kelangkaan sumberdaya perikanan dan faktor penyebabnya

Click here to load reader

Post on 03-Jul-2015

2.016 views

Category:

Documents

51 download

Embed Size (px)

DESCRIPTION

Ikan sebagai sumber makanan protein hewani tidak akan pernah terlepas dari seberapa besar tingkat konsumsi ikan dunia. Oleh karena itu seiring dengan pertumbuhan populasi dunia, konsumsi ikanpun semakin meningkat dari tahun ke tahun. Berdasarkan data dari Badan Pangan Dunia (FAO), konsumsi ikan dunia telah meningkat dua kali lipat sejak tahun 1973 dan negara-negara berkembang mengambil peran penting dalam masalah ini. China dengan dominasi dalam faktor pendapatan dan kependudukan, telah mendominasi konsumsi ikan dunia dan menggeser posisi jepang, dimana konsumsi ikannya sebanyak 36% dalam tahun 1997 dan dibandingkan hanya sekitar 11% di tahun 1973. Sementara jepang ditahun yang sama menurun dari 24% menjadi tinggal 11%.

TRANSCRIPT

MAKALAH KELANGKAAN SUMBERDAYA PERIKANAN DAN FAKTOR PENYEBABNYA Disusun oleh : AIrita Jayati Sudiarto 4443090140 JURUSAN PERIKANAN FAKULTAS PERTANIAN UNIVERSITAS SULTAN AGENG TIRTAYASA 2011

KATA PENGANTAR SegalapuiimarilahkitapaniatkankehadiratAllahSWTyangtelah memberikankitasemuakesehatandankepadaseluruhparapengikutnya.Saya sangatbersyukuratas tugasmatakuliahEkonomi Sumberdaya Perikanandengan iudulKelangkaanSumberdavaPerikanandanFaktorPenvebabnvayangdapat saya selesaikan dengan baik.Namunsayasebagaipenulismakalahinimasihiauhdarisempurnadan masihbanyakkekurangan.Olehkarenaitu,besarharapansayaataskritikdan saran yang membangun untuk makalah ini.Akhirkata,sayaberharapsemogatuiuanpembuatanmakalahinidapat tercapai sesuai dengan yang diharapkan. Dan semoga iuga pembahasan yang saya susuninibermanIaatbagiparapembacadanmampumenambahwawasandan pengetahuaan. Wassalam Serang,Februari 2011 Penulis

DAFTAR ISI Kata Pengantar DaItar Isi Bab I : Pendahuluan I.1Latar Belakang.................................................................................. 1 I.2IdentiIikasi Masalah...........................................................................2 I.3Tuiuan.................................................................................................2 1.4 ManIaat...............................................................................................2 Bab II : Kaiian Pustaka II.1Ekonomi Perikanan............................................................................3 II.2Sumberdaya Perikanan.......................................................................4 II.3Kelangkaan........................................................................................6 II.4Kelompok pesimis dan optimis terhadap sumber daya alam.............7 II.5Mengukur kelangkaan sumber daya alam........................................10 Bab III : Pembahasan III.1Kondisi Perikanan di Indonesia......................................................13 III.2Kelangkaan Sumber Daya Perikanan di Beberapa Tempat di Indonesia dan Faktor Penyebabnya................................................19 III.2.1 Over Fishing di Perairan Cilacap Menyebabkan Hasil Tangkapan Nelayan Terus Menurun..................................19 III.2.2 Ancaman kepunahan ikan Endemik Indonesia...................21 III.2.3 Banyaknya Perburuan Ikan Hiu di Laut Meniadi Salah Satu Penyebab Kelangkaan Iakan di Perairan Indonesia...........24 III.2.4 Fenomena ilegal Iishing dan Ironi negara bahari................25 III.2.5 Nelayan kita yang merana...................................................27 III.3 Alasan Mengapa Sebagian Besar Perikanan Dunia OverIishing.....28 III.4 Sumber Daya Alam dan Pertumbuhan Ekonomi.............................34 Bab IV : Kesimpulan..............................................................................................40 DaItar Pustaka Lampiran

BAB I PENDAHULUAN I.1Latar Belakang Duniatelahmengakui,bahwaindonesiaadalahnegarakepulauan terbesar di dunia, dimana terdiri dari 17.508 pulau, dengan garis pantai sekitar 81.000km. Indonesiamemilikiluaswilayah lautansekitar5,8iutakm2 atau sekitar70dariluastotalteritorialIndonesia.DenganpotensiIisikini, tentunyakitaharusberbanggaataspotensiini,sertamampumengelolanya denganbaik.Sayangnya,denganpotensiyangcukupbesarini,kita(bangsa indonesia)belummampumenuniukankerdiriannyasebagaibangsabahari. Indikasinyasangatielas,sampaisaatinimasyarakatkitayangberproIesi sebagainelayanmasihhidupdibawahgariskemiskinan.Harusnyadengan potensikekayaanbaharitersebut,sudahmampumembuatbangsaini seiahtera. Inimerupakanbuktikegagalanpemerintahkitadalampengelolaan sektorkelautandanperikanan.Sekaligusmengindikasikanperhatian pemerintah terhadap sektor ini masih dipandang sebelah mata.Apapasalyangmembuatbangsainibelummapandalamsektor bahari?Indikasikecilnya adalahbelumadanyakesadarankolektiIbangsaini akanartipentingnyasektorkelautankita.Darisegipengambilkebiiakan misalnya,departemenyangsecarakhususmenanganimasalahkebaharian yaknikementerianKelautandanPerikanankitabaruadapascatumbangnya ordebaru. Itubaru padapersoalanpenentukebiiakan. TentunyapotensiIisik tersebutbukanlahhanyameniadikebanggaansaia.Akantetapipotensiitu harusdikelolauntukkepentingandankemakmuranrakyat.Sayangnya, sampaisekarangpotensisumberdayaperikanankitamasihbelumdikelola secara eIektiI dan banyaknya nelayan yang menangkap ikan secara berlebihan tanpa memperhatikan lingkungan. Akibatnya, teriadi kelangkaan sumber daya perikanandibeberapadaerahdanpadaakhirnyamenyebabkankepunahan spesiesdisuatudaerahdiIndonesia.Padahal,kitasebagainegaramaritim harussadarakankekayaannegarakitayangharuskitaiagadenganbaik,

terutamaikanlangkayang terancampunahdanyangseharusnyadilestarikan dandilindungi.Jikateriadikelangkaansumberdayaperikanan,makaharga produksipunakannaikdanpadaakhirnyahargaikandipasaranpun meloniak. Hal inilah yang melatar belakangi saya menulis makalahmengenai kelangkaan sumber dava perikanan dan faktor penvebabnva. I.2IdentiIikasi Masalah IdentiIikasi masalah dari iudul makalah ini, yaitu : a. Teriadinya kelangkaan sumberdaya perikanan di beberapa daerah di Indonesia. b. Meningkatnya harga dikarenakan teriadinya kelangkaan sumber daya perikanan. c. Banyaknya spesies ikan langka yang langka punah di Indonesia. d. Banyak Faktor yang menyebabkan teriadinya kelangkaan sumber daya perikanan yang kurang diperhatikan oleh pemerintah. I.3Tuiuan Tuiuandaridisusunnyamakalahini,yaituuntukmemenuhitugas pengganti uiian tengah semester mata kuliah ekonomi sumber daya perikanan Dandapatmengetahuikelangkaansumberdayaperikananyangrenewable danIaktorpenyebabnya.Selainitupulauntukmenambahwawasandan pengetahuan kepada para pembaca. I.4ManIaat ManIaatdaridisusunnyamakalahini,yaitudapatmenambah wawasandanpengetahuanmengenaiIaktorpenyebabkelangkaansumber daya perikanan.

BAB II KA1IAN PUSTAKA II.1Ekonomi Perikanan Ekonomimerupakansalahsatuilmusosialyangmempelaiari aktivitasmanusiayangberhubungandenganproduksi,distribusi, pertukaran, dan konsumsi barang dan iasa. Istilah "ekonomi" sendiri berasal darikataYunaniokoc(oikos)yangberarti"keluarga,rumahtangga"dan vooc(nomos),atau"peraturan,aturan,hukum,"dansecaragarisbesar diartikansebagai"aturanrumahtangga"atau"manaiemenrumahtangga." Sementarayangdimaksuddenganahliekonomiatauekonomadalahorang menggunakankonsepekonomidandatadalambekeria.Manusiasebagai makhluksosialdanmakhlukekonomipadadasarnyaselalumenghadapi masalahekonomi. Inti darimasalahekonomi yang dihadapi manusia adalah kenyataanbahwakebutuhanmanusiaiumlahnyatidakterbatas,sedangkan alatpemuaskebutuhanmanusiaiumlahnyaterbatas.Tindakanekonomi adalahsetiapusahamanusiayangdilandasiolehpilihanyangpalingbaik dan paling menguntungkan. Tindakan ekonomi terdiri atas dua aspek, yaitu : O TindakanekonomiRasional,setiapusahamanusiayangdilandasioleh pilihan yang paling menguntungkan dan kenyataannya demikian. OTindakanekonomiIrrasional,setiapusahamanusiayangdilandasioleh pilihanyangpalingmenguntungkannamunkenyataannyatidak demikian. MotiIekonomiadalahalasanataupuntuiuanseseorangsehingga seseorangitumelakukantindakanekonomi.MotiIekonomiterbagidalam dua aspek: OMotiI Intrinsik, disebut sebagai suatu keinginan untuk melakukan tidakan ekonomi atas kemauan sendiri.

OMotiIekstrinsik,disebutsebagaisuatukeinginanuntukmelakukan tidakanekonomiatasdoronganoranglain.Padaprakteknyaterdapat beberapa macam motiI ekonomi: OMotiI memenuhi kebutuhan OMotiI memperoleh keuntungan OMotiI memperoleh penghargaan OMotiI memperoleh kekuasaan OMotiI sosial / menolong sesama EkonomiPerikananmerupakanbagiandariilmuekonomiumum yangmempelaiariIenomenadanpersoalanyangberhubungandengan bidangperikanan.PerikanansendirimenurutUndang-undangnomer31 tahun2004pasal1ayat1yaitu Semuakegiatanyangberhubungandengan pengelolaandanpemanIaatansumberdayaikandanlingkungannyamulai daripraproduksi,produksi,pengolahansampaidenganpemasaranyang dilaksanakandalamsuatubisnisperikanan.Sedangkanikanmenurut undang-undangnomer31tahun2004pasal1ayat2yaitusegalaienis organismeyangseluruhatausebagiandarisiklushidupnyaberadapada lingkungan perairan. Karena ikan dan segala ienis organismeyanghidupdi lingkunganperairanmemilikinilaiekonomisataumerupakansumber ekonomiserta adanyaperilakuekonomi,maka terdapatekonomiperikanan yangkemudiantimbulpermintaandanpenawaran.Perilakuekonomiitu sendiriyaitubagaimanacaramemenuhikebutuhanmanusiaagarmencapai kepuasandenganmemanIaatkansumberdayayangterbatasnamunsarana untukmemenuhikebutuhanituterbatas.Olehkarenaitumanusiaatau masyarakatharusmelakukanpilihandalammenggunakanalatpemuas kebutuhanatausumberdayaitudaniugamemilihdiantarakebutuhanyang harusdipenuhinya.Alatpemuaskebutuhanitudapatdisebutsebagai sumberdaya, barang konsumsi maupun barang produksi. II.2Sumberdaya PerikananSumber daya alammerupakan segala sesuatu yangberada dibawah maupundiataspermukaanbumitermasuktanahyangsiIatnyamasih

potensialsertasiIatnyabelumdilibatkandalamprosesproduksiuntuk meningkatkan tersedianya barang dan iasa dalam perekonomian. Sedangkan barang sumber dayamerupakan sumber daya alamyang sudah diambil dari dalamataudariataspermukaanbumidansiapdigunakanserta dikombinasikandenganIaktor-Iaktorproduksilainsehinggadapat dihasilkanprodukbaruyangberupabarangatauiasabagikonsumen maupun produsen. Barang sumber daya yang dipakai dalam proses produksi dapatmeningkatkanproduksibarangdaniasabiladikombinasikandengan Iaktor produksi lain. SedangkanyangdimaksuddenganPerikananmenurutUndang-undangnomer31tahun2004pasal1ayat1yaituSemuakegiatanyang berhubungandenganpengelolaandanpemanIaatansumberdayaikandan lingkungannyamulaidaripraproduksi,produksi,pengolahansampai denganpemasaranyangdilaksanakandalamsuatubisnisperikanan.Jadi sumber daya perikanan merupakan segala sesuatu yang berada disekitar laut atau perairan termasuk terumbu karangiuga pohonmangrove yang siIatnya masih potensial serta siIatnya belum dilibatkan dalam proses produksi untuk meningkatkantersedianyabarangdaniasadalamperekonomian.Sumber daya perikanan merupakan sumber daya yang dapat diperbaharui (renewable resources Ilow resources).Pada dasarnya sumber daya alam itu dapat dikelompokkan meniadi duakelompokutama,yaitukelompoksumberdayaalamyangtidakdapat diperbaharui(exhaustibleresourcesstockresourcesIundresources) contohnyabarangtambangyangadadidalamperutbumisepertiminyak bumi,batubara,timahdannikel.manusiaharusmenggunakanSDAini seeIisienmungkin.Sebab,sepertibatubara,baruakanterbentukkembali setelahiutaantahunkemudian.SumberdayainimempunyaisiIatbahwa volumeIisikyangtersediatetapdantidakdapatdiperbaharuiataudiolah kembali.Untukteriadinyasumberdayaienisinidiperlukanwakturibuan tahun.Yangkeduayaitusumberdayaalamyangdapatdiperbaharui (renewableresourcesIlowresources).SumberdayainimempunyaisiIat terus-menerusadadandapatdiperbaharuibaikolehalamsendirimaupun

denganbantuanmanusia.Dalamhalini,ikanmerupansumberdayaalam yangkategoriini.WalaupunsumberdayainimempunyaisiIatterus menerusada,namuniikasumberdayaalamtersebuttidakdikeloladengan baikmakaakanmenimbulkankelangkaan.Sepertipendapatkelompok pesimisterhadapsumberdayaalamyaitu'Sumberdayaalamituterbatas adanya,sehinggaapabilaterusmenerusdiambilmakacadangannyamakin lama akan semakin menipis dan sampai pada saatnya pasti akan habis. II.3Kelangkaan Manusiadalammemenuhikebutuhanhidupnyatidakpernahada puasnya.Kebutuhanmanusiaberanekaragamdanterus-menerusada.Hari keharikebutuhanmanusiasemakinbertambahbanyakbaikiumlah,mutu, dancoraknya.Pertambahannyaitutidaksebandingdengansumberdaya yangtersedia.Olehkarenaitu,akanadasebagianorangyangtidak mendapatkanalatpemuaskebutuhanyangdiinginkan,entahkarenatidak mampumengeluarkanpengorbananyangdisyaratkan(biayatidak teriangkau)ataukarenabarangsudahhabis.Kondisitersebutdapatdisebut sebagai kelangkaan. Jadi kelangkaan dapat diartikan situasi atau keadaandi manaiumlahsumberdayayangadadirasakankurangatautidakcukup untukmemenuhikebutuhanmanusia.Paraekonomterbiasamengartikan katalangkadengankeadaandimanaiumlahbarangyangdimintalebih banyakdaripadaiumlahbarangyangditawarkanatauyangdisediakandan dalampasarpersainganbsempurna,kelangkaaniniakanmenyebabkan hargabarangyangbersangkutannaik.Dalamkaitannyadengansumber dayaalam,persediaanitudihadapkanpadatingkatkonsumsisumberdaya alampertahununtukmemperkirakanberapalamalagiiumlahcadangan tersebut akan dapat dikonsumsi untuk menopang kehidupa manusia.Menurut ilmu ekonomi, kelangkaan mempunyai dua makna, yaitu terbatas, dalam arti tidak cukup dibandingkan dengan banyaknya kebutuhan manusiadanterbatas,dalamartimanusiaharusmelakukanpengorbanan untuk memperolehnya.

II.4Kelompok pesimis dan optimis terhadap sumber daya alam Mengenaiseiauhmanasumberdayaalamitudapatmelayani kebutuhan manusia ada dua kelompok pemikir yang masing-masing berbeda pendapat. Satu kelompokmerasa optimis terhadap tersedianya sumberdaya alam dan kelompok satu lagi merasa pesimis. a. KelompokPesimis,kelompokinimenyatakanbahwaSumberdaya alam itu terbatas adanya, sehingga apabila terus menerus diambilmaka cadangannyamakinlamaakansemakinmenipisdansampaipada saatnya pasti akan habis. Pemikiran yang pesimis ini sudah diawali oleh tokoh-tokohekonomi terkenal sepertiAdam SmithdanDavid Ricardo. DemikianpulaThomasRobertMalthussudahmelihatlebihawal bahwapertumbuhanpendudukakanselalumengikutideretukur, sedangkan pertumbuhan pemuas kebutuhan manusia, khususnya pangan akanmeningkat sesuai denganderethitung, sehinggamanusiadimuka bumiinipadasuatusaatakanmengalamikekuranganbahanmakanan dan alat pemuas kebutuhan lainnya. Tersedianyasumberdayaalamdibumiiniadalahterbatas baikdalamartikuantitasmaupundalamartikualitas.MenututDavid Ricardo,manusiaselalumenggunakansumberdayaalamyangpaling tinggikualitasnyaterlebihdahulu.Kemudiankarenakuantitassumber dayayangtinggikualitasnyainiakanhabis,manusiaberalih menggunakansumberdayaalamyanglebihrendahkualitasnya. Keiadianiniakanberlangsungterussampaipadapenggunaansumber dayaalamyangsangatmarginalkualitasnya.Sebagaiakibatnyabiaya pengambilanataupengolahanakansemakinmeningkatdanpada gilirannyahargabarang-barangsumberdayaituakanmeniadimahal. Kelompokpesimisinikhawatirakanadanyakelangkaansumberdaya alamyangdariharikeharisemakinberatdirasakan.Peranan perkembanga teknologi dan transportasi telah dilupakan oleh kelompok pesimisini,bahkanmerekamengirabahwaperkembanganteknologi iustruakansemakinmengurasadanyasumberdayaalamyangadadi bumi ini.

Pendapat-pendapatkelompokpesimistersebutyaitusebagai berikut : 1. Duniainiterbatasadanya,sehinggaterbataspulalahsumberdaya alamyangadadaninimembatasipulatersedianyabarang-barang produksi bagi kebutuhan manusia. 2. Hampir semuakegiatanproduksi saatinipertumbuhannyabersiIat eksponensial,artinyapenggaliansumberdayaalamiugaakan semakin cepat peningkatannya. 3. Produksibarangdaniasapastiakanberhentiapabilabatas cadangan sumber daya alam itu sudah tercapai. 4. Batascadanganituakansegeratercapai,iikapolakonsumsi sumber daya alam tidak kembali. 5. Dampakyangtimbuldalammasyarakatadalahbahwadalam proses menuiu batas pertumbuhan tersebut bersiIat kehancuran. 6. Akhirnyakitaharusberusahauntukmengubahtendensi pertumbuhanyangsiIatnyaeksponensialitudanmembatasi kegiatanmanusiasesuaidenganbatasan-batasanalamiahyang berupacadangansumberdayaalamdankualitaslingkungan tertentu. Dariuraiandiatastampakkemaiuanteknologiakanmendorong pertumbuhanekonomisemakinpesatlagi,namundenganadanya peringatandarikelompokRoma,manusiaharusdapatmenentukan bataspertumbuhanekonomisendiriyangpadagilirannyaakan membatasi tingkat pengambilan sumber daya alam. Suatu alternatiI lain ialahdapatsaiaperekonomianberkembangterus,tetapiharus ditemukanteknologiyangakanmenghematpenggunaansumberdaya alam.Dengandemikiankelompokpesimisiniwalaupuncemas terhadapperkembanganekonomidunia,namuntidakberartibahwa merekainiputusasabahkaniustrumenyarankanagardicariialan keluarnya.Memangduniainiterbatasadanya,banyaksumberdaya alamyangtidakdapatdiperbaharuimendekatititikkehabisan

cadangannyadanbanyaksumberdayaalamyangdapatpulihtelah diperdagangkan secara berlebihan (over used).b. KelompokOptimis.Kelompokiniberpendapatbahwasumberdaya alamitutersediamelimpahdantidakakanpernahhabis,lebih-lebih untuksumberdayaalamyangdapatdiperbaharui.Memangkelompok optimismengakuiadanyapencemaranyangsemakinmembahayakan manusia,sehinggaperludiambilsuatutindakanuntukmencegahnya. Namunkelompokinibelummelihattanda-tandaakanmenipisnya persediaansumberdayaalam,bahkansebaliknyacadangansumber dayaalamitudikatakanmasihcukupbanyak.Dankelompokini membantahpendapatdarikelompokpesimisyangmengatakanbahwa 'Perananperkembanganteknologiakansemakinmengurassumber dayaalamyangadadibumiini.Dalamhalinikelompokoptimis menyatakanbahwaperkembanganteknologitidakmengurassumber dayaalam,namuniusruakanmengurangipengurasansumberdaya alam dengan memberikan penielasan sebagai berikut : 1. fisiensiperkembanganteknologidalambentukpenemuancara-caraproduksibarudapatberupapenghematanpenggunaanbarang-barangsumberdayaalamsebagaimasukandalamprosesproduksi dengan iumlah Iaktor produksi lain tetap. 2. aurulang(recvcle)denganteknologibarusumberdayaalamitu dapatdigunakanberulangkalilewatprosespengolahankembali limbah produksi. 3. ksplorasidenganteknologibaruakanlebihmudahditemukan cadangansumberdayaalambaru,sehinggameningkatkaniumlah persediaan sumber daya alam. 4. Substitusidenganteknologibaruakanlebihdimungkinkanuntuk menemukansumberdayaalampenggantiatausumberdayaalam alternatiI,sehinggadimungkinkanadanyakonservasisumberdaya alam. Lebihlaniutdikatakanbahwatanpaadanyateknologibaru,maka sumberdayaalamyangadatidaklebihdaribarangrongsokansaia.

Akhirnyakelompokoptimismenyarankanagarsumberdayaalam diusahakandengancarayanglebiheIisien,yaitudengantingkat produksitertentudigunakansumberdayaalamyangsedikitmungkin daniugaderaiatpencemaranlingkunganyangminimal.Kelompokini iugatidakmenolakbahwapengambilansumberdayaalamyang berlebihan akan merusak potensi sumber daya alam itu sendiri. II.5 Mengukur kelangkaan sumber daya alam Persediaan(reserve)ataucadangan(stock)sumberdayaalam merupakansumberdayaalamyangsudahdiketahuidanterbuktibaikdari segiiumlahataubesarnyadeposityangdiukurdalamsatuan-satuanseperti ton,m3,barreldantelahdiketahuipulamanIaatnyasertalangkaadanya (bernilaiekonomis).Cadangansumberdayaakanmeningkatbilateriadi penemuanbaru(discoverv),peningkatancadanganyangtelahterbukti (extension)danrevisi(revision)cadangansebagaiakibatperkembangan inIormasimengenaikondisipasardanteknologibaru,yangkemudiandapat mengubah sumber daya alam yang tidak ekonomis meniadi sumber daya alam yangekonomis.Namun,sayangnyasulituntukmengetahuivolumeIisik, lokasi,maupunkualitassumberdayaalamsecaratepat,sehinggasulitpula untuk menentukan deraiat kelangkaan sumber daya alam tersebut. Untukmengetahuilangkatidaknyasumberdayaalamdibumiini, paraahliekonomimenggunakanberbagaicaraataualatpengukurdalam bidangilmunya,yaitudenganmelihathargabarangsumberdayaalamdan nilaisewaekonomisataueconomicrent(Fishier),ataumelihatsatuanbiaya produksibarangsumberdayaalamitu(BarnettdanMorse,Scarcitvand Growth,hal.149),dandapatpuladenganmelihatroyalty(economicrent) maupun elastisitas substitusi. Cara-cara tersebut yaitu antara lain : a. Biaya ProduksiBaikekonomklasik(Ricardo)maupunNeoKlasik(Jevons) melihat bahwa peningkatan biaya produksi berhubungan dengan semakin berkurangnyapersediaanataucadangansumberdayaalam.Memang barang sumber daya alam seiak adanyamanusiadi bumi ini sudah terus-

menerus diambil atau dieksploitasi. Pada umumnya orang percaya bahwa sumberdayaalamsecaraekonomismemanglangkadandengan berkembangnyawaktusumberdayaalamitumeniadisemakinlangka dan ini akan mangganggu kehidupan manusia dan pertumbuhan ekonomi. Namun,dalamstudiBarnettdanMorseitu,dikemukakanbahwateori klasikmengenaimeningkatnyakelangkaansumberdayaalamitutidak dapat diterima, kecuali dalam hal yang sangat terbatas atau tertutup. BarnettdanMorsemembuathipotesistentangkelangkaan sumberdayaalamyaitubahwasumberdayaalamitusemakinlangka apabila : 1. Biaya riil unit output meningkat terus selama periode pengambilan. 2. BiayaproduksikomoditiyangdiambilrelatiIlebihtinggidaripada biaya produksi komoditi lain. 3. HargakomoditiyangdiambilrelatiIlebihtinggidaripadaharga komoditi lain. Barnett dam Morse menaIsirkan penemuannya itu sebagai akibat dariperubahanteknologidankeuntungandariskalaekonomi(economic ofscale).Perkembanganteknologisangatmenyolokdibidangsumberdaya mineral, khususnya banyak mesin-mesin yang menggantikan tenaga manusiadaniustrubanyakpulakapitaldantenagakeriayang menggantikan antara berbagai sumber daya alam itu sendiri.b. Harga barang sumber daya alam Kelangkaansumberdayaalamdapatdilihatdarihargabarang sumberdayayangsemakinmeningkatmaupundilihatdarirovaltiatau rent. Rent adalah harga bayangan satu unit barang sumber daya yang ada dalamcadangan(stock).Bilaseseorangtertarikpadakelangkaanmaka rentlebihtepatsebagaialatpengukurnya.Namunapabilasesorang berminatuntukmengetahuibanyaknyapengorbanandalammamperoleh barangsumberdayaalam,makahargalebihtepatsebagaiindikatornya karenahargasudahmencakupbiayaproduksidanrent.Selaniutnya karena rent sulit untuk diamati maka harga lebih banyakdipakai sebagai

indikatorbaikuntukmelihatkelangkaanmaupunpengorbananguna menghasilkan barang sumber daya alam. Harga barang sumber daya relatiI lebih baik daripada biaya per unit sebagai pengukur kelangkaan sumber daya alam karena : 1. Hargariilbarangsumberdayalebihmelihatkedepandan mencerminkanadanyabayayangdiharapkandimasadatangbaik untuk eksplorasi, penemuan, maupun pengambilan. 2. Kemaiuanteknologimengalihkantanda-tandakelangkaansumber daya alam yang dituniukkan oleh harga riil barang sumber daya.3. Hargariiltidakmenuniukkanadanyakecenderungansemakin langkanyasumberdaya alamyangmamilikisumberdayapengganti (substitusi). 4. Hargariilsumberdayadapatmeningkatataupunmenurun,yang berartimenuniukkanadanyakelangkaanatauberkurangnya kelangkaan,tergantungpadahargamanayangdipakaiuntuk membuat angka indeks (price deflator). c. Nilai sewa dari sunber daya alam (economic rent) atau nilai sumber daya alamditempatnya(insituresources),merupakanalatpengukuryang ketiga terhadap kelangkaan sumber daya alam. Nilai sewa ini lebih tepat menggambarkankelangkaansumberdayaalamdaripadaduacara sebelumnya.Nilaisewa(economicrent)sumberdayaalampada umumnyameningkatdalambeberapapuluhtahunterakhir,tetapibiaya produksi dan harga barang iustru menurun. NamunterdapatkelemahanpadapendekatanIisikmaupun secaraekonomis.PendekatansecaraIisiktidakmemilikikepastian mengenaibesarnyacadangan,sedangkanpendekatansecaraekonomis memilikikelemahanyaitubilamekanismepasartidakdapatbekeria secarasempurna.Olehkarenaitumasihsulituntukmemastikankondisi darisumberdayaalamitu,apakahmasihmelimpahatausudahlangka adanya,walaupunkitamengetahuisecarapastibahwapengambilannya telahdilakukansecaraterus-menerusbahkandenganlaiuyangsemakin meningkat.

BAB III PEMBAHASAN III.1Kondisi Perikanan Indonesia KondisiterkiniperikananIndonesiasebenarnyaberadadalam krisis.Terkadangdata-datayangadatidakseialandengankenyataanyang teriadidilapangan.Potensisumberdayakelautankitayangbesartidak meniadikannelayankitaberhentiberteriakkesulitantangkapan.Konsumsi ikannasional,volumeeksporikannasional,danvolumetangkapanikan ilegalyangtidakdilaporkan(unreported)meniadimasalahpraktek penghisapansumberdayaperikananIndonesia.Kondisiinidiperparah denganlemahnyapengawasanpemerintahdanaparatkeamanan.Apabila tidakditanganaiseriustentusaiadikhawatrikanakanmeniadikonIlik horizontalyang dapatmenimbulkanancamankeamanan,ketidakstabilan, dan kemiskinan.Ikansebagaisumbermakananproteinhewanitidakakanpernah terlepasdariseberapabesartingkatkonsumsiikandunia.Olehkarenaitu seiringdenganpertumbuhanpopulasidunia,konsumsiikanpunsemakin meningkatdari tahunke tahun.Berdasarkandata dariBadan PanganDunia (FAO), konsumsi ikan dunia telah meningkat dua kali lipat seiak tahun 1973 dannegara-negaraberkembangmengambilperanpentingdalammasalah ini.ChinadengandominasidalamIaktorpendapatandankependudukan, telahmendominasikonsumsiikanduniadanmenggeserposisiiepang, dimanakonsumsiikannyasebanyak36dalamtahun1997dan dibandingkanhanyasekitar11ditahun1973.Sementaraiepangditahun yang sama menurun dari 24 meniadi tinggal 11.

Gambar1.Gambaranperbandingankonsumsiperikananduniatahun1973 dan 1997 (Sumber,FAO 1997) Saat ini lebih kurang seperempat bagian dari ikan yang dikonsumsi olehpendudukduniaadalahberasalprodukbudidayadanpersentaseini akan terus meningkat, sementara produk hasil tangkapan dari laut dan danau akanterusmenurundisebabkanoverIishingdankerusakanlingkungan. Penurunaniniteriadiselama10tahun(1970sampai1980an),dimana penangkapanikandilakukansecarabesar-besaransebagaihasildari perluasan areapenangkapan,penerapan teknologi penangkapan terbarudan meningkatnyainveastasipadasektorini.Akibatnyaprodukikandarihasil penangkapan meloniak taiam dari 44 iuta ton di tahun 1973 meniadi 65 iuta ton di tahun 1997. Kondisi ini menyebabkan operasi penangkapan ikan telah meniadikaneksploitasiyangberlebihdilaut.Olehkarenaituharapan kedepandariproduksiperikananduniatertumpupadaaktivitasbudidaya ikanyangpadadasarwarsainilebihdiarahkankebidangbudidayalaut. Budidayaikansaatinimenyumbangsekitar30daritotalproduksiikan dunia.Indonesiayangmemilikigarispantaiterpaniangkeduadidunia (81.000km)setelahKanadadankekayaanalamlautyangbesardan beranekaragamtelahmeniadikanIndonesiasebagaisalahsatunegarayang berpotensibesardalambidangperikanan.Namun,sepertihalnyakondisi

perikanandunia,kondisiperikanantangkapIndonesiaiugasemakin menurun dari tahun ke tahun.

Gambar3.Rata-ratatahunanhasilperikanantangkapdanproduksitotal perikanan budidaya di Indonesia tahun 1984-1999. Peningkatanrata-rataproduksibudidayaikantahunanlebihtinggi dibandingdenganpeningkatanaktivitaspenangkapan.Sebagaicontoh,dari tahun1986-1991,produksiikandariperikanantangkapmeningkatsebesar 5, sementara pertumbuhan tahunan dalam produksi budidaya adalah 8.5.

Sebagai negarayangmengklaimdirinya sebagainegaramaritim,Indonesia belum begitumengapresiasi terhadapmomentumhari perikanan dunia yang bertepatanpadatanggal21Nopember.Sebuahperingatanyangberupa perayaan(celebration)mungkinkurangdianggappentingbagisebagian orang.Tapisebagaisebuahkreativitaskebudayaan(kultural),masyarakat kitasangatkayadenganacara-acaraperayaanini.Adanilaiyanghendak diusung, dilestarikan, dan diwariskan. Ada harapan yang ingin dipupuk, dan cita-citayanghendakdiraih.Karenaitu,takheraniikaritualsepertimerti laut. petik laut. sedekah laut, sebagai apresiasikulturaluntukmenghormati alam atau mensyukuri anugerah Tuhan masih dipertahankan oleh masyarkat kita yang hidup di daerah pesisir. Hanya saia, apresiasi secara nasional oleh negarakita,yangdiIasilitasiolehpemerintahbelumadaseiauhini.Tapi bukansoalacararitualyanghendakkitapermasalahkanseiringdengan momentumhariperikananduniaini.Melainkan,kitaperlumelihatseperti apakondisiperikanankita.BagaimanaposisiIndonesiadiantara pertarunganglobalduniaperikanan?Sepertiapanasibmasyarakat perikanankita?Lantas,apatantanganyangharuskitahadapiterhadap masalahini?Itulahberbagaipertanyaanyangpatutkitaiawabsecara bersama sebagai sebuah bangsa maritim.PemerintahIndonesiabolehbanggaatasprestasiperikanannya selamaini.Indonesiamerupakansupplier40kebutuhanikannegara Amerika.SelainThailand,ChinadanSingapuraKitaiugamenduduki peringkat10besar,yakniperingkatke-8negaraeksportirikanAsiauntuk pasar Eropa. Namun, pasar ini iuga sangat rentan terhadap krisis yang masih melandaduniasekarangini.Akibatkrisiskeuanganglobal,Departemen Kelautandan Perikanan(DKP)memperkirakaneksporperikananIndonesia stagnan,yaknisebesarUS$2,6miliar.Permintaandipasarutama,yakni AmerikaSerikat,UniEropa,danJepangturunakibatkrisiskeuangan global.Pelemahanpasareksporikandipastikanakanmenyebabkan persaingandengannegarapengeksporlainnyasemakinketat.Selamaini, eksporkepasarutamamencakup 70persenatausekitarUS$1,82miliar pada2008.Jumlahtersebutmerosot15persentahunini,meniadisekitar

US$1,54miliar.Kemerosotanyangteriadidalamperdaganganglobal perikanan ini disebabkan oleh menurunnya kapasitas penangkapan ikan oleh paranelayankita.CuacaburukyangteriadidiperairanIndonesia mengakibatkanparanelayanberhentimelaut.Ditambahlagistockikandi lautyangmenurundrastisakibatpenangkapanberlebih(overfishing) meniadi penyebab utama penurunan hasil tangkapan tersebut.Ketidakstabilanpasar,kecenderunganpenawarandanpermintaan ikanyangIluktuatiI,itulahalasankitatidakperlubanggaterhadapprestasi selamaini.Bahkankalaukitasalahlangkahdantidakhati-hatidalam menerapkankebiiakanperikananbisaIatalakibatnya.Lagipulakitaiuga perlubertanya,iikahasileksport tersebutdianggapsebagaiprestasi,seiauh manacapaiantersebutdapatdinikmatiuntukkeseiahtaraanrakyat Indonesia?Bolehlahitudianggapprestasidalammenyumbangkan pendapatannegara.Tapiapagunanyaiikatidakbisadinikmatirakyatnya. Nyatanya,kehidupanparanelayanyangterhamparsepaniangpesisir kepulauanIndonesia,hidupmerekamakinharimakinburukkondisinya. Itulahmengapakitaperlumeniniau ulangkebiiakanorientasiekspordalam sektor perikanan kita. Apalagi iika kebutuhandi dalamnegeri belum cukup terpenuhi.DirienPengolahandanPemasaranHasilPerikananDepartemen KelautandanPerikanan(DKP)menengaraibahwaIndonesiamasih mengimpor ikan patin dan ikan kembung untuk memenuhi kebutuhan dalam negeri.Indonesiasetiaptahunharusmengimporikanpatinsebanyak1.300 tonpertahundariVietnam,sedangkanikankembungharusdiimpordari Pakistanuntukmemenuhikebutuhandalamnegeri.Indonesiadengan iumlahpendudukyangsangatbesarmerupakanpasaryangmenianiikan. Selamaini,masyarakatIndonesiasendiribelumbanyakyang mengkonsumsiproteinyangbersumberdariperikanankita.Ikandengan kualitasproteinyangtinggilebihseringmeniadiprimadonauntuk komoditasekspor.Fenomenainibisadikatakansebuahironi.Pemerintah haruslebihpekaterhadapmusimikanuntukmengawasikelangkaandan

kelebihanikan antarwilayahuntukmemastikanikankitadapat terpasarkan didalamnegeri.Olehkarenaitu,rencanaDKPuntukmenerapkansistem buka-tutupdalamkebiiakaneksporikandi2010perludisambutbaik. Rencananya,pemerintahakanmembangunmegacoldstorageuntuk menyimpankelebihanpasokanikandidalamnegeri.Ikan-ikanutuhhasil tangkapan dalam negeri bakal diekspor dengan sistem buka tutup. Sehingga, saatpasokanikandidalamnegeriberlebih,makasimpananikandalam mega cold storage akan dibuka untuk dilemparkan ke luar negeri. Ikan-ikan tersebutakandiekspordalambentukutuh.Selamapasokanikanuntuk industripengolahanikandidalamnegerikurang,makapintueksporikan akanditutuplantaranuntukmemenuhikebutuhanindustripengolahanikan dalam negeri. Pembangunan mega cold storage direncanakan di tiga lokasi; yaituPelabuhanSamuderaBitung,PelabuhanSamuderaMuaraBarudan PelabuhanSamuderaSurabaya.Sembarimenguruspasarsendiri,kitabisa lebihmemperhatikanperkonomiannelayan.Mengingatperdagangandi tingkatlokaliugatidakkalahpentingnyauntukditangani.Sudahbegitu lama tempat pelelanganikan(TPI)didaerah pesisirdibiarkan terbengkelai. Akibatnya,paratengkulakpembururentebebasmemainkanhargaikan. Nelayanmakinmenderitaakibatperdaganganyangdikuasairenternir. Padahalmerekamasihharusmerasakanmahalnyabiayauntukkebutuhan melaut.Inimemangmasalahklasik,tapibukanberartiharusdiabaikan. Justru harus terus-menerus dicari solusi penataannya yang tepat. Masalah ini harussegeradituntaskan,karenaiikapemerintahtidakdapat memberdayakannelayandantidakbisauntukmenuntaskankemiskinan nelayan,makadapatteriadikelangkaansumberdayaperikanan,karena sesungguhnyakelangkaansumberdayaalamyangkemudianmenimbulkan kepunahanitupadadasarnyadapatdisebabkanolehadanyaduakelompok masyarakat, yaitu1. Kelompokkapitalisyangbekeriauntukmemaksimumkanlaba, sehingga merekainiberusahauntukmenggalisumberdayaalamsebanyak mungkin dalam iangka waktu tertentu.

2. Kelompokmiskinyangterpaksamengurassumberdayaalamuntuk memenuhikebutuhanhidupnyayangsubsisten.Karenakemiskinannya kelompokinitidakmemperhatikankelestarianlingkunganyang sesungguhnyaadalahtempatmerekamenumpanghidup.Masalahinilah yang meniadi ironi bangsa Indonesia. III.2KelangkaanSumberDayaPerikanandiBeberapaTempatdi Indonesia dan Faktor Penyebabnya III.2.1OverFishingdiPerairanCilacapmenyebabkanHasilTangkapan Nelayan Terus Menurun Hasiltangkapannelayandalambeberapatahun belakanganiniterusmengalamipenurunan.Salahsatu penyebabnyayakniperairanCilacapsudahoverIishing. HalitudiungkapkanWakilKetuaIHimpunanNelayanSeluruh Indonesia(HNSI)CilacapIndonCahyonosaatpertemuandengan seiumlahanggotakelompoknelayanpadatanggal28Juni2010, menyusulpaceklikyangdirasalebihpaniangdaribiasanya. "Dulu masa panen delapan bulan, masa paceklik empat bulan. Tapi Sekarangkebalikannya,"ungkapnya.Menurutnya,sebelumtahun 1990an,denganarealtangkapandaripantaiTelukpenyuhingga pantaiKebumenhasiltangkapannelayancukupmembanggakan. 'Karenawaktuitunelayandanperahuiaringnyabelumbanyak, uiarnya.Beliaumenggambarkan,padamasaituibaratnasisatu capondimakan10orangkekenyangan,sekarangnasisatucapon dimakanuntuk1000orang.SelainoverIisihing,Iaktorpenyebab menurunnyahasiltangkapankarenapengaruhpemanasanglobal yangmempengaruhiiumlahikandilautan."Berdasarkan penelitian,setiaptahun,suhuairlautnaiksatuderaiat,"katanya. Namun,laniutdia,Iaktorlainyangmemilikiandilkarena berkurangnyahutanmangrovedanmenyempitnyaLagunaSegara

AnakanakibatsedimentasitinggidariSungaiCitanduy. 'PadahalLagunaSegaraAnakansebagaitempatpemiiahanalami ikan.Dandiperparahdenganbanyaknyaiaringapungdialur tersebut,bebernya.MenurutIndon,pemerintahharuscepat tanggapagartidakteriadiseleksialamyangmenyakitkan.Perlu terobosansinergis,salahsatuupayamengatasioverIishing adalah mengarahkannelayankedaerahtangkapandiZonaEkonomi EksklusiI(ZEE),sekitar200mildaribibirpantai.'Selamaiini nelayandi Cilacap belum banyak yangmelakukan penangkapan di wilayahitu,uiarnya.Namun,halitutidakmudahkarenabutuh dayadukungyangmemadaidarisegikemampuannelayan.Dan tentusaiamembutuhkanbiayabesar.Secaraterpisah,Ketua PaguyubanPariwisataPantaiTelukPenyu(PPTP)Karsidi mengatakanakibatmenurunnyahasiltangkapannelayanCilacap, sebagianbesarikanyangdiiualpedagangdikabupateniniberasal dari wilayah pantai utara (pantura) Jawa. "Setiap hari ada sekitar 10 tonikandaripanturayangmasukdiCilacapdandiiualkerumah makan maupun masyarakat. Kalau dipersentasekan, iumlah tersebut mencapai80persenikanyangdiiualdiCilacap,"katanya. Besarnya iumlah ikan dari pantura yangmasuk ke Cilacap ini iuga menuniukkandayakonsumsimasyarakatterhadapikansemakin tinggi. BeberapaperairandiIndonesiamemangsudah mengalamiOverFishing.ZainalAriIindaripusatpenelitian OseanograIiLIPImengatakanbeberapawilayahyangmengalami overIishingataupenangkapanberlebihan."DilautJawa,Selat MalakadanSelatKarimata.TahuniniadakemungkinanLaut AraIuraiugamengalamikelangkaankarenaoverIishing.Kian padatnyaialurpenangkapanikandiarea-areayangmeniadi penyebabutamakelangkaanikandiwilayahtersebut.Perubahan sepertihutanmangroveyangberalihIungsimeniaditambakdan

polusiyangbanyakdisebutkanindustri-industridi utara Jawa iuga berpengaruhterhadapkelangkaansumberdayaperikanan. Perubahaniklimiugaakanmengambilperananpentingseputar kelangkaanikandiperairanIndonesia."Limahingga10tahun mendatang,perubahaniklimberpotensimemperburukkondisi sumberdayaikandilautIndonesia,"tandasnya.Sebelahselatan PulauJawameniadiareayangdinilaiZainalmasihmemiliki sumber daya ikan dalam iumlah aman. Dalam kacamata Zainal, hal inidisebabkanlantaranperalatanyangdigunakanparanelayandi wilayah itu masih relatiI sederhana.Karena di sebelah selatan para nelayan tidak bisa melaut terlalu iauh karena keterbatasan alat.III.2.2 Ancaman Kepunahan Ikan Endemik Indonesia III.2.2.1 Eksploitasi berlebih JenisIkanendemiksepertiIkanBilih (MystacoleususpadangensisBlkr.),IkanBelida (Notopteruschitala),danIkanHaruan(Channastriata) merupakanikanyangbanyakdigemarimasyarakat.Ikan Bilihyang seringdiiadikanmenudi rumahmakankarena rasanyayangenakdangurihmerupakansantapan istimewabagimasyarakat,khusunyadisekitarDanau Singkarak.Permintaanpasardanharganyayangtinggi yaknimencapaiRp.80.000/kgpunmeniadikanikanini komoditasyangsangatberharga.Penangkapandengan iaringbermatakeciluntukmemperolehhasilyangbesar yangdilakukanolehnelayansemakinmenekaniumlah populasiIkanBilihdiDanauSingkarak.Selainuntuk konsumsi,eksploitasiyangdilakukaniugaberdasarkan permintaanikansebagaiikanhias.IkanBelidaseiak beberapatahunterakhirmengalamipermintaanpasar

untukikanhias.PadahalsebelumnyaIkanBelidahanya digunakan untuk konsumsi sebagai bahan baku pembuatan pempekPalembang.IkanHaruanyangbanyakhidupdi rawa-rawadiKalimantanSelatanmulaisulitdiiumpai keberadaannya.Halinidikarenakanmeningkatnya perburuananakanIkanHaruansebagaipakanIkan Louhan.Halinimengakibatkanterganggunyasiklus produksiIkanHaruanyangadadialamdikarenakanikan tidaksempatbesaruntukmelakukanprosesreproduksi. Eksploitasiberlebihtersebutberdampakpaniangterhadap kepunahanekologiyangdisebabkanolehkegiatan penangkapanberlebih.Haltersebutakanmemicu timbulnyagangguan-gangguankegiatanmasyarakat lainnyaterhadapekosistemsepertipolusi,penurunan kualitasair,danperubahaniklimyangdisebabkanoleh kegiatan-kegiatan manusia (Pet, dan Mous, 2002). III.2.2.2 Kurangnya kegiatan budidaya Ancamankepunahanikanendemikdiperparah dengan kurangnya upaya untuk meningkatkan iumlah ikan endemikmelaluikegiatanbudidaya.Haltersebut disebabkan antara lain tingkat kesulitan ikan-ikan endemik tersebutuntukdilakukanpemiiahannyasecarabuatan. Ketersediaan benih yang hanya berasal dari alam membuat prosesbudidayatidakberialanlancarkarenaadanya ketergantunganterhadappasokanbenihdarialam. Kebiiakanrevitalisasiperikanandenganbertumpupada peningkataniumlaheksporikan(Munggorodan Armansyah,2008),meniadikankesempatanpopulasiikan endemikIndonesiauntukbereproduksidengankegiatan budidayasemakinsedikit.Halinidisebabkanpermintaan

akaneksporyangtinggidanwaktuuntukbereproduksi bagiikanyanglamasehinggamenimbulkan ketidaksabaranbagipelakuperikananuntuk membudidayakannya. III.2.2.3 Introducing ikan asing Ikan asingmerupakan ikan yang berasal bukan dari habitat asli, melainkan ikan yang sengaia didatangkan dariluarhabitatuntukdibudidayakan.Masuknya (introducing)ikanasinginimerupakansuatumasalah seriusbagiikanendemik.Halinidikarenakanmeniadi ancamankeberadaanspesieslokaldanmemilikipotensi untukmengubahekosistem(SimberloIandStiling1996). Saatikanasinginimemasukisuatuhabitatbaru,makaia akanmeniadisainganikan aslihabitat tersebut,dalamhal ini adalah ikanendemik. Persaingan inimeliputi beberapa hal,yaknipersainganhabitathidup,kegiatanmemperoleh makanan,danpersainganmendapatkanoksigendalam perairan.Ikanasingyangtelahmasukpadasuatuhabiat perairanmakaakanteriadiseleksialamipadaperairan tersebut.Seleksiiniterdapatduakemungkinanyakni apakah ikan asing ini akan mati tanpa meninggalkan bekas atau akanmampu bertahandalamhabitat baru.Apabilaia mampu bertahan dan bahkanmerasa habitat barunya lebih sesuaidaripadahabitatasalnya,makaiaakanmampu mengalahkanikanlokaldalamhabitattersebut.Contoh yangtelahbanyakteriadidituniukkanpadakasusikan Tillapia yang diintroduksi di perairan Indonesia (WhitIield et al. 2002). Indonesia yang menganut sistem perdagangan bebasmerupakan surga bagimasuknya ikan asing. Hal ini sulit dihindari dikarenakan alur perdagangan dan distribusi

ikanyangbegitupaniangdanberanekaragamienisikan yang diperdagangkan. Diperkirakan setiap harinya, sekitar 7000spesiesikandiangkutkapaluntukdidistribusikan antar negara di seluruh dunia (Carlton 2001). III.2.3 Banyaknya Perburuan Ikan Hiu di Laut Meniadi Salah Satu Penyebab Kelangkaan Ikan di Perairan Indonesia. CuacaburukyangmelananselatanCilacap,Jawada perairanselatanCilacap,JawaTengah,membuatpasokanikan minim.Akibatnya,eksporhasillaut,sepertiikantunadanudang, dari Cilacap terhenti. Kata SudirwanKadamilah,seorangeksportir hasil laut Cilacap "Stoknya kosong sama sekali. Tidak ada nelayan yangmemasokikanlagi.Akibatkosongnyapasokanikandari nelayan Cilacap, banyak nelayan yang terpaksa mendatangkan ikan danudangdariPantaiUtaraJawa.Padahalsesungguhnya kekosongan ikan tidak hanya teriadi di Cilacap, tapi iuga hampir di semuapesisirselatanJawa.Saatiniparanelayanhanyabisa mengirimikankeluarnegeripalingbanyak35ton.Padahal sebelumnyakeuntunganhariandarimengeksporikanbisa mencapaiRp200iuta.SaatinipalingbanyakRp10iutaperhari. Selainituseiak2006hasilproduksiikandiperairanselatanJawa memangterusmenurun.Jikapada2006hasiltangkapannelayan bisa mencapai 650 ton, pada 2010 hanya 291 ton. AbdullahHabibi,CaptureFisheriesCoordinatorWWF Indonesia, mengatakan turunnya iumlah ikan di perairan Indonesia, satudiantaranyadisebabkanolehsemakinbanyaknyaperburuan ikanhiudilaut."Merekainipredatorpuncakyangsangatpenting dalam rantaimakanan,"katadia. Tingginyapermintaansiriphiudi pasar,disebutAbdullah,sebagaisalahsatuIaktorsemakin sedikitnyaiumlahhiudilaut.Ikanhiuyangditangkapnelayan

sedikitnya70persenteriaringsecaratidaksengaia.Sementaraitu, salahsatupengusahapemburuikanhiudiCilacap,mengatakan sudahtigatahunterakhirinihasiltangkapanikanhiumemang menuruntaiam.Katabeliau"Duludidekatpantaimasihadahiu. Tapi sekaranginikamiharusmencarinyahinggaperbatasan Pulau Christmas, Australia," Kini bukan hanya hiu yang susah dicari, tapi iugabeberapaienisikanlain,diantaranyaikantongkol,cakalang, danlayur.Penggunaanpukatharimauolehnelayandaerahlain meniadi penyebab turunnya hasil tangkapan, selain Iaktor cuaca. III.2.4 Fenomena ilegal fishing dan ironi negara bahari Sudahbukanrahasiaumumlagi,kalauIenomena pencurian ikan (ilegal fishing) di perairan Indonesia meniadi sangat marak.Kegiatanpenangkapanikansecarailegalolehkapal berbenderaasingdiperairanindonesia,bukanteriadibeberapa tahun terakhirini saia. Akan tetapikegiatanini sudahberlangsung seiakpuluhantahun.Kapalberbenderaasingtersebutmenyamar sebagai kapal nelayan indonesia, ada iuga yang menggunakan surat iiinpenangkapanpalsu.Haruskitaakuiiuga,bahwakebiiakan kelautankitayangmasihlonggar,sehinggamemungkinkankapal-kapalasinguntukmasukmeniarahhasillautkita.Menurut Sudarmin(Faiar,10/7)bahwabanyakIaktoryangteridentiIikasi sebagaipenyebabteriadinyaillegalIishingdiperairanindonesia yaitu:(1)Luasnyapotensilautyangbelumterolah,(2)Peluang bisnisikanyangmenggiurkan,(3)Kelemahanpenegakanhukum, (4)Mentalitasaparat,dan(5)HambatandariIaktorperundang-undangan.EkonomseniorKwikKianGie(Kompas,26/3/2005) mengatakanbahwakerugiannegaraakibatpencurianikanserta penambanganpasirsecarailegalselamainiyaknisebesarRp76,5 triliun.Angkakerugiannegaradisektorperikananmenempati

urutankeduasetelahkerugiandarisektorpaiakyangmencapai angka sebesar Rp 215 triliun.Maraknyapencurianikansecarailegal(ilegalfishing) olehkapalasingmerupakanIenomenayangkontrasdan menyakitkanhatimasyarakatkita.Betapatidakkekayaanlautkita dengan seenaknya dirampas oleh nelayan asing, sementara nelayan kitatidakbisamenikmatihasillautsendiri.DataKompas(27/9) menyebutkanbahwaThailandmerupakansalahsatunegarayang memilikikapalpenangkapikanterbanyakyangberoperasisecara ilegal sebanyak 500 unit. Sedangkan yang legal sebanyak 306 unit. Darihasilpenagkapanitu,Thailandmampumemproduksihasil tangkapandengantotalpenangkapansebesar72.540ton/tahun, meliputi27.540tonditangkapsecaralegal,sisanya45.000ton merupakanhasiltangkapansecarailegal.Hasiltangkapantersebut dibawalangsungkeThailand.Ironisnyalagiselamaini,indonesia sebagaipengambilkebiiakansekaligussebagaipenghasilikan iustru tidak mampu berbuat banyak. Bukan rahasia umum lagi, kalo modelkeriasamasepertiinicenderungmenguntungkanpihak asing.Halinimengingatkankitapadamodelkeriasamadengan perusahanpertambanganasing(Ireeport,INCOdanperusahaan seienisdenganmodelpengelolaan TransNational Corporate/TNC) dimanakitahanyamengandalkanatauberharappadapaiak periiinan pengoperasian saia.Demikianiugadengansektorperikanankita,hanya berharappadapaiakperiiinanpengoperasiankapalsesuaidengan penggunaanalattangkapsaia.Dalamsetahun,untukalattangkap ienispukatdikenakanbiaya167dollarAS/GrossTon(GT),alat tangkapienispursen254dollarAS/GTdanalattangkapgilnet sebesar54dollarAS/GT.Jikadilihatdarihasiltransaksi perdaganganprodukperikananduniasenilai70miliardollar AS/tahun,indonesiahanyamampumeraup2,2miliardollarAS atausekitar2,8persen.SebaliknyaThailandmampumeraup4

miliardollarASdanCinamendapatkanporsi25miliardollarAS (Kompas, 27/9). Olehkarenanya, sungguhsesuatuyangironisiika sekiranyakitamasihmengangapsebagainegarabahari,sementara hasil-hasil perikanan di bawa kabur oleh kapal asing (negara lain). III.2.5 Nelayan kita yang merana Sepertikitaketahui,nasibburuh,petanidannelayankita sudahdapatdipastikan,merekahidupdibawahgariskemiskinan. Kelompokyangpalingmenikmatiadalahmerekayangmemiliki modal besar (pengusaha) dan dekat dengan kekuasaan. Kemiskinan nelayansepertinyameniadibenangkusutyangsulitdiurai. Kebiiakanpemerintahyangpronelayanmutlakdilakukanuntuk mendorongtingkatkeseiahteraannelayankita.BeberapaIaktor yangmenyebabkan kemiskinan nelayan antaralain : (1) rendahnya tingkatteknologipenangkapan;(2)kecilnyaskalausaha;(3) belumeIisiennyasistempemasaranhasilikandan(4)status nelayanyangsebagianbesaradalahburuh.Olehkarenanya pembangunaninIrastrukturnelayanbantuanalatpenagkapanikan sertamembantudalampemasaranhasiltangkapadalahmutlak dilakukandalamrangkameningkatkankeseiahteraannelayan. Selainitu,harusadapayunghukumyangmelindungiaktivitas penangkapannelayanlokalsertapengaturanataupembatasan penangkapanbagikapalasingdankapal-kapalbesarsertaharus ada undang-undang yang mengatur batas wilayah kita dengan batas wilayahteritotialnegaralain.Haliniperlu,gunamenghindarkan konIlik nelayan lokal dan nelayan asing.Kebiiakanperikananyangpronelayanadalahsuatu keharusan, iika tidak maka nelayan kita akan merana akibat ketidak becusan pemerintah dalammengelola wilayah pesisir dan laut kita. Masalah ini harus segera dituntaskan, karena iika pemerintah tidak

dapatmemberdayakannelayandantidakbisauntukmenuntaskan kemiskinannelayan,makadapatteriadikelangkaansumberdaya perikanan,karenasesungguhnyakelangkaansumberdayaalam yangkemudianmenimbulkankepunahanitupadadasarnyadapat disebabkan oleh adanya dua kelompok masyarakat, yaitu1. Kelompok kapitalis yang bekeria untuk memaksimumkan laba, sehinggamerekainiberusahauntukmenggalisumberdaya alam sebanyak mungkin dalam iangka waktu tertentu. 2. Kelompokmiskinyangterpaksamengurassumberdayaalam untukmemenuhikebutuhanhidupnyayangsubsisten.Karena kemiskinannyakelompokinitidakmemperhatikankelestarian lingkunganyangsesungguhnyaadalahtempatmereka menumpang hidup. Inilah kelompok nelayan Indonesia saat ini yangharusmeniadipusatperhatianpemerintahuntuksegera dituntaskan. III.3 Alasan Mengapa Sebagian Besar Perikanan Dunia OverIishing Seringdiungkapkanbahwasumberdayaikanmerupakan sumberdayayangterpulihkan.Produksiperikananduniaterusmengalami penurunandanbahkanoverIishingdanpunah.Dibawahiniakandiuraikansebab-sebabkerusakanperikananduniaditiniaudaripendekatan pengelolaan perikanan konvensional serta mencoba mendiskusikan altenatiI pengelolaandanmetodepemanIaatansumberdayaikankedepan.1. Manaiemen Konvensional Pauly,etal.,2002mengatakanbahwakegiatanperikanan sebenaranya adalah merupakan suatu kegiatan pengeiaran atau perburuan hewanair,sepertiperburuanhewan-hewandaratlainnyasepertirusa, kelinciatauhewan-hewanlainnnyadihutan.Merekamenielaskanlebih laniut bahwa tidak ada perburuan yang dilakukan secara industri di dunia ini,kecualipadasumberdayaikan.Dapatdibayangkan,apayangteriadi

iikakegiatanperburuanitudiiadikanindustridalamskalabesar? Pertimbangan aspek ekonomi akanmeniadi lebihdominan dibandingkan denganaspeklainnya.Satuanupayaperburuantersebutakanmelebihi kapasitasmaksimumnyadanmengakibatkankerusakandankepunahan sumberdayayangbersangkutan.Dimulaipadaawalabad19ketika nelayanInggrismengoperasikansteamtrawl,kegiatanperikanan berkembangpesatdanmeniadikomoditasindustridanperdagangan. Sadarakankerusakanyangtimbulakibatexploitasiyang"rakus" tersebut,ilmuwanbiologiperikananmengembangkanbeberapamodel pengelolaanperikanan.Model-modelpengelolaanperikanan konvensionaltersebutkemudiandiaplikasikandiberbagaiperairandi belahanbumigunamenghambatlaiukerusakansumberdayaikan. Meskipunmodel-modeltersebutterusberkembangdanmengalami perbaikan,namuntaksatupunmodelpengelolaanyangadamampu menghambat laiu kerusakan sumberdaya ikan. Ada beberapa alasan yang bisadiungkapkandisinikenapamodel-modelkonvensionalpengelolaan sumberdayaikantersebutgagaldalammenghambatkerusakan sumberdaya ikan.Secaraumum,model-modelpengelolaanperikanan konvensioanlyangdikembangkanselamainididasarkanataspositivistic scienceyangberasumsibahwaekosistemalaminidapatdiprediksidan dikontrol.Dalamkenyataannya, asumsiini sangat susahuntukdipenuhi. Disampingkemampuanmanusiauntukmemprediksiperilakuekosistem alamterbatas,perilakuekosistemsendiriiugasangatsusahuntuk diprediksi.Sehingga,model-modelyangberbasiskesetimbanganyang banyakdiadopsidalampengelolaansumberdayaikan(sepertinilai maximum sustainable yields, MSY), tidak dapat diterapkan dengan baik. Bukankarenaketersediaandatayangterbatas,tapiyanglebihutama adalahkegagalandalammengadopsiperilakuekosistemdalam modelnya.Sehingga,penentuanreIerencepoint(nilaiacuan)kapasitas maksimumlingkunganyangmeniadidasardalampenentuanbatas maksimum variabel keputusan (seperti MSY) menemui ketidak-akuratan.

Kesalahan,baikitulebihataukurang(darikapasitasmaksimum sesungguhnya)akanberdampakyangburukbagipengelolaan sumberdaya ikan. Alasanberikutnya adalahmodel-modelpengelolaanperikanan konvensionalyangsebagianbesardikembangkanuntukspesiestunggal padaperikananindustridibelahanbumiutarabagianbarat,tidakcocok diterapkan pada perikanan daerah tropis yang notabene berskala kecil dan bersiIatmultigear-multispecies.Padahal,bumibagianselatanyang merupakannegaraberkembang,dimanaperikanannyadidominasioleh perikananskalakecil,menyumbanghampir58produksiperikanan dunia. Perbedaan skala, sistem penangkapan ikan dan ekosistem perairan, menyebabkanmodel-modelkonvensionaltidakmampuuntuk menerangkankompleksitasperikanandaerahtropis.Pengelolaan perikanan,padahakekatnyaadalahpengelolaanekosistem,dimana keterkaitanantarakomponenyangsatudenganyanglainnyasangaterat hubungansebabakibatnya.Perubahanpadasatuelemenekosistemakan merubahstruktursecarakeseluruhanekosistemtersebut.Ketidak mampuanmodeluntukmenielaskankompleksitasperikananini,telah diyakinimeniadi penyebab perubahan struktur ekosistem perikanan yang padaakhirnyamenyebabkandegradasiproduksiikandanoverIishingdi hampir seluruh wilayah daerah tropis.Padasisilainnya,manaiemenperikanankonvensioanalyang hanyaterIokuspadastockassessmentmodelyangmenaIikkanaspek sosialiugadisinyalirmeniadisalahsatupenyebabketidak-berhasilan model-modelkonvensioanal.Padahal,managementperikananpada hakekatnyaadalahsuatuupayauntukmengontrolupayapenangkapan, ataukongkretnyamengaturnelayan,pelakuutamakegiatanperikanan, dalammengoperasikanalattangkapnya,kapan,dimanadanseberapa besarkapasitasperikananyangbolehdigunakan.Olehsebabitu, pengetahuantentangdinamikaperilakunelayandalamkegiatan penangkapanikantermasukdidalamnyaaspeksosial-ekonominelayan yangmelatar-belakanginya,sangatlahpentingdalampengelolaan

sumberdaya ikan. Hilborn, 1985mengungkapkan bahwa krisis perikanan coddansalmondiCanadapadatahun1980ansebenarnyabukanlah karena ketidak mampuan model dalam memperediksi ekologi semata tapi karenadinaIikkannyaaspekperilakunelayaninidalampengelolaan sumberdayaikan.Penurunanstokikan,perubahankomposisi sumberdayaikan,sertameningkatnyakompetisiantarnelayan,telah mendorongnelayanuntukmelakukanupaya-upayaeIisiensidengan menambahdayakapal,teknologipenangkapanikan,danalatbantu penangkapanikanyangkesemuanyamengakibatkanmeningkatnya kapasitas penangkapan ikan. Subsidi pemerintah yang tak terencana, iuga diyakinitelahmendorongnelayanuntukmeningkatkanupaya penangkapan ikan. Motorisasi kapal nelayan yang tidak dibarengi dengan upayapeningkatanpemahamannelayanakanpengelolaansumberdaya ikantelahmenyebabkanmeningkatnyatekananpenangkapandidaerah pesisir.Dalambeberapakasus,nelayanmelakukanperubahanatau modiIikasiukurankapal,alattangkapatauteknologipenangkapanikan yangdigunakangunamengelabuhiperaturanyangdikeluarkanoleh pemerintah.Sehinggapenghitungansatuanupayapenangkapandalam model perikanan konvensioanal yang hanya berbasis pada iumlah armada penangkapan akan menyesatkan. Ketidakmampuanmodelkonvensionaldalammengoptimalkan tuiuanpengelolaanitu sendiri, iugadiyakinimeniadipenyebabgagalnya model-modelpengelolaansumberdayaikankonvensionaldalam menghambatlaiukerusakansumberdayaikan.Secaraumum,tuiuan pengelolaansumberdayaikandituiukanuntukmengoptimalkantiga tuiuanutama,yaitu:ekonomi, biologidan sosial. Kebiiakanpengelolaan sumberdayaikandiharapkanmampuuntukmemuaskanaspekekonomi dengantetapmeniagakelestariansumberdayasehinggamampu menseiahterakanmasyarakat,khususnyanelayansecaraberkelaniutan. Namundemikian,dariketigatuiuanutamatersebut,khususnyaantara tuiuanekonomidanbiologisangatlahbertentangandantidakmungkin untukdicapaisecarabersamaan.Mengoptimalkanekonomiakan

berdampakpadaperusakansumberdayaikandansebaliknya mengoptimalkansumberdayaikan(kelestariansumberdayaikan)tidak akanmampumemuaskanaspekekonomi.Perkembanganmodel pengelolaansumberdayaikanyangpadaawalnyahanyadiukurdengan aspek biologi semata, maximum sustainable yield (MSY) yang kemudian dimodiIikasidenganmempertimbangkanaspekekonomi,maximum economicyield(MEY)danterakhirmeniadioptimumsustainableyield (OSY)menuniukkanupaya-upayaperbaikanterhadapmodelyangada. Namun,dariketigamodel tersebut, sampai saat inibelummampuuntuk mengoptimalkan seluruh tuiuanpengelolaan sumberdayaikan.Yang ada adalah,dengannilaiacuanMSYyangmasihdiragukannilainyaitu, sebagianbesarnegaraberkembangmengesampingkan aspekbiologidan sosialdanterusmembukaaksespenangkapanikanuntuktuiuandevisa negara.2. Pengelolaan Sumberdaya Ikan ke Depan Selamamasihdidasarkanpadamodel-modelkonvensionalyang memahamiperikanansecaralinear,dapatdiduga,speciestunggaldan kesetimbangansistem,pengelolaanperikanantidakakanberhasil.Oleh sebabitusangatberbahayaiikapengelolaanperikanankhususnya perikananindustrididaerahtropismasihdidasarkanpadamodel-model konvensionalini.Perikananbukanlahkegiatanekonomisemata,namun sudahmerupakanialanhidupsebagianbesarnelayankecildidaerah tropis.Olehkarenaitupendekatansosial-ekologiyang mengakomodasikanaspekekologidansosialdalamsuatusistemlayak untukdipertimbangkandalampengelolaansumberdayaikankedepan. Perikananharusdipandangsebagaiintegrasisistemsosial-ekologi denganduaarahumpanbalikdansistemadaptasiyangkomplek. Pengelolaanperikananbukanlagidituiukanuntukmeniawabpertanyaan "kemanaperikaaninginkitaarahkan?"tetapi"bagaimanakitaberubah menuiuarahyangdikehendaki?"Pengelolaansumberdayaikanyang didasarkanpadanilaiacuan(sepertiMSY),sudahsaatnyadicarikan

alternatiIpenggantinya,denganmenggunakanruiukanarah kecenderungan perkembangan sumberdaya tersebut (misalnya perubahan komposisi hasil tangkapan, ukuran hasil tangkapan, dsb).Pendekatanecosystembasedmanagement(EBM)untuk pengelolaansumberdayaikanmungkinmerupakansalahsatumetoda alternatiIuntukpengelolaanekosistemsumberdayaikanyangkomplek. TheEcosystemPrinciplesAdvisoryPanel(EPAP),menyatakanbahwa EBMmengembansedikitnya4aspekutama:(1)interaksiantaratarget speciesdenganpredator,kompetitordanspeciesmangsa;(2)pengaruh musimdancuacaterhadapbiologidanekologiikan;(3)interaksiantara ikandanhabitatnya;dan(4)pengaruhpenangkapanikanterhadapstok ikan dan habitatnya, khususnya bagaimanamenangkap satu species yang mempunyaidampakterhadapspecieslaindidalamekosistem.Bila dalampenielasanEPAPtidakdisebutkansecaralangsungtentang bagimanamengelolaperilakuorangataumanusiasebagaikomponen ekosistemdimanamerekahidupdanmemanIaatkansumberdaya,tetapi sesungguhnya unsur manusia telah masuk di dalamnya. Di lain pihak, the NationalResearchCounciloItheUSA(NRC)dalamdeIinisinya menyebutkanmanusiasebagaikomponensekaliguspenggunadalam ekosistemsecaralangsungsertamembedakanantaraekosistemdan penggunaekosistemtersebut.Disebutkaniugabahwatuiuanakhirdari EBMadalahmeniagakeutuhandankelestarianekosistem.Sebagaialat monitoringekosistem,EBMkemudiandilengkapidenganindikator ekologi untuk mengukur perubahan ekosistem yang dimaksud. Indikator-indikatorinidiupayakanlebihberartisecaraekologi,mudahdipahami dan diterapkan di lapangan. Berdasarkan hasilmonitoring ini diharapkan perubahanekosistemtermasukmanusiayangadadidalamnyamudah diielaskan,sehinggakeadaanekosistemsecarakeseluruhanakan diketahuidantindakanperbaikandapatdilakukansecapatnyauntuk mengatasikerusakanyangada.Sebagaicontoh,RochetandTrenkel, 2003mengelompokkanindikatorperubahansumberdayaikanmeniadi3 kelompokbesaryaitu(1)indicatorpadatingkatpopulasi;(2)indicator

padatingkatantarspeciesikandan(3)indicatorpadatingkatkelompok ikan.Padatataranpelaksanaan,EBMseringdisandingkandengan marineprotectedarea(MPA),yangdideIinisikansebagaisuatuwilayah yangpopulasisumberdayanyabebaseksploitasi.TuiuanMPAadalah untukmelindungisumberdayadarieksploitasiagarsumberdayatersebut pulihkembali.Disampingmeningkatkanukuranikan,MPAiuga diharapkanmampumengembalikanstoksumberdayayangtelahrusak. Mouset.al,2005dalamkaiiannyatelahmengungkapkankeunggulan MPA dibandingkan dengan pendekatan konvensional yang menggunakan nilaiacuan(sepertiMSY).Khususnyabagipengelolaanperikanandi Indonesia,merekasecarategasmengusulkanuntukmenggantimetoda pendekatan pengelolaan perikanan yang selama ini didasarkan pada nilai MSY dengan MPA. III.4 Sumber daya alam dan pertumbuhan ekonomi Hubunganantarapertumbuhanekonomidantersedianyasumber dayaalamtidaksamadenganhubunganantarapertumbuhanekonomidan tersedianyabarangsumberdayayangdipakaidalamprosesproduksi. Semakincepatpertumbuhanekonomi akansemakinbanyakbarangsumber dayayangdiperlukandalamprosesproduksiyangpadagilirannyaakan mengurangitersedianyasumberdayaalamyangadadidalambumikarena barangsumberdayaituharusdiambildaricadangan(stock)sumberdaya alam.Jadisemakinmenggebunyapembangunanekonomidinegarayang sedangberkembang,termasuknegaraIndonesiakarenamerasatertinggal darinegaralaindaninginmenghilangkanadanyakemiskinandinegara tersebut,makaakanberartisemakinbanyakbarangsumberdayayang diambil di bum dan semakin sedikitlah volume cadangan sumber daya alam tersebut.DengandemikiandapatdikatakanadahubunganyangpositiI antarakuantitasbarangsumberdayadanpertumbuhanekonomi,tetapi sebaliknyaadahubunganyangnegatiIantarapertumbuhanekonomidan cadangan sumber daya alam yang ada di dalam bumi. Disamping itu dengan

pembangunanekonomiyangcepatyangdibarengidenganpembangunan pabrik-pabrik,akanterciptapulapencemaranlingkunganyangsemakin membahayakan kehidupan manusia. Gambar1.1menuniukkantingkatpendapatannasionalyang digambarkanpadasumbuvertikalsebagaiIungsidaripemakaianbarang sumberdayayangdigambarkanpadasumbuhorizontal.KurvaYI(R) menuniukkanadanyahubunganpositiIantaraiumlahbarangsumberdaya yang dipakai dalam proses produksi dengan tingkat pendapatan nasional. Pendapatan(Y)Y I(R) Nasional

0R0R1Barang Sumber Daya (R) Gambar1.1HubunganantaraPendapatanNasionaldanBarang Sumber Daya MisalnyadalamGambar1.1dapatdilihatbilaiumlahbarang sumberdayayangdipakaidalamperekonomiansetinggiR0,makatingkat pendapatannasionalakansetinggiY0 danapabilaiumlahbarangsumber dayaalamyangdipakaibertambahmeniadiR1, makatingkatpendapatan nasional iugameniadilebih tinggi yaitu meniadi Y1. Sedangkan gambar 1.2 menuniukkanbahwavolumecadangansumberdayaalam(N)merupakan Iungsidaripertumbuhanekonomi(Y)dandisiniterdapathubunganyang negatiI,artinyasemakincepatpertumbuhanekonomisuatuperekonomian akansemakinmenipiscadangansumberdayaalamdinegarayang bersangkutan.Dalamgambar1.2dituniukkanpadasaatpertumbuhan

ekonomi setinggi Y0, maka iumlah cadangan sumber daya alam adalah N0 danbilalaiupertumbuhanekonomimeningkatmeniadiY1,makaiumlah persediaan sumber daya alam menurun meniadi N1. Sumber Daya Alam NI(Y) 0 Y0 Y1 Pendapatan Nasional Gambar 1.2 Hubungan antara Pendapatan Nasional dan Persediaan Sumber Daya Alam Olehkarenaituperludiingatbahwadenganadanyapembangunan yangsangatcepat,apabilakitatidakberhati-hati,pastipembangunanitu akanmangurassumberdayaalamyangadadinegarainidanpada gilirannyabarangsumberdayayangdiperlukanbagipembangunaniuga akanterbatasadanya,sehinggahaliniakanmenghambatpertumbuhan ekonomilebihlaniut.Sumberdayaalamsebagaisuatucadanganadapada setiap saat dan cadangan inimeningkat dengan adana penemuan baru, serta berkurangdengan adanya penggunaan ataupengambilansumberdaya alam itu.Disampingitusumberdayaalamiugaakanberkurangapabilateriadi kerusakan alamiah.Karena sumber daya alamdiartikan sebagai segla sesuatu yang ada dibumimaupundiatasbumiyangdihasilkanolehalamdanbukanoleh manusia,makaproduksibarangdaniasaitutidakmungkinteriaditanpa melibatkansumberdayaalamdidalamprosesproduksimereka.Dengan semakinmeningkatnya iumlah penduduk,maka semakin banyak diperlukan

barang dan iasa untuk memenuhi kebutuhan penduduk tersebut. Peningkatan iumlah barang dan iasa dengan sendirinya memerlukan lebih banyak barang sumberdayasebagaisalahsatuIaktorproduksiyangakandiolahbersama Iaktor-Iaktorproduksilainbaikdalamindustripengolahan,industri pertanianmaupunindustriiasa,yangsebagaiproduksampingannyaadalah pencemaranlingkungan.Dalamhalinibarangdaniasamerupakanproduk yangdiinginkan(desirableoutput)danlimbahsertapencemaransebagai produkyangtidakdiinginkan(undesirableoutput).Jaditerdapathubungan yangpositiIpulaantarapembangunanekonomidanpencemaran lingkungan.HubungantersebutdituniukkanolehKurvaLingkungan Kuznets. Pada awalnya semakin giat pembangunan ekonomi, semakin tinggi puladeraiatpencemaranlingkungan.Gambar1.3menuniukkanhubungan tersebutyaitupadasumbuhorisontaldigambarkantingkatpertumbuhan ekonomidanpadasumbuvertikaldigambarkantingkatpencemaran. ApabilalaiupertumbuhanekonomsetinggiY0makatingkatpencemaran lingkungan setinggi P0 dan bila tingkat pertumbuhan ekonomi setinggi Y1, maka tingkat pencemaran lingkungan setinggi P1. Jadi disatu pihak kegiatan produksibarangdaniasamenghasilkansesuatuyangbergunauntuk meningkatkankeseiahteraanhiduppenduduk,tetapidilainpihakkarena adanyapencemaranlingkunganmerupakanIaktoryangmenekan keseiahteraan hidup penduduk. (Lihat pula gambar 1.5). PI(Y) Pencemaran Pertumbuhan (Y) Gambar 1.3 Hubungan antara tingkat pertumbuhan dan tingkat pencemaran.

Pencemaran 0US $ 5000Pendapatan Perkapita Gambar 1.4 Kurva lingkungan kuznets (KLK) berbentuk U Hubungan antara iumlah penduduk, pertumbuhan ekonomi, barang sumbedaya,barangsumberdayaalamdanlingkungandapatdilukisan sebagaiberikut(Gambar1.5).Denganberkembangnyaiumlahpenduduk, perekonomianharuslebihbanyakmenyediakanbarangdaniasademi mempertahankanataumempertinggitaraIhidupsuatubangsa.Namun peningkatan produksi barang dan iasa akan menuntut lebih banyak produksi barang sumber daya alam yang harus digali atau diambil dari persediannya. Sebagaiakibatnyacadangansumberdayaalammeniadisemakinmenipis. Disampingitu'pencemaranlingkungansemakinmeningkatpuladengan semakinlaiunyapertumbuhanekonomi terutamauntuknegara-negarayang barumemulaipembangunannya.Jadidenganpembangunanekonomiyang menghasilkanpertumbuhanekonomiakanteriadipuladuamacamakibat yaitudisatupihakmemberikandampakpositiIbagikehidupanmanusia berupa semakin tersedianya barang dan iasa dalam perekonomian dan dilain pihakterdapatdampaknegatiIbagikehidupanmanusiayangberupa pencemaranlingkungandanmenipisnyapersediaansumberdayaalam. Pencemaranlingkunganmenyebabkantimbulnyagangguankesehatan, turunnyaproduktivitaskeriadankurangnyamannyakehidupan. Sedangkan berkurangnyapersediaansumberdayaalamakanmengurangikemudahan

dalampenyediaanbarangdaniasabagipemenuhankebutuhanmanusia sehinggabiayaproduksimeningkatdanatauproduksiturunsertaharga produkmeniadimahal.Olehkarenaitupembangunanekonomiharuslah bersiIatpembangunanyangberwawasanlingkunganataupembangunan yangberkelaniutanyangtidakmengurassumberdayaalamdanmerusak lingkungan. () (-) (-) Gambar1.5Hubunganantaraiumlahpenduduk,pertumbuhan ekonomi, barang sumber daya alam dan lingkungan. Barang dan Jasa Penduduk Pertumbuhan ekonomi Pencemaran Lingkungan Menipisnya Sumber Daya Alam

BAB IV KESIMPULAN Indonesia adalah negara kepulauan terbesar di dunia, dimana terdiri dari17.508pulau,dengangarispantaisekitar81.000km.Indonesia memiliki luaswilayah lautan sekitar 5,8 iuta km2 atau sekitar 70 dari luas totalteritorialIndonesia.TentunyapotensiIisiktersebutbukanlahhanya meniadikebanggaansaia.Akantetapipotensiituharusdikelolauntuk kepentingandankemakmuranrakyat.sumberdayaalamyangdapat diperbaharui(renewableresourcesIlowresources).Sumberdayaini mempunyaisiIatterus-menerusadadandapatdiperbaharuibaikolehalam sendirimaupundenganbantuanmanusia.Dalamhalini,ikanmerupan sumber daya alam yang kategori ini.Sumber daya alam yang dapat diperbaharui (renewable resources Ilow resources)mempunyai siIat terus-menerus adadandapatdiperbaharui baik oleh alam sendiri maupun dengan bantuan manusia. Dalam hal ini, ikan merupakan sumber daya alam yang kategori ini. Walaupun sumber daya ini mempunyai siIat terusmenerus ada,namun iikasumberdaya alam tersebut tidakdikeloladenganbaikmakaakanmenimbulkankelangkaan.Seperti pendapat kelompok pesimis terhadap sumber daya alam yaitu 'Sumber daya alamituterbatasadanya,sehinggaapabilaterusmenerusdiambilmaka cadangannyamakinlamaakansemakinmenipisdansampaipadasaatnya pastiakanhabis.Memangduniainiterbatasadanya,banyaksumberdaya alamyang tidakdapatdiperbaharuimendekati titikkehabisancadangannya dan banyak sumber daya alam yang dapat pulih telah diperdagangkan secara berlebihan(overused).Karenatuiuandaripengeloalaansumberdaya perikananitusendiriyaituuntukmeniagaketersediaanstockikandi perairanagartidakhabis.Makadariitu,kitaharusdapatmenggunakannya sebaikmungkin,sebabkesalahandalammemanIaatakansumberdayayang

dapatdiperbaharuiinidapatmengakibatkankerugianyangsiIatnya kontinyu pula.BanyakIaktoryangdapatmeyebabkankelangkaanikanyang kemudianmenimbulkan kepunahan ikan. Faktor-Iaktor tersebutdiantaranya yaituoverIishing,illegalIishing,konsumsiikannasional,volumeekspor ikannasional,volumetangkapanikanilegalyangtidakdilaporkan (unreported)meniadimasalahpraktekpenghisapansumberdayaperikanan Indonesia.SelainitupulaKemerosotanyangteriadidalamperdagangan globalperikananinidisebabkanolehmenurunnyakapasitaspenangkapan ikanolehparanelayankita. Cuaca burukyang teriadidiperairanIndonesia mengakibatkanparanelayanberhentimelaut.Ditambahlagistockikandi lautyangmenurundrastisakibatpenangkapanberlebih(overfishing) meniadipenyebabutamapenurunanhasiltangkapantersebut.Danbanyak Iaktor-Iaktor lainnya. Sealain itu pula pemerintah harus lebih peka terhadap musim ikan untukmengawasi kelangkaan dan kelebihan ikan antar wilayah untuk memastikan ikan kita dapat terpasarkan di dalam negeri.

DAFTAR PUSTAKA Fauzi,Akhmau..KebiiokonperikononJonkelouton:isu.sintesis.Jonqoqoson. uiameuia Pustaka 0tama : Iakaita. Fauzi,Akhmau.. PemoJelon sumber JovoperikononJonkelouton untuk onolisis kebiiokon. uiameuia Pustaka 0tama : Iakaita. Fauzi, Akhmau. . Fkonomi Sumber Bovo Alom Jon linqkunqon. uiameuia Pustaka 0tama : Iakaita. Fauzi,Akhmad.2010.konomiPerikanan.Teori.KebiiakandanPengelolaan. GramediaPustakaUtama;Jakarta.FoouanuAgiicultuie0iganization.. The State of Woilu Fisheiies anu Aquacultuie . FA0, Rome, pp. Kusnaui..Akorkemiskinonnelovon.PTLKiSPelangiAksaia: Yogyakaita. Kusnaui. . Iominon sosiol nelovon. LKIS. Yogyakaita. Kusnaui. 9. Konflik sosiol nelovon: kemiskinon Jon perebuton sumber Jovo perikonon. LKIS Pelangi Aksaia. Yogyakaita. Nangunjaya,FachiuuuinN..EiJupEormonisJenqonAlom.Yayasan 0boi Inuonesia : Iakaita. Pet,IosuanP.I.Nous..KawasanKonseivasiLautuanNanfaatnyabagi Peiikanan.TheNatuieConseivancySoutheastAsiaCenteifoiNaiine Piotecteu Aieas, Sanui, hlm. Supaimoko. 8. Fkonomi Sumber BovoAlom Jon linqkunqon eJisi 4: Suatu Penuekatan Teoiitis. BPFE : Yogyakaita. Wiyono.E.S..StoksumberJovoikonJonkeberloniutonkeqioton perikonon. Inovasi : Iakaita.