accelerating...tenaga hijau, juga berhasil meresmikan beroperasinya pembangkit listrik tenaga surya...
TRANSCRIPT
AcceleratingRenewableEnergyDevelopment
Langkah mantap Indonesia Power semakin terlihat jelas di tahun 2019 dalam mengakselerasi pengembangan bisnis pembangkitan berbasis Energi Baru Terbarukan (EBT). Komitmen ini tentunya membutuhkan penyempurnaan secara berkesinambungan melalui Program Inovasi dan Riset serta Pengembangan (Research and Development) dalam segala hal, khususnya dalam pemanfaatan teknologi yang optimal guna meningkatkan kinerja Perusahaan dan pengembangan portofolio bisnis baru bagi Perusahaan (second curve of business).
Pencapaian demi pencapaian berhasil ditorehkan Indonesia Power di tahun 2019 dengan komersialisasi Pembangkit Listrik Tenaga Air (PLTA) Rajamandala setelah mengantongi Sertifikat Laik Operasi (SLO) dari Direktorat Jenderal Ketenagalistrikan (DJK) Kementerian ESDM. Indonesia Power melalui anak perusahaannya, PT Indo Tenaga Hijau, juga berhasil meresmikan beroperasinya Pembangkit Listrik Tenaga Surya (PLTS) Atap atau PLTS Rooftop dengan memanfaatkan modul Photo Voltage (PV) dari Canadian Solar yang dapat menurunkan emisi yang dihasilkan oleh unit pembangkit yang selama ini dioperasikan menggunakan energi primer gas ataupun minyak. Indonesia Power juga sedang menggarap berbagai Project EBT yang tersebar di berbagai daerah di Indonesia. Lebih dari itu, Indonesia Power secara konsisten sejak tahun 2017 melaksanakan Program Tempat Olah Sampah Setempat (TOSS) yang mampu mengelola dan mengolah sampah menjadi energi yang dapat menciptakan nilai ekonomi bagi masyarakat.
Pemanfaatan teknologi yang optimal juga dijadikan peluang oleh Indonesia Power dalam menjawab tantangan Industri 4.0. Indonesia Power pun bergerak dinamis dan mengikuti alur perubahan hingga bertransformasi melalui digitalisasi proses bisnis. Semangat bertransformasi ini pun tecermin dalam konsep “IP Great: Light Up 4.0”, yang sekaligus menjadi kendaraan yang membawa Indonesia Power lebih dekat dengan impian untuk “Menjadi perusahaan pembangkit terpercaya yang menerangi hingga ke pelosok negeri”. Transformasi digital ini juga memainkan peranan penting dalam mengoptimalkan efisiensi, keandalan dan kecepatan transisi menuju energi terbarukan.
Aksi nyata ini merupakan bentuk eksekusi ekselen yang dilakukan Indonesia Power untuk senantiasa mencapai kinerja unggul yang turut mendukung transformasi PLN “Power Beyond Generation”, sekaligus sebagai wujud komitmen dalam mendorong tercapainya target 23% EBT dalam bauran energi primer di tahun 2025 mendatang yang mendukung pencapaian tujuan pembangunan berkelanjutan (Sustainable Development Goals – SDGs) dalam memastikan tersedianya akses energi yang berkelanjutan secara merata, ramah lingkungan, andal dan terjangkau bagi seluruh masyarakat di negeri kita tercinta, Indonesia.
Indonesia Power’s steady steps are increasingly clear in 2019 in accelerating the development of a Renewable Energy-based (NRE) generation business. This commitment requires continuous improvement through the Innovation and Research and Development Program in all aspects, particularly in optimizing the use of technology to enhance the Company’s performance and developing the new business portfolios for the Company (second curve of business).
Indonesia Power managed to achieve many achievements in 2019, with the commercialization of the Rajamandala Hydroelectric Power Plant (PLTA) after obtaining the Commissioning Certificate (SLO) from the Directorate General of Electricity (DJK) of the Ministry of EMR. Indonesia Power, through its subsidiary, PT Indo Tenaga Hijau, successfully inaugurated the operation of a Rooftop Solar Power Plant (SoPP) by utilizing a Photo Voltage (PV) module from Canadian Solar that can reduce emissions generated by the generating units that operate by using gas or oil as primary energy. Indonesia Power is also working on various NRE Projects spread throughout various regions in Indonesia. Further, Indonesia Power consistently implemented the Local Trash Can (TOSS) Management Program since 2017, which manages and processes waste into energy to create economic value for the community.
Indonesia Power also optimizing the use of technology as an opportunity in answering Industry 4.0 challenges. Indonesia Power moves dynamically and follows the path of change to transformation through digitizing business processes. This spirit of transformation is reflected in the “IP Great: Light Up 4.0”, as the driver to encourage Indonesia Power closer to the dream of “Becoming a trusted energy company that illuminates the whole state”. The digital transformation plays an important role in optimizing the efficiency, reliability, and speed of the transformation to renewable energy.
This action is an excellent execution by Indonesia Power to always achieve superior performance to simultaneously support the PLN’s transformation “Power Beyond Generation”, as well as a form of commitment in encouraging the 23% NRE target in the primary energy mix by 2025 in order to support the achievement of Sustainable Development Goals (SDGs) to ensure the availability of energy access that is evenly distributed, environmentally friendly, reliable, and affordable for all the people in our beloved country, Indonesia.
iiLaporan Keberlanjutan 2019PT Indonesia Power
Daftar IsiContents
Gambaran KeberlanjutanSustainability Overview
Tata Kelola KeberlanjutanSustainability Governance
Profil PerusahaanCompany Profile
Meningkatkan Kinerja Usaha, Optimalkan Kontribusi Bagi NegeriEnhancing Business Performance, Optimizing Contribution toThe State
04 Ikhtisar Kinerja KeberlanjutanSustainable Performance Overview
08 Sambutan Direktur UtamaPresident Director’s Statement
14Strategi Dalam Pencapaian TujuanPembangunan BerkelanjutanStrategies to Achieving Sustainable Development Goals
26 Tentang Laporan IniOn The Report
26 Keterlibatan Pemangku KepentinganStakeholders’ Involvement
40 Penghargaan dan Sertifikasi Tahun 2019Awards and Certification in 2019
48 Peristiwa Penting Tahun 2019Significant Events in 2019
76 Struktur Tata Kelola PerusahaanCorporate Governance Structure
85 Standar Etika dan IntegritasCode of Conduct and Integrity
96 Manajemen Risiko KeberlanjutanSustainability Risk Management
56 Identitas PerusahaanCorporate Identity
58 Skala Organisasi PerusahaanCompany’s Organizational Scale
59 Visi, Misi, Kompetensi Inti dan Budaya PerusahaanVision, Mission, Core Competence, and Corporate Culture
62 Struktur Organisasi PerusahaanCompany’s Organizational Structure
64 Wilayah Kerja PerusahaanCompany’s Working Area
66 Pangsa Pasar Market Share
67 Rantai Pasokan PerusahaanCompany’s Supply Chain
70 Perubahan Signifikan Tahun 2019Significant Changes in 2019
71 Unit-Unit Indonesia PowerUnits of Indonesia Power
73 Keanggotaan Asosiasi Association Membership
102Ikhtisar Pencapaian Kinerja Operasi dan KeuanganOperation and Financial Performance Achievements Highlight
105 Penciptaan dan Pendistribusian Nilai EkonomiCreation and Distribution of Economic Values
110 Pengelolaan Dampak Ekonomi Tidak LangsungManagement of Indirect Economic Impact
119 Produksi dan Penjualan Tenaga ListrikElectricity Production and Sales
122
Peningkatan Ketersediaan, Keandalan dan Efisiensi PembangkitImprovement of the Availability, Reliability,and Efficiency of Plants
132
Pengembangan Inovasi Berkelanjutan Bagi Peningkatan PerformanceSustainable Innovation Development for Performance Improvement
137 Peningkatan Kepercayaan dan Kepuasan PelangganEnhancement of Customer Trust and Satisfaction
Ekonomi Economy
iiiSustainability Report 2019
PT Indonesia Power
Mengelola Dampak Lingkungan, Menjaga Kelestarian BumiManaging Environmental Impacts, Maintaining Earth’s Sustainability
Mencapai Kinerja Ekselen Dengan SDM UnggulAchieving Excellent Performance With Superior HR
Membina Kemitraan, Mendorong Kemandirian MasyarakatFostering Partnerships, Encouraging Community Independence
LampiranAppendix
Meningkatkan Budaya Keselamatan dan Kesehatan Kerja, Wujudkan Kinerja PrimaImproving Occupational Health and Safety Culture, Actualizing Performance Excellence
142 Ikhtisar Pencapaian Kinerja LingkunganEnvironmental Performance Highlight
145 Tantangan dan Strategi Pengelolaan LingkunganChallenges And Strategies in Environmental Management
147 Sistem Manajemen LingkunganEnvironment Management System
148 Pengelolaan Dampak LingkunganEnvironmental Impact Management
182 Program Pelestarian LingkunganEnvironmental Conservation Program
194 Program Eco-Office Eco-Office Program
195 Pengembangan Pembangkit Energi Baru TerbarukanNew Renewable Energy Power Plant Development
208 Investasi Bagi Pengelolaan dan Pelestarian LingkunganInvestment in Environmental Management and Conservation
209 Penanganan Pengaduan LingkunganEnvironmental Complaint Handling
212
Kebijakan Unggul dan PelaksanaanHuman Capital ExcellenceSuperior Policy and Human Capital Excellence Implementation
214 Komposisi Pegawai Employees Composition
220 Rekrutmen dan Turnover PegawaiEmployees’ Recruitment and Turnover
223 Pemenuhan Hak-Hak Pegawai Fulfillment of Employee Rights
236 Pengembangan Kompetensi dan Keahlian PegawaiEmployees’ Competence Development and Expertise
247 Penilaian Kinerja dan Pengembangan KarirPerformance Assessment and Career Development
248 Survei HRSE HRSE Survey
249 Penanganan Pengaduan PegawaiEmployee Complaints Handling
280 Visi dan Misi CSR PerusahaanCompany’s CSR Vision and Mission
280 Program dan Perencanaan Program CSR CSR Program and Program Planning
298 Evaluasi Kinerja Performance Evaluation
303 Investasi bagi Masyarakat Investment for the Community
306
Indeks Isi GRI Standards “Opsi Komprehensif” dan Pengungkapan Sektor Utilitas ListrikGRI Standards “Comprehensive Option” and Electric Utilities Sector Disclosures Content Index
315 Lembar Umpan Balik Feedback Sheet
254 Budaya Keselamatan dan Kesehatan KerjaSafety Culture
255Tantangan dan Strategi Keselamatan danKesehatan KerjaOccupational Health and Safety Challenges and Strategies
256 Sistem Manajemen Keselamatan dan Kesehatan KerjaOccupational Health and Safety Management System
256
Keselamatan dan Kesehatan Kerja Dalam Perjanjian Kerja BersamaOccupational Health and Safety in Collective Labor Agreement
257 Panitia Pembina Keselamatan dan Kesehatan KerjaOccupational Health and Safety Committee
258 Identifikasi Jenis Pekerjaan Berisiko TinggiHigh-Risk Work Identification
262 Program Pengelolaan Keselamatan dan Kesehatan KerjaOccupational Health and Safety Management Program
268 Keselamatan dan Kesehatan Kerja KontraktorContractors’ Occupational Health and Safety
270Perlindungan Keselamatan dan Kesehatan Bagi Masyarakat SekitarSafety and Health Protection for the Surrounding Community
272Kinerja dan Evaluasi Keselamatan dan Kesehatan KerjaPerformance and Evaluation of Occupational Health and Safety
Lingkungan Environment
Sosial Social
Sosial Social
Sosial Sosial
2 Laporan Keberlanjutan 2019PT Indonesia Power
GambaranKeberlanjutan
Gambaran Keberlanjutan
3 Sustainability Report 2019PT Indonesia Power
Mengakselerasi Pengembangan Energi Terbarukan menjadi tantangan bagi Kami untuk menciptakan energi masa
depan yang bersih, berkelanjutan dan dapat diandalkan. Pencapaian demi pencapaian kami torehkan di tahun ini.
Kami berhasil mengoperasikan secara komersial PLTA Rajamandala. Keberhasilan pengelolaan lingkungan dan pemberdayaan masyarakat juga kami dibuktikan dengan
raihan 2 PROPER Emas, 11 PROPER Hijau dan 6 PROPER Biru. Capaian ini kami jadikan sebagai bekal untuk dapat
melangkah dengan lebih baik dan percaya diri di tahun 2020 dalam rangka mencapai satu tujuan, yaitu “menjadi
perusahaan energi terbaik yang tumbuh berkelanjutan”.
Accelerating Renewable Energy Development” is our challenge to actualize a clean, sustainable, and reliable future energy. We
obtained many great achievements this year. We have started the operation of Rajamandala Hydropower Plant commercially.
The success of our environmental management and community empowerment is also evidenced by 2 Gold PROPERs, 11 Green
PROPERs, and 6 Blue PROPERs. These achievements are our provision to be better and confident in 2020 to achieve one goal,
“to become the best energy company that grows sustainably.
4 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Ikhtisar Kinerja KeberlanjutanSustainable Performance Overview
Kinerja EkonomiEconomic Performance
IndikatorIndicator
SatuanUnit 2017 2018 2019
Kinerja Produksi dan Operasi Production and Operation Performance Produksi Energi Listrik Pembangkit Milik SendiriPower Generation from Existing Power Plants GWh 42.220,40 41.944,56 39.112,86
Penjualan Energi Listrik Electricity Sales GWh 40.307,40 40.082,53 37.535,45Kapasitas Daya Terpasang Jawa-Bali (Grid dan Embedded)Installed Capacity in Java-Bali (Grid and Embedded) MW 8.954 8.644 8.954
Kinerja Ketersediaan dan Keandalan Pembangkit Availability and Reliability of Power Plants
Equivalent Availability Factor (EAF) % 92,07 87,94 88,64
Scheduled Outage Factor (SOF) % 5,21 5,88 7,27
Equivalent Forced Outage Rate (EFOR) % 2,75 7,35 1,52
Sudden Outage Frequency (SdOF) kali 2,40 2,96 2,30
Efisiensi Thermal Thermal Efficiency % 32,95 33,15 34,07
Tara Kalor Netto Net Heat Rate kCal/kWh 2.609,80 2.594,05 2.524,55
Kinerja Keuangan Financial Performance
Pendapatan Usaha Pendapatan Usaha Rp juta Rp million 39.436.418 43.038.300 42.583.849
Laba Tahun Berjalan Laba Tahun Berjalan Rp juta Rp million 3.232.323 3.501.624 7.370.309Distribusi Nilai Ekonomi kepada Pemangku KepentinganDistribusi Nilai Ekonomi kepada Pemangku Kepentingan Rp juta Rp million 37.003.726 39.147.619 34.388.335
Pelibatan Penyedia Lokal (Nasional) Local (National) Suppliers’ Involvement Jumlah Penyedia NasionalRevenues
Penyedia Penyedia 1.657 1.644 1.714
Persentase Penyedia Nasional Income for the Year % 99,22 98,68 98,90Nilai Pengadaan Penyedia NasionalDistribution of Economic Value to the Stakeholders Rp juta Rp million 7.706.034,26 17.108.868,38 19.084.065,85
34.388.335Rp Juta Million
Distribusi Nilai Ekonomi kepada Pemangku KepentinganDistribution of Economic Value to the Stakeholders
1.159.376Rp Juta Million
Kontribusi pada Penerimaan Negara (Pajak)Contribution to Government Revenues (Taxes)
PLTA Rajamandala(47 MW)
Proyek Energi Baru Terbarukanyang Beroperasi Komersial(Commercial on Date - COD)New Renewable Energy Project that operated Commercially (Commercial Operation Date - COD)
86,17Skor Kepuasan PelangganCustomer Satisfaction Score
Pengelolaan Dampak Ekonomi Tidak LangsungManagement of Indirect Economic Impact
- Pembangunan Infrastruktur Ketenagalistrikan dan Sarana/Prasarana Masyarakat yang Merata
- Peningkatan Keterampilan dan Penciptaan Peluang Usaha Masyarakat Sekitar
- Penyerapan 1.281 Tenaga Kerja Lokal- Pelibatan 98,90% Penyedia Lokal
- Electricity Infrastructure Development and Equitable Facilities/Infrastructure
- Enhancing Skills and Creating Business Opportunities in the Surrounding Communities
- Recruitment of 1,281 Local Manpower- 98.90% of Local Suppliers Involvement
5 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Kinerja LingkunganEnvironmental Performance
IndikatorIndicator
SatuanUnit 2017 2018 2019
Pengelolaan Energi Energy Management
Penggunaan Energi Energy Consumption GJ 499.407.530 504.585.640 464.711.748
Intensitas Energi Energy Intensity GJ/GWh 11.811,70 12.029,82 11.881,30
Jumlah Efisiensi Energi Total Energy Efficiency GJ 28.374.253,83 37.735.384,41 41.779.993,04
Pengelolaan Emisi Emission Management Inventaris Gas Rumah Kaca (Scope 1 dan 2)Greenhouse Gas Inventory (Scope 1 and 2) Ton CO2e 51.621.966,17 59.585.581,58 65.938.756,68
Intensitas Emisi GRK GHG Emission Intensity Kg CO2e/kWh 0,72 0,81 0,95
Jumlah Pengurangan Emisi Total Emission Reduction Ton CO2 1.960.738,84 1.953.899,42 2.286.006,72
Pengelolaan Sumber Daya Air Water Resources Management
Penggunaan Air Water Consumption m3 14.906.590,50 13.326.671,79 14.730.087,71
Konservasi Air Water Conservation m3 837.586,20 1.530.738,62 1.641.661,69
Pengelolaan Limbah Waste ManagementLimbah B3 yang Dihasilkan dan DikelolaB3 Waste Generated and Managed Ton 552.353,03 504.065,38 1.243.964,62
Limbah B3 yang DimanfaatkanB3 Waste Utilized Ton 104,80 739,55 822,49
2.286.006,72Ton CO2
5.874,54GWh
2
Berhasil dikurangi melaluiProgram Pengurangan EmisiSuccessfully reduced through the Emission Reduction Program
Produksi Energi TerbarukanNew Renewable Energy Production
1.641.661,69m3
822,49Ton
41.779.993,04 Gigajoule
Konservasi Keanekaragaman Hayati Biodiversity Conservation
Air Didaur Ulang untuk Digunakan KembaliRecycled Water is Reutilized
Limbah Fly Ash dan Bottom Ash dimanfaatkan untuk Batako dan Paving BlockFly Ash and Bottom Ash waste are utilized as blocks and paving blocks
Berhasil dikurangi melalui Program Peningkatan dan Pembudayaan Efisiensi Energi Ekselen (5E)Successfully reduced through the Enhancing and Embedding Energy
Elang Jawa, Jalak Bali, Penyu Lekang, Sapi Putih Taro, Tukik, Rusa Timor, Badak Jawa, Mangrove, Terumbu Karang, Pohon Endemik dan Tanaman LangkaJavan Hawk-Eagle, Bali Myna, Olive Ridley Sea Turtle, White Taro Ox, Tukik, Javan Rusa, Javan Rhinoceros, Mangrove, Coral Reef, Endemic Tree, and Rare Plant
PLTDG Pesanggaran PLTP Kamojang-Darajat POMUPesanggaran DGPP &GPP Kamojang-Darajat POMU
Proper Emas Gold Proper
11Proper HijauGreen proper
Proper BiruBlue Proper6
6 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Kinerja SosialSocial Performance
IndikatorIndicator
SatuanUnit 2017 2018 2019
Program INPOWER CARE INPOWER CARE ProgramPenyaluran Dana Program INPOWER CAREFund Disbursement for INPOWER CARE Program
Rp JutaRp millon 28.384 36.474 41.241
Pengelolaan Keselamatan dan Kesehatan Kerja Occupational Health and Safety ManagementJumlah Pegawai yang Diwakili Dalam P2K3Employees represented in P2K3
OrangPeople 800 762 849
Frequency Rate Rate 5,75 - 2,19
Pengelolaan Sumber Daya Manusia Human Resources Management
Jumlah Pegawai Tetap Total Permanent Employees Orang People 4.209 4.294 4.320Rata-rata Jam Pelatihan PegawaiAverage Training Hours of Employees
Jam/PesertaHours/Participant 227 432 189
Employee Satisfaction Index % 84,98 97,05 80,84
Employee Enggagement Index % 84,26 82,38 84,19
Ikhtisar Kinerja KeberlanjutanSustainable Performance Overview
Program InPower CareInPower Care Program
41.241Rp Juta Rp Million
Investasi Sosial melalui Program CSRSocial Investment through the CSR Program
Program Pusat Pelayanan Sakit Jiwa (Satya Gawa)- Pengobatan Gratis- Pelatihan Pembuatan Telur Asin
Program Inspirasi Perempuan- 34 Program
Pemberdayaan Perempuan
- 483 Penerima Manfaat
Program Ipreneur- 61 Program Pemberdayaan
Masyarakat Mandiri melalui Pengembangan UKM
Program AdiPertiwi - Pelestarian dan Ekowisata
Lembu Putih Taro- Seni Budaya Bandrong- Pembangunan Ecopark Suralaya
AdiPertiwi Program- Preservation and Ecotourism of
the White Taro Ox- Bandrong Art and Culture- Suralaya Ecopark Construction
Ipreneur Program- 61 Independent Community
Empowerment Program through SMEs Development
Women’s Inspiration Program- 34 Women’s Empowerment
Programs- 483 Beneficiaries
Program IP Pintar- Program Sertifikasi Profesi- Man Power Planning,
Rekrutmen, On Boarding Training Terintegrasi
Mental Illness Service Center Program (Satya Gawa)- Free Medical Treatment- Salted Egg Training
Program IP Pintar- Professional Certification- Integrated manpower
planning, recruitment, on boarding training
IP Academy Fire & SafetyAcademy
Pusat Pengembangan Kompetensi dan Keahlian Pegawai Employees’ Competency and Expertise Development Centre
Peningkatan KapabilitasPegawai terkait K3Employees’ Capacity Building in relation to OHS
Bakti Pelayanan MasyarakatCommunity Assistance
Bakti Pemberdayaan MasyarakatCommunity Empowerment
Bakti Pembinaan HubunganCommunity Relations
7 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
8 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Sambutan Direktur Utama [GRI 102-14]President Director’s Statement [GRI 102-14]
M. Ahsin Sidqi PLT. Direktur UtamaActing of President Director
9 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Para pemangku kepentingan yang budiman,
Puji syukur kepada Tuhan Yang Maha Pengasih, Kami dapat mempersembahkan Laporan Keberlanjutan PT Indonesia Power 2019 ini kepada para pemangku kepentingan.
Berbagai pencapaian dalam bidang ekonomi, sosial, dan lingkungan, serta tata kelola selama 2019 dapat diraih dengan gemilang. Beragam tantangan dapat Kami jawab dengan baik. Itu semua tentunya berkat kerja keras dan kerjasama antara Perusahaan dan para pemangku kepentingan untuk dalam mewujudkan visi Perusahaan untuk “Menjadi perusahaan energi tepercaya yang tumbuh berkelanjutan”.
Laporan ini bukan hanya sebagai tradisi namun juga sebagai bukti keseriusan Kami dalam menunjukkan transparansi dan tanggung jawab sebagai sebuah perusahaan pembangkit listrik kelas dunia yang ingin tumbuh dan berkembang bersama masyarakat dan hidup harmonis dengan alam lingkungan yang lestari.
Tahun ini Kami mengangkat tema “Akselerasi Pengembangan Bisnis Pembangkitan Berbasis Energi Baru Terbarukan (EBT)”. Akselerasi pengembangan bisnis pembangkitan berbasis EBT yang Kami maksudkan adalah upaya penyempurnaan melalui Program Inovasi dan Riset serta Pengembangan yang Kami upayakan terus-menerus tanpa henti, untuk mengembangkan portofolio bisnis baru dan meningkatkan kinerja Perusahaan. Pencapaian demi pencapaian berhasil ditorehkan Perusahaan meliputi berbagai kinerja keberlanjutan, yaitu:
Dear distinguished stakeholders,
With gratitude to the Almighty God, We present the 2019 Sustainability Report of PT Indonesia Power to the stakeholders.
In 2019, various achievements in the economic, social, and environmental, as well as governance, were achieved brilliantly. We answered various challenges well. All of this is because of the hard work and collaboration between the Company and stakeholders to actualize the Company’s vision to “Be a reliable company with sustainable growth”.
The report is not only a tradition, but also a proof of Our commitment to demonstrating the transparency and responsibilities as a world-class power plant company that wants to grow and develop with the community, and live harmoniously with the sustainable environment.
This year, We raise the theme “Accelerating Business Development of New and Renewable Energy-Based Generations (NRE)”. Accelerating the business development of the NRE-based generation through the Innovation and Research and Development Program means that We strive to continuously develop new business portfolios and improve the Company’s performance. The Company recorded many achievements, which include various sustainability performance:
Laporan ini bukan hanya sebagai tradisi namun juga sebagai bukti keseriusan Kami dalam menunjukkan transparansi dan tanggung jawab sebagai sebuah perusahaan pembangkit listrik kelas dunia
yang ingin tumbuh dan berkembang bersama masyarakat dan hidup harmonis dengan alam lingkungan yang lestari.
The report is not only a tradition, but also a proof of Our commitment to demonstrating the transparency and responsibilities as a world-class power plant company that wants to grow and develop with the community, and live
harmoniously with the sustainable environment.
10 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Di tahun 2019 ini, Kami berhasil membukukan pendapatan usaha sebesar Rp42.583.849 juta; relatif stabil dari tahun sebelumnya yaitu sebesar Rp43.038.300 juta. Kami juga sangat berbangga dan bersyukur kehadirat Tuhan Yang Maha Kuasa atas laba tahun berjalan yang naik 110,48%, dari Rp3.501.624 juta tahun 2018 menjadi 7.370.309 juta pada tahun 2019 ini. Dari nilai tersebut, Kami dapat mendistribusikan nilai ekonomi kepada pemangku kepentingan sebesar Rp34.388.335 juta dan kontribusi pada penerimaan negara dari sektor pajak sebesar Rp1.159.376 juta.
Hal lain yang membanggakan Kami adalah mulai beroperasinya secara komersial Proyek Energi Baru Terbarukan PLTA Rajamandala (47 MW) (Commercial on Date - COD). Ini merupakan bukti nyata dari upaya berkesinambungan Indonesia Power untuk membangun dan mengembangkan pembangkit berbasis EBT sebagai komitmen Kami dalam dalam mendorong tercapainya target 23% EBT dalam bauran energi primer di tahun 2025 mendatang.
Keberadaan Perusahaan di tengah-tengah masyarakat juga membawa dampak ekonomi positif yang tidak hanya dirasakan oleh Perusahaan tapi juga masyarakat setempat dengan adanya pembangunan infrastruktur ketenagalistrikan dan sarana/prasarana masyarakat yang merata, peningkatan keterampilan dan penciptaan peluang usaha masyarakat sekitar, penyerapan 1.281 tenaga kerja lokal, dan juga pelibatan 98,90% penyedia lokal dengan nilai pengadaan penyedia nasional sebanyak Rp19.084.065,85 juta (naik 11,54% dari tahun sebelumnya).
Selain itu, nilai kepuasan pelanggan yang disurvei oleh pihak independen memberikan hasil yang membanggakan. Hasil survei atas nilai kepuasan pelanggan tahun 2019 ini adalah sebesar 86,17 dengan kategori “sangat memuaskan”.
Sebagaimana tahun-tahun sebelumnya, Indonesia Power secara rutin melaksanakan sosialisasi dan pelatihan praktik Anti Korupsi kepada pegawai dan mitra kerja sebagai bagian dari penerapan “Indonesia Power Bersih” yang merupakan komitmen GCG untuk menjadikan Indonesia Power bebas Korupsi, Kolusi dan Nepotisme. Program tolak gratifikasi dengan slogan “Tolak, Kembalikan, Laporkan” juga terus Kami jalankan bersama Integrity Note untuk menumbuhkan dan meningkatkan budaya integritas perusahaan yang sehat.
In 2019, We succeeded in recording revenue of Rp42,583,849 million, which relatively stable compared to last year of Rp43,038,300 million. We express our gratitude for the Almighty God as profit for the year increased by 110.48%, from Rp3,501,624 million in 2018 to Rp7,370,309 million in 2019. We were able to distribute economic value to stakeholders amounted to Rp34,388,335 million and contribution to Government Revenues in tax of Rp1,159,376 million from the profit.
We are also proud to say that our Renewable Energy Project has operated commercially, the Rajamandala Hydroelectric Power Plant (47 MW) (Commercial Operation Date - COD). This is clear evidence of Indonesia Power’s continuous efforts to build and develop NRE-based power plants as our commitment in bolstering the achievement of the 23% NRE target in the primary energy mix by 2025.
The Company’s presence in the community also has a positive economic impact, not only for the Company but also for the local community, through the development of electricity infrastructure and equitable community facilities/infrastructure, skills improvement and the creation of business opportunities for the surrounding community, absorption of 1,281 local workers, and local suppliers’ involvement of 98.90% with the procurement value of Rp19,084,065.85 million for the national suppliers (increased by 11.54% from the previous year).
In addition, the customer satisfaction surveyed by an independent party yielded encouraging results. In 2019, the survey conveyed that the value of customer satisfaction was 86.17, under the category “very satisfying”.
As in previous years, Indonesia Power carries out anti-corruption practice dissemination and training to employees and partners as part of the “Indonesia Power Bersih”, a GCG commitment to establishing Indonesia Power that is free of Corruption, Collusion, and Nepotism. We conduct reject gratification program with the slogan “Refuse, Return, Report”, and Integrity Note program to foster and enhance a healthy corporate integrity culture.
Kinerja Ekonomi Economic Performance
Aspek Tata Kelola, Transparansi dan Anti KorupsiGovernance, Transparency, and Anti-Corruption aspects
Sambutan Direktur Utama [GRI 102-14]President Director’s Statement [GRI 102-14]
11 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Dengan jumlah pegawai yang bertambah sebanyak 26 orang menjadi total 4.320 pegawai di tahun 2019 ini, Indonesia Power senantiasa berkomitmen untuk mengembangkan Human Capital Excellence untuk menyiapkan Generasi Pembangkitan yang Kompeten dan Profesional dalam proses akselerasi pengembangan bisnis pembangkitan berbasis EBT. Segala proses ini didukung oleh IP-Academy sebagai Pusat Pengembangan Kompetensi dan Keahlian Pegawai.
Jumlah rata-rata jam pelatihan pegawai adalah 189 jam pelatihan. Kepuasan pegawai juga selalu diukur. Saat ini Employee Satisfaction Index adalah 80,84% dan Employee Engagement Index sebesar 84,19%.
Program Kesehatan dan Keselamatan Kerja tidak hanya dilakukan bagi pegawai Indonesia Power, tetapi juga bagi kontraktor. Berbagai pencapaian gemilang di bidang K3 juga diraih Indonesia Power sehingga semakin memicu Kami untuk meningkatkan kapabilitas pegawai terkait K3 melalui Fire & Safety Academy.
Untuk mewujudkan kemandirian masyarakat, Kami menerapkan InPower Care (Indonesia Power Community Assistance, Relation and Empowerment) sebagai panduan pelaksanaan program CSR Indonesia Power yang terintegrasi dengan unit-unit Perusahaan yang mencakup Bakti Pelayanan pada Masyarakat, Bakti Pembinaan Hubungan dan Bakti Pemberdayaan Masyarakat. Tahun ini Kami berhasil menyalurkan dana Program INPOWER CARE sebesar Rp41.241 juta atau meningkat 13,07% dari tahun 2018.
In 2019, the additional 26 employees provide the Company with a total of 4,320 employees. Indonesia Power is always committed to developing Human Capital Excellence to prepare a Competent and Professional Power Generation in accelerating the business development of the NRE-based generation. All these processes are supported by IP-Academy as an Employee Competency and Expertise Development Center.
The average employee training hour reached 189 hours of training per participant. We always measure the employees’ satisfaction. Currently, the Employee Satisfaction Index is 80.84% and the Employee Engagement Index is 84.19%.
Occupational Health and Safety program is not only conducted for Indonesia Power’s employees, but also contractors. Indonesia Power also obtained various achievements in the OHS field, thus motivating Us to enhance the OHS capability of employees through Fire & Safety Academy.
We implement InPower Care (Indonesia Power Community Assistance, Relations, and Empowerment) as a guide to Indonesia Power’s CSR program, which is integrated with the Company’s units which cover Community Assistance, Community Relations, and Community Empowerment Services to realize community independence. This year, We disbursed Rp41,241 million for INPOWER CARE Program, an increase of 13.07% compared to 2018.
Aspek Sosial Social Aspect
Indonesia Power juga terus melaksanakan Survei Perilaku Etis secara rutin kepada mitra kerja dengan lebih terarah untuk melihat indeks penerapan GCG dan mendeteksi kemungkinan munculnya perilaku fraud dari mitra kerja. Penerapan Enterprise Risk Management yang terintegrasi dalam keseluruhan proses bisnis juga Kami upayakan secara berkesinambungan.
Pengukuran Key Performance Indicators (KPI) juga dilakukan kepada Direksi sebagai bukti bahwa implementasi tata kelola yang baik dimulai dari komitmen pimpinan puncak untuk mewujudkan IP-Bersih. Pada tahun 2019, pencapaian KPI Direksi secara kolegial adalah sebesar 90,66 dimana aspek yang mencapai target adalah fokus tenaga kerja dan kepemimpinan, tata kelola dan tanggung jawab kemasyarakatan. Selanjutnya penilaian atas GCG Direksi tahun 2019 mencapai skor 96% dengan kualitas penerapan GCG “Sangat Baik”.
Indonesia Power carries out regular Ethical Behavior Surveys to business partners focusing on the GCG implementation index and possible fraud behavior detection in partners. We strive to implement integrated Enterprise Risk Management in all business processes.
We assess the Board of Directors’ Key Performance Indicators (KPI) as evidence that the good governance implementation starts from the commitment of the top leadership to realize IP-Bersih. In 2019, the Board of Directors’ collective achievement of KPI is 90.66, with targeted aspects of employment and leadership, governance, and corporate responsibility. Further, the Board of Directors’ GCG assessment in 2019 scored 96% with “Very Good” GCG implementation quality.
12 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Berbagai kegiatan Kami laksanakan dalam kerangka InPower Care ini, misalnya: • Bakti Pelayanan Masyarakat dengan Program Pusat Pelayanan
Sakit Jiwa (Satya Gawa), dengan melakukan Pengobatan Gratis dan Pelatihan Pembuatan Telur Asin;
• Bakti Pembinaan Hubungan dengan Program IP Pintar, dengan melakukan Program Sertifikasi Profesi, Man Power Planing Recruitment, On Boarding Training Terintegrasi; dan
• Bakti Pemberdayaan Masyarakat dengan Program Inspirasi Perempuan (dengan melakukan 34 Program Pemberdayaan Perempuan yang diberikan kepada 483 Penerima Manfaat), Program Ipreneur (dengan melakukan 61 Program Pemberdayaan Masyarakat Mandiri melalui Pengembangan UKM), dan Program AdiPertiwi (dengan melakukan Pelestarian dan Ekowisata Lembu Putih Taro, Seni Budaya Bandrong, dan Pembangunan Ecopark Suralaya).
We carry out various activities in regards to InPower Care: • Community Assistance, with the Mental Illness Service Center
Program (Satya Gawa), by conducting Free Medical Treatment and Training in Making Salted Eggs;
• Community Relations, with IP Pintar Program, by conducting Professional Certification Program, Manpower Planning Recruitment, Integrated On-Boarding Training; and
• Community Empowerment, with the Women’s Inspiration Program (by conducting 34 Women’s Empowerment Programs provided to 483 Beneficiaries), the Ipreneur Program (by conducting 61 Independent Community Empowerment Programs through Development of SMEs), and the AdiPertiwi Program (by carrying out the Conservation and Ecotourism of the Taro White Ox, Bandrong Culture Art, and Ecopark Suralaya Development).
Indonesia Power menerapkan Sistem Manajemen yang Terintegrasi (Integrated Management System/IMS) di mana pengelolaan lingkungan menjadi salah satu komponen dalam IMS. Di tingkat strategis, Kantor Pusat bertindak memberikan arahan bagi unit-unit di lingkungan Perusahaan, dan unit-unit mengelola aspek lingkungan sesuai dengan sifat dan skala dampak masing-masing.
Beragam pencapaian luar biasa di bidang pengelolaan lingkungan ditorehkan Indonesia Power pada tahun 2019 ini. Di tahun ini, Kami berhasil melakukan penurunan konsumsi energi sebesar 464.711.748 GJ atau turun 7,90% dari tahun 2018. Efisiensi energi juga berhasil kami lakukan sebesar 41.779.993,04 GJ, dimana kondisi ini meningkat 10,72% dari tahun 2018 berkat Program 5E (Enhancing and Embedding Energy Efficiency Excellence) yang semakin inovatif setiap tahunnya. Selain itu, Indonesia Power juga berhasil mengurangi jumlah emisi yang dikeluarkan sebesar 2.286.006,72 ton CO2. Ini artinya Kami berhasil mengurangi emisi sebesar 17% dari tahun sebelumnya.
Begitupun dalam hal pengelolaan limbah, dimana terjadi penurunan jumlah limbah B3 yang dimanfaatkan kembali meningkat 11,21% dari 739,55 ton di tahun sebelumnya menjadi 822,49 ton di tahun 2019 ini. Sama halnya dengan daur ulang air yang digunakan kembali, yang berhasil Kami tingkatkan dari tahun sebelumnya menjadi 1.641.661,69 m3.
Beberapa program konservasi Keanekaragaman Hayati juga Kami lakukan di 2019 ini, misalnya konservasi Elang Jawa, Jalak Bali, Penyu Lekang, Sapi Putih Taro, Tukik, Rusa Timor, Badak Jawa, Mangrove, Terumbu Karang, Pohon Endemik dan Tanaman Langka.
Indonesia Power implements an Integrated Management System (IMS), and environmental management is one of the components in IMS. Strategically, Head Office acts to provide direction for units in the Company’s environment, and the units manage the environmental aspect in line with the nature and the scale of their impacts.
Indonesia Power inscribed various outstanding achievements in environmental management in 2019. This year, We successfully reduced energy consumption by 464,711,748 GJ, a decrease of 7.90% from 2018. We also succeeded in achieving energy efficiency by 41,779,993.04 GJ, an increase of 10.72% compared to 2018, due to a more innovative 5E (Enhancing and Embedding Energy Efficiency Excellence) Program. In addition, Indonesia Power reduced the number of emissions released by 2,286,006.72 tons of CO2. Therefore, We succeeded in reducing emissions by 17% from the previous year.
Likewise, in terms of waste management, the reutilization of B3 waste increased by 11.21%, from 739.55 tons in 2018 to 822.49 tons in 2019. The utilization of recycled water also increased compared to the previous year, to 1,641,661.69 m3.
We carry out several biodiversity conservation programs in 2019, e.g. the conservation of Javan Hawk-eagle, Bali Myna, Olive Ridley Sea Turtle, White Taro Ox, Tukik, Javan Rusa, Javan Rhinoceros, Mangrove, Coral Reef, Endemic Tree, and Rare Plant.
Aspek LingkunganEnvironmental Aspect
Sambutan Direktur Utama [GRI 102-14]President Director’s Statement [GRI 102-14]
13 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Para pemangku kepentingan yang budiman,
Kami menyadari bahwa masa depan yang penuh tantangan harus Kami sikapi dengan cerdas dan bijaksana. Namun Kami yakin bahwa Kami akan sanggup menghadapi berbagai tantangan dengan kerjasama yang erat antara Perusahaan dan pemangku kepentingan.
Saat ini, berdasarkan analisis SWOT dengan Internal Factor Evaluation (IFE) dan External Factor Evaluation (EFE), Perusahaan berada pada posisi yang baik, sehingga strategi yang sesuai untuk Perusahaan adalah Grow and Build. Oleh sebab itu, sebagaimana arahan Pemegang Saham dengan Strategic Mission-nya, maka value utama yang diberikan oleh Indonesia Power adalah Securing Business Sustainability, Optimizing Cost Efficiency dan Leading Industry Capabilities (SOLID), yaitu memastikan keberlangsungan suplai energi listrik untuk keberlangsungan bisnis, melakukan efisiensi biaya, meningkatan keunggulan operasional dengan mengembangkan kemampuan internal, mengembangkan usaha bisnis, dan menerapkan teknologi baru dalam menjawab tantangan tren disruptif, perubahan regulasi dan mengembangkan bisnis strategis untuk mempertahankan posisi kompetitif, misalnya dengan pengembangan EBT.
Sebagai penutup, segenap manajemen dan karyawan Indonesia Power menyampaikan apresiasi setinggi-tingginya atas dukungan seluruh pemangku kepentingan. Semoga nilai-nilai keberlanjutan yang sudah dicapai sangat baik di 2019 dapat kita tingkatkan kembali di 2020 sehingga impian kita bersama untuk menjadikan Indonesia Power “Menjadi Perusahaan Pembangkit Tepercaya Yang Menerangi Hingga Ke Pelosok Negeri” dapat kita raih dengan sukses.
Dear distinguished stakeholders,
We realize that our future is full of challenges to overcome intelligently and wisely. However, We believe We shall be able to face the challenges by tight cooperation between the Company and the stakeholders.
Currently, based on a SWOT analysis with Internal Factor Evaluation (IFE) and External Factor Evaluation (EFE), the Company is in a good position. The appropriate strategy for the Company is to Grow and Build. Therefore, as directed by the Shareholders in their Strategic Mission, Indonesia Power provides the main value of Securing Business Sustainability, Optimizing Cost Efficiency, and Leading Industry Capabilities (SOLID), by ensuring the continuity of electricity supply for business continuity, implementing cost efficiency, refining operational excellence by developing internal capabilities, developing business ventures, and implementing new technologies in response to the challenges of disruptive trends, changing regulations, and developing strategic businesses, to maintain competitive positions, e.g. by developing NRE.
Finally, the management and all employees of Indonesia Power expressed our highest appreciation for the support of all stakeholders. We hope that the sustainability values that have been achieved very well in 2019 can be enhanced in 2020, thus our common dream to make Indonesia Power “A Trusted Generation Company that Illuminates the Whole Country” can be achieved successfully.
Menjawab Tantangan Masa DepanResponding to Future Challenges
Berkat berbagai upaya di bidang lingkungan dan sosial, Indonesia Power berhasil mendapatkan 2 PROPER Emas untuk Unit PLTDG Pesanggaran dan PLTP Kamojang-Darajat POMU. Secara total untuk seluruh unit, Indonesia Power meraih 2 PROPER Emas, 11 PROPER Hijau, dan 6 PROPER Biru.
Because of various environmental and social efforts, Indonesia Power obtained 2 Gold PROPERs for Pesanggaran DGPP and the GPP Kamojang-Darajat POMU. In total, Indonesia Power won 2 Gold PROPERs, 11 Green PROPERs, and 6 Blue PROPERs.
PLT. Direktur UtamaActing of President Director
M. Ahsin Sidqi
14 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Strategi Dalam PencapaianTujuan Pembangunan BerkelanjutanSustainability Strategies in Achieving Sustainable Development Goals
Tujuan Pembangunan Keberlanjutan (Sustainable Development Goals - SDGs) merupakan agenda global tahun 2030 yang menjadi cetak biru untuk pencapaian pembangunan masa depan yang berkelanjutan dengan menjawab tantangan atas isu global, termasuk di dalamnya kemiskinan, kesehatan, pendidikan, kesetaraan gender, perubahan iklim, kerusakan lingkungan, hak asasi manusia, perdamaian dan keadilan sosial. Sebagai Perusahaan Pembangkitan yang Tepercaya di Indonesia, Indonesia Power ikut serta dalam upaya untuk berkontribusi pada pencapaian SDGs di tingkat nasional dan internasional dengan merumuskan dan menjalankan strategi inisiatif terkait isu keberlanjutan yang dituangkan dalam Roadmap Keberlanjutan Indonesia Power.
Roadmap Keberlanjutan Indonesia Power merupakan suatu rencana dan strategi untuk mencapai tujuan keberlanjutan Perusahaan. Tujuan utama dari roadmap ini adalah untuk mendukung pencapaian tujuan pembangunan berkelanjutan yang dilaksanakan secara holistik di seluruh unit Perusahaan dan menciptakan nilai positif bagi seluruh pemangku kepentingan yang relevan.
The Sustainable Development Goals (SDGs) are a global agenda in 2030 as a blueprint for achieving sustainable future development by addressing challenges to global issues, including poverty, health, education, gender equality, climate change, environmental damage, human rights, peace, and social justice. As a Reliable Power Generation Company in Indonesia, Indonesia Power participates to contribute to the achievement of SDGs at the national and international levels by formulating and implementing initiative strategies related to sustainability issues, as outlined in the Indonesia Power Sustainability Roadmap.
The Indonesia Power Sustainability Roadmap is a plan and strategy to achieve the Company’s sustainability goals. The main objective of this roadmap is to support the achievement of sustainable development goals that are implemented holistically in all Company’s units and create positive value for all relevant stakeholders.
Mencakup seluruh aspek dalam value
chain (SIPOC)Covers all aspects of the value chain
(SIPOC)
SupplyMenyediakan bahan baku ramah lingkungan dan bekerjasama dengan supplier bisnis bertanggung jawabProviding environmentally friendly raw materials and cooperating with responsible business suppliers
InputOrganizational governance yang baikGood organizational governance
ProcessPraktik ketenagakerjaan yang mengutamakan K3, kesejahteraan kebahagiaan dan kebanggan bekerjaEmployment practices that prioritize OHS, welfare, happiness, and working pride
OutputPelaksanaan pengelolaan lingkungan dan pengembangan masyarakatImplementation of environmental management and community development
CustomerPenanganan pelanggan yang terbaikBest customer handling
Karakteristik Roadmap Keberlanjutan Indonesia PowerCharacteristics of the Indonesia Power Sustainability Roadmap
15 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Pertumbuhan kinerja keberlanjutan Indonesia Power juga tak terlepas pada komitmen Kami dalam membangun pondasi yang kuat terhadap pencapaian SDGs yang didasarkan pada lima pilar sebagai berikut:
The growth of Indonesia Power’s sustainability performance is inseparable from our commitment in establishing a strong foundation for achieving SDGs, based on the five pillars as follows:
Mengatasi tantangan dan memaksimalkan peluang bisnisOvercoming challenges and maximizing business opportunities
Mencapai SustainableDevelopment Goals (SDGs)yang menciptakan nilai dan mendukung strategiAchieving Sustainable Development Goals (SDGs) that create value and support strategies
Implementasi seluruh core subject ISO 26000Implementation of all core subject areas of ISO 26000
Melaksanakan program keberlanjutansecara holistik dan pendekatansystem thinkingCarrying out a sustainability program in a holistic and system thinking approach
Menjalankan inclusive business dan menciptakannilai positif bagi seluruh pemangku kepentinganyang relevan (Creating Shared Value)Carrying out inclusive business and creating positive value for all relevant stakeholders (Creating Shared Value)
Komitmen pada masyarakat sekitar Perusahaan mendorong kemandirian ekonomi melalui Program Pemberdayaan MasyarakatCommitment to the communities surrounding the Company to encourage economic independence through the Community Empowerment Program
Komitmen menjaga ekosistem lingkungan melalui program: Pemenuhan ketaatan aturan lingkungan (PROPER), GO90, Hijaunesia Power dan Kawan Hijaunesia PowerCommitment to protecting the environmental ecosystem through programs: Compliance with environmental regulations (PROPER), GO90, Hijaunesia Power, and Kawan Hijaunesia Power
Berkontribusi dalam mewujudkan kesejahteraan bagi seluruh stakeholderContribute to actualizing welfare of all stakeholders
Berkomitmen mengimplementasikan seluruh program tanggung jawab sosial dengan bekerjasama dengan berbagai pihak, diantaranya pemerintah, masyarakat, dunia pendidikan, civil society dan mediaCommitted to implementing all social responsibility programs, in collaboration with various parties, including the government, the community, the academic world, civil society, and the media
Berkontribusi dalam mewujudkan masyarakat yang damai, adil dan inklusif yang bebas dari rasa takut dan kekerasan, melaui penggunaan teknologi sistem yang safetyContribute to actualizing a peaceful, just, and inclusive society that is free from fear and violence, by utilizing safety technology system
People
Planet
Prosperity
Partnership
Peace
12345
16 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Melalui lima pilar tersebut, pendekatan Kami terhadap pencapaian SDGs di berbagai bidang termasuk ekonomi, kelestarian lingkungan, sumber daya manusia, keselamatan dan kesehatan kerja, kesejahteraan dan pembangunan sosial serta tata kelola menjadi lebih terintegrasi di seluruh organisasi kami.
Through these five pillars, Our approach to achieving SDGs in various fields, including economics, environmental sustainability, human resources, occupational health and safety, welfare, and social development, as well as governance, has become more integrated throughout our organization.
Strategi Keberlanjutan Dalam Pencapaian Tujuan Pembangunan BerkelanjutanSustainability Strategies in Achieving Sustainable Development Goals
SDGsLingkungan HidupEnvironment
EkonomiEconomy
Kesejahteraan IndividuIndividual Welfare
MasyarakatSociety
Fokus SDGs Indonesia PowerIndonesia Power’s SDGs Focus
17 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Isu dan Strategi Keberlanjutan Kami
Our Sustainabilty Issues and Strategies
Program Inisiatif Unggulan
Flagship Initiative Program
Capaian Program Tahun 2019
Performance Achieved In 2019
GRI Standards dan
Pengungkapan Sektor Utilitas
ListrikGRI Standards
and Electric Utilities Sector
Disclosures
SDGs HalamanPage
Meningkatkan Kinerja Usaha Dalam Mengoptimalkan Kontribusi Bagi Negeri dan Menciptakan Manfaat Bagi Seluruh Pemangku KepentinganImproving Business Performance in Optimizing Contributions to the Country and Creating Benefits for All Stakeholders
Menyelesaikan Pembangunan Proyek Strategis Pembangkit Listrik Nasional hingga beroperasi secara komersial (Commercial Operation Date – COD)Completed the Construction of the Power Plant National Strategic to commercially operate (Commercial Operation Date - COD)
- COD PLTA Rajamandala (47 MW) tanggal 12 Mei 2019
- COD PLTD Senayan (101 MW) tanggal 5 Desember 2019
- COD of Rajamandala HPP (47 MW) on 12 May 2019
- COD of Senayan DPP (101 MW) on 5 December 2019
GRI 203-1 -
Pembangunan Pembangkit di Indonesia Timur Untuk Meningkatkan Rasio Elektrifikasi Listrik di Daerah Tertinggal, Terdepan dan Terluar (3T)Development of Power Plants in Eastern Indonesia to Increase Electrification Ratio in Disadvantaged, Frontier, and Outermost (3T) Regions
- Proyek Beroperasi: MPP Merauke 2 (20 MW), MPP Sorong (20 dan 30 MW) dan MPP Biak 2 (10 MW)
- Projects Operating: Merauke MPP 2 (20 MW), Sorong MPP (20 and 30 MW) and Biak 2 MPP (10 MW)
GRI 203-1 -
Pembangunan Infrastruktur Untuk Menunjang Sarana dan Prasarana Umum Bagi Masyarakat SekitarInfrastructure Development to Support Public Facilities and Infrastructure for the Surrounding Communities
- Pembangunan dan perbaikan sarana sanitasi- Renovasi rumah menjadi layak huni- Pembangunan dan renovasi sarana ibadah
dan sarana pendidikan- Construction and repair of sanitation
facilities- Renovation of decent livable housing- Construction and renovation of religious
facilities and educational facilities
GRI 203-1 -
Peningkatan Keterampilan dan Penciptaan Peluang Usaha Masyarakat Sekitar Enhancing Skills and Creating Business Opportunities in Surrounding Communities
- Pelaksanaan salah satu Program InPower Care: “Program Desa Kopi Konservasi Tanaman Kopi Anti Erosi” dengan total omzet kelompok selama tahun 2019 sebesar Rp739 juta
- One of the InPower Care Programs: “Coffee Plant Conservation Village Program for Anti-Erosion” with a total group’s turnover during 2019 amounted to Rp739 million
GRI 203-2 -
Integrasi Program Keberlanjutan Indonesia Power terhadap SDGsIntegration of the Indonesia Power Sustainability Program into SDGs
18 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Isu dan Strategi Keberlanjutan Kami
Our Sustainabilty Issues and Strategies
Program Inisiatif Unggulan
Flagship Initiative Program
Capaian Program Tahun 2019
Performance Achieved In 2019
GRI Standards dan
Pengungkapan Sektor Utilitas
ListrikGRI Standards
and Electric Utilities Sector
Disclosures
SDGs HalamanPage
Mendistribusikan Nilai Ekonomi yang Dihasilkan Kepada Pemangku KepentinganDistributing Economic Value Generated to Stakeholders
Rp34.388.335 jutaRp34,388,335 million
GRI 201-1 -
Program Sustainable Research and Development (R&D)Sustainable Research and Development (R&D) Program
Terlaksananya Pre FS 1 MW Ground Mounting PVPre-FS 1 MW Ground Mounting PV
GRI 201-2EU8
-
Mengelola Dampak Lingkungan Untuk Menjaga Kelestarian BumiManaging Environmental Impacts to Protect the Earth’s Sustainability
Pengelolaan Efisiensi Energi Energy Efficiency Management
- Program Enhancing and Embedding Energy Efficiency Excellence (Program 5E) berhasil menciptakan efisiensi energi sebesar 41.779.993,04 GJ
- Penggunaan energi primer yang berasal dari Energi Baru Terbarukan (EBT) sebesar 20.651.869 GJ
• The Enhancing and Embedding Energy Efficiency Excellence Program (5E Program) succeeded in generating energy efficiency of 41,779,993.04 GJ
• The primary energy utilization derived from New Renewable Energy (NRE) amounted to 20,651,869 GJ
GRI 302-1GRI 302-2GRI 302-3GRI 302-4GRI 302-5
-
Menjaga Kualitas Udara Untuk Mengatasi Dampak Perubahan IklimMaintaining Air Quality to Overcome the Climate Change Impacts
- Pengurangan Emisi sebesar 2.286.006,72 ton CO2 salah satunya dengan melakukan konversi bahan bakar (gasifikasi dan pemakaian Biomass)
- Tidak menggunakan bahan refrigerant dan AC yang mengandung bahan-bahan perusak lapisan ozon
- Melakukan Clean Development Mechanism (CDM) pada Unit PLTP Gunung Salak
- Emission reduction of 2,286,006.72 tons of CO2, one of which is by converting fuel (gasification and use of biomass)
- Not using refrigerant and AC that contain ozone-depleting substances
- Conducting Clean Development Mechanism (CDM) at Gunung Salak GPP Unit
GRI 305-1GRI 305-2GRI 305-3GRI 305-4GRI 305-5GRI 305-6GRI 305-7
EU5
-
Strategi Keberlanjutan Dalam Pencapaian Tujuan Pembangunan BerkelanjutanSustainability Strategies in Achieving Sustainable Development Goals
19 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Isu dan Strategi Keberlanjutan Kami
Our Sustainabilty Issues and Strategies
Program Inisiatif Unggulan
Flagship Initiative Program
Capaian Program Tahun 2019
Performance Achieved In 2019
GRI Standards dan
Pengungkapan Sektor Utilitas
ListrikGRI Standards
and Electric Utilities Sector
Disclosures
SDGs HalamanPage
Pengelolaan Efisiensi AirWater Efficiency Management
- Konservasi air 1.018.623,68 m3 melalui program Reduce, Reuse, Recycle (3R)
- Terjadi penurunan 38,87% penggunaan air yang bersumber dari air tanah
- Water conservation of 1,018,623.68 m3 through the Reduce, Reuse, Recycle (3R) program
- There was a 38.87% decrease in the use of groundwater
GRI 303-1GRI 303-3
-
Pemanfaatan LimbahWaste Utilization
- Pemanfaatan 822,49 ton Fly Ash dan Bottom Ash (FABA)
- Program penggiat bank sampah (Program Tempat Olah Sampah Setempat - TOSS) yang dapat mereduksi timbulan sampah sebesar 6 ton/hari di Kecamatan Dawan
- Utilization of 822.49 tons of Fly Ash and Bottom Ash (FABA)
- The garbage bank activator program (Local Trash Can Program - TOSS), which reduces waste generation by 6 tons/day in Dawan Sub-District
GRI 306-2 -
Menjaga Ekosistem Perairan/Laut dan DaratConserving Aquatic/Marine and Land Ecosystems
- Tidak menggunakan air yang bersumber dari badan air yang berada di kawasan lindung dan badan air yang berada di lokasi-lokasi daerah water-stressed area
- Perlindungan keanekaragaman hayati berbagai satwa langka dan endemik (Konservasi Elang Jawa, Jalak Bali, Penyu Lekang, Sapi Putih Taro, Tukik, Rusa Timor, Badak Jawa, Mangrove, Terumbu Karang, Pohon Endemik dan Tanaman Langka)
- Program Kawan Hijaunesia Power dengan jumlah penanaman pohon sebanyak 40.604 pohon
- Memperhatikan kualitas air limbah sesuai baku mutu sebelum dialirkan ke badan air
- Tidak terjadi insiden tumpahan batubara, minyak/pelumas maupun bahan kimia yang digunakan
- Not using water sourced from water bodies in protected areas and water bodies in water-stressed areas
- Biodiversity conservation of endangered animals and endemic plants (Conservation of Javan Hawk-eagle, Bali Myna, Olive Ridley Sea Turtle, White Taro Ox, Tukik, Javan Rusa, Javan Rhinoceros, Mangrove, Coral Reef, Endemic Tree, and Rare Plant)
- The Kawan Hijaunesia Power Program planted 40,604 trees
- Focusing on the quality of wastewater in line with the quality standards before flowing them to water bodies
- There were no incidents of coal, oil/lubricant, or chemicals spills
GRI 303-2GRI 304-1GRI 304-2GRI 304-3GRI 304-4GRI 306-1GRI 306-3GRI 306-4GRI 306-5
EU13
-
20 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Isu dan Strategi Keberlanjutan Kami
Our Sustainabilty Issues and Strategies
Program Inisiatif Unggulan
Flagship Initiative Program
Capaian Program Tahun 2019
Performance Achieved In 2019
GRI Standards dan
Pengungkapan Sektor Utilitas
ListrikGRI Standards
and Electric Utilities Sector
Disclosures
SDGs HalamanPage
Penyediaan dan Pengembangan Pembangkit Energi Baru Terbarukan (EBT)Provision and Development of New and Renewable Energy (NRE) Power Plant
Pengembangan Pembangkit Listrik dari Sumber EBT:- Pembangkit Listrik Tenaga Air (PLTA)- Pembangkit Listrik Tenaga Mini Hidro (PLTM)- Pembangkit Listrik Tenaga Panas Bumi (PLTP)- Pembangkit Listrik HybridKerjasama terkait Pengembangan EBT:- Kerjasama instalasi PLTSa dengan Waskita
Karya- Kerjasama pengembangan sumber EBT
dengan Pemerintah Provinsi Bangka Belitung- Kerjasama pembangunan Pembangkit Listrik
Biomass dengan Pd Tebo Holding CompanyDevelopment of NRE-Sourced Power Plants:- Hydroelectric Power Plant (HPP)- Mini-Hydro Power Plant (MHPP)- Geothermal Power Plant (GPP)- Hybrid Power PlantCollaboration in NRE Development:- Cooperation to install WEPP with Waskita
Karya- Cooperation to develop NRE resources with
Bangka Belitung Provincial Government- Cooperation to construct Biomass Power
Plant with Pd Tebo Holding Company
EU8 -
Meningkatkan Kualitas Penerapan Prinsip Tata Kelola yang Baik Dengan Memerangi dan Mencegah Segala Bentuk Praktik Korupsi dan Penyalahgunaan Wewenang (Fraud)Improving the Quality of Good Governance Principles by Battling and Preventing All Forms of Corruption and Abuse of Authority (Fraud) Practices
Anti KorupsiAnti-Corruption
- Set Up ISO 37001:2016 Sistem Manajemen Anti Penyuapan
- Pelatihan Anti Korupsi kepada 116 insan Perusahaan
- Sosialisasi komitmen 3T (Tidak Suap, Tidak Gratifikasi, Tidak Fraud)
- Tidak terjadi insiden korupsi atau pelanggaran yang bersifat fraud yang dilakukan insan Perusahaan
- Sosialisasi Pengendalian Gratifikasi kepada 660 Mitra Kerja
- Peringatan Hari Anti Korupsi Sedunia (HAKORDIA)
- Set up ISO 37001:2016 Anti-Bribery Management System
- Anti-Corruption training to 116 Company’s personnel
- 3T commitment socialization (No Bribery, No Gratuity, No Fraud)
- There were no incidents of corruption or fraudulent violations committed by the Company’s personnel
- Gratification Control Socialization to 660 Partners
- World Anti-Corruption Day (HAKORDIA)
GRI 205-1GRI 205-2GRI 205-3
-
Strategi Keberlanjutan Dalam Pencapaian Tujuan Pembangunan BerkelanjutanSustainability Strategies in Achieving Sustainable Development Goals
21 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Isu dan Strategi Keberlanjutan Kami
Our Sustainabilty Issues and Strategies
Program Inisiatif Unggulan
Flagship Initiative Program
Capaian Program Tahun 2019
Performance Achieved In 2019
GRI Standards dan
Pengungkapan Sektor Utilitas
ListrikGRI Standards
and Electric Utilities Sector
Disclosures
SDGs HalamanPage
Pencegahan dan Penanganan Benturan KepentinganPrevention and Handling of Conflicts of Interest
- Adanya Pedoman Benturan Kepentingan Dalam Keputusan Direksi Nomor 166.K/10/IP/2014
- Dewan Komisaris maupun Direksi tidak memiliki hubungan keluarga dan keuangan dengan sesama anggota Dewan Komisaris, Direksi dan Pemegang Saham Utama dan/atau Pengendali
- Conflict of Interest Guidelines in the Board of Directors’ Decree No. 166.K/10/IP/2014
- The Board of Commissioners and the Board of Directors have no familial and financial relations with fellow members of the Board of Commissioners, the Board of Directors, and Major and/or Controlling Shareholders
GRI 102-16GRI 102-17GRI 102-25
-
Pengembangan dan Peningkatan Pengetahuan terkait Pembangunan BerkelanjutanKnowledge Development and Enhancement related to Sustainable Development
Terlaksananya seminar, conference dan workshop Direksi terkait Renewable Energy Development The Board of Commissioners and Board of Directors participated in the Training related to Sustainable Development, i.e.
GRI 102-27 -
Mencapai Kinerja Ekselen dengan SDM Unggul Melalui Penciptaan Lingkungan Kerja yang Adil dan LayakAchieving Excellent Performance with Superior HR by Creating a Fair and Decent Work Environment
Pengembangan Kompetensi dan Keahlian PegawaiEmployee Competency and Expertise Development
Program IP Academy:- Pembangunan dan pengembangan pusat
pengembangan expertise dan centre of excellence
- Akselerasi percepatan kompetensi operasi dan pemeliharaan
- Pendidikan Formal- Sertifikasi- Community of Expertise- Program pelatihan pegawai dengan rata-rata
jam pelatihan mencapai 189 jam/peserta- Pelatihan Masa Persiapan PensiunIP Academy Program:- Construction and development of a center
for the development of expertise and center of excellence
- Acceleration of operational and maintenance competencies
- Formal education- Certification- Community of Expertise- The average hour of employees’ training
reached 189 hours of training per participant
- Pension Preparation Training
GRI 404-1GRI 404-2
EU14
-
Penyediaan Lapangan Pekerjaan yang Adil/Setara Provision of Fair/Equitable Employment
- Rekrutmen 155 pegawai baru (112 pria dan 43 wanita)
- Recruitment of 155 new employees (112 men and 43 women)
GRI 401-1
22 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Isu dan Strategi Keberlanjutan Kami
Our Sustainabilty Issues and Strategies
Program Inisiatif Unggulan
Flagship Initiative Program
Capaian Program Tahun 2019
Performance Achieved In 2019
GRI Standards dan
Pengungkapan Sektor Utilitas
ListrikGRI Standards
and Electric Utilities Sector
Disclosures
SDGs HalamanPage
Keberagaman dan Kesetaraan Dalam Komposisi Badan Tata Kelola dan Komposisi Pegawai PerusahaanDiversity and Equality in the Composition of Corporate Governance and Company’s Employees
- Terdapat 1 orang wanita menduduki posisi Direksi Perusahaan
- Terdapat 900 orang pegawai wanita- There is 1 woman who holds the position of
the Company’s Director- There are 900 female employees
GRI 102-22GRI 102-24GRI 405-1
Pemberian Remunerasi dan Fasilitas Pegawai yang SetaraProvision of Equal Employee Remuneration and Facilities
- Kepatuhan terhadap upah minimum dengan rasio gaji pegawai entry level dengan upah minimum: 2,80
- Memastikan hak-hak pegawai tetap maupun tidak tetap sesuai standar peraturan ketenagakerjaan yang berlaku
- Kesetaraan remunerasi pegawai wanita dan pria
- Sebanyak 58 orang pegawai wanita menggunakan hak cuti melahirkan
- Compliance with minimum wages, proven by the ratio of entry-level employee salaries to the minimum wage of 2.80
- Ensuring the rights of permanent and non-permanent employees are in accordance with prevailing labor regulations
- Equal remuneration for men and women employees
- There were 58 female employees who exercise their rights to maternity leave
GRI 202-1GRI 401-2GRI 401-3GRI 405-2
Kesetaraan Dalam Pengembangan Karir PegawaiEquality in Employee Career Development
- Sebanyak 5 pegawai wanita dipromosikan- Five female employees were promoted
GRI 404-3
Menaati Setiap Peraturan dan Kebijakan Terkait Hak Asasi ManusiaComplying with Every Regulation and Policy Regarding Human Rights
- Mencegah praktik diskriminasi, kerja paksa dan pekerja anak
- Memberikan kebebasan kepada setiap pegawai untuk berkumpul/berserikat
- Preventing practice of discrimination, forced labor, and child labor
- Providing freedom to every employee to gather/associate
GRI 102-41
Strategi Keberlanjutan Dalam Pencapaian Tujuan Pembangunan BerkelanjutanSustainability Strategies in Achieving Sustainable Development Goals
23 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Isu dan Strategi Keberlanjutan Kami
Our Sustainabilty Issues and Strategies
Program Inisiatif Unggulan
Flagship Initiative Program
Capaian Program Tahun 2019
Performance Achieved In 2019
GRI Standards dan
Pengungkapan Sektor Utilitas
ListrikGRI Standards
and Electric Utilities Sector
Disclosures
SDGs HalamanPage
Meningkatkan Budaya Keselamatan dan Kesehatan Kerja (K3) Untuk Mewujudkan Kinerja PrimaImproving Occupational Health and Safety (OHS) Culture to Achieve Excellent Performance
Perlindungan Keselamatan dan Kesehatan Bagi PegawaiSafety and Health Protection for Employees
- Menjadi Pelopor International Sustainability Rating System (ISRS) Pembangkitan Listrik di Indonesia
- Adanya Panitia Pembina Keselamatan dan Kesehatan Kerja (P2K3) di masing-masing unit
- Tersusunnya risk mapping area pembangkit beserta program pencegahan dan penanganan dalam menghadapi risiko K3
- Tercantumnya hak dan kewajiban penerapan K3 dalam Perjanjian Kerja Bersama (PKB)
- Terlaksananya Program sertifikasi dan pelatihan K3 kepada 841 personel
- Pelaksanaan Tindakan Corrective atas Evaluasi Kinerja K3
- Becoming a Pioneer in the International Sustainability Rating System (ISRS) for Power Generation in Indonesia
- Existence of the Occupational Health and Safety Management Committee (P2K3) in each unit
- Formulation of risk mapping of the power plant area, with prevention and treatment programs to handle OHS risks
- The stipulation of rights and obligations of OHS implementation in the Collective Labor Agreement (CLA)
- OHS certification and training program for 841 personnel
- Corrective Actions on OHS Performance Evaluation
GRI 403-1GRI 403-2GRI 403-3GRI 403-4
EU16
Perlindungan Keselamatan dan Kesehatan Bagi KontraktorSafety and Health Protection for Contractors
- Penerapan Contractor Safety Management System (CSMS) di PLTU Banten 3 Lontar OMU
- Pelaksanaan safety briefing kepada seluruh tenaga kerja kontraktor
- Implementation of a Contractor Safety Management System (CSMS) at SPP Banten 3 Lontar OMU
- Safety briefing to all contract employees
EU17EU18
Perlindungan Keselamatan dan Kesehatan Bagi Masyarakat SekitarSafety and Health Protection for the Surrounding Communities
- Terlaksananya sosialisasi K3 bekerjasama dengan BNPB, BPBD dan Pemkab Pandeglang dalam program Desa Tanggap Bencana Tsunami
- OHS dissemination in collaboration with BNPB, BPBD, and Pandeglang Regency Government in the Tsunami Disaster Response Village program
EU21
24 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Isu dan Strategi Keberlanjutan Kami
Our Sustainabilty Issues and Strategies
Program Inisiatif Unggulan
Flagship Initiative Program
Capaian Program Tahun 2019
Performance Achieved In 2019
GRI Standards dan
Pengungkapan Sektor Utilitas
ListrikGRI Standards
and Electric Utilities Sector
Disclosures
SDGs HalamanPage
Membina Kemitraan Dalam Mendorong Peningkatan Kesejahteraan, Kemandirian dan Kualitas Hidup Masyarakat Fostering Partnerships to Encourage Improvement of People’s Welfare, Independence, and Quality of Life
Menginsiprasi Sekaligus Melatih Masyarakat Dalam Merancang dan Menjalakan Usaha Kecil Melalui Program Pemberdayaan MasyarakatInspire and train the community in designing and running small businesses through community empowerment programs
- Pelaksanaan 97 program pemberdayaan masyarakat berbasis Inspirasi Perempuan dengan jumlah 580 orang perempuan dan perputaran ekonomi hingga Rp2,5 miliar
- Program pemberdayaan ODGJ melalui kegiatan produksi telur asin dengan omzet mencapai Rp40,13 juta/tahun
- Pelaksanaan Program TOSS menambah pendapatan ekonomi anggota kelompok hingga Rp1,1 juta/bulan
- There were 97 Women’s Inspiration-based community empowerment programs with a total of 580 women and economic turnover of up to Rp2.5 billion
- ODGJ empowerment program through salted egg production with a turnover of Rp40.13 million/year
- TOSS Program increased the economic income of group members to Rp1.1 million/month
GRI 413-1GRI 413-2
Program Peningkatan Kualitas Kesehatan MasyarakatCommunity health quality improvement program
- Pelayanan kesehatan melalui Klinik Bakti Indonesia Power, pusat layanan bagi orang dengan gangguang jiwa, pemberian makanan tambahan bagi balita, pemeriksaan kesehatan dan pengobatan gratis, pembangunan sarana sanitasi, donor darah, khitan massal dan peningkatan skill tenaga medis melalui Jumpa Bakti Desa Siaga
- Health services through the Indonesia Power’s Bakti Clinic, a service center for people with mental disorders, supplementary feeding for toddlers, free medical examinations and treatment, construction of sanitation facilities, blood donation, mass circumcision, and skill enhancement of medical personnel through the Jumpa Bakti Desa Siaga
GRI 413-1
Peningkatan Kompetensi dan Keahlian SDM di Bidang Ketenagalistrikan Melalui Program IP Pintar dan Employee Voluntary ProgramImprovement of HR competencies and expertise in the electricity sector through the IP Pintar Program and the Employee Voluntary Program
- Kerjasama dengan 12 SMK, 62 siswa mengikuti program magang dan 30 siswa lulus sertifikasi dan diterima di IP Group
- Berbagi pengetahuan, wawasan dan keterampilan kepada 378 siswa Sekolah Dasar, Taman Kanak-Kanak, Karang Tarunan dan Komunitas Anak
- In collaboration with 12 Vocational Schools, 62 students participated in an internship program and 30 students passed certification and were accepted at the IP Group
- Sharing knowledge, insights, and skills with 378 students from Elementary School, Kindergarten, Karang Tarunan, and Children’s Community
GRI 413-1
Strategi Keberlanjutan Dalam Pencapaian Tujuan Pembangunan BerkelanjutanSustainability Strategies in Achieving Sustainable Development Goals
25 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Isu dan Strategi Keberlanjutan Kami
Our Sustainabilty Issues and Strategies
Program Inisiatif Unggulan
Flagship Initiative Program
Capaian Program Tahun 2019
Performance Achieved In 2019
GRI Standards dan
Pengungkapan Sektor Utilitas
ListrikGRI Standards
and Electric Utilities Sector
Disclosures
SDGs HalamanPage
Pembangunan Infrastruktur Pembangkitan yang Bertanggung JawabDevelopment of responsible generation infrastructure
- Tidak terdapat penduduk/masyarakat yang terkena dampak displacement (pemukiman kembali)
- TThere are no residents/community affected by displacement/resettlement
EU20EU22
Pengelolaan Dampak Operasi Terhadap Masyarakat Lokal Secara BerkelanjutanManagement of operational impacts on local communities in a sustainable manner
- Terlaksananya analisa dampak kegiatan Perusahaan terhadap masyarakat lokal, baik pada tahap perencanaan hingga pembangunan dan pengoperasian
- Analysis of the impact of the Company’s activities on local communities, starting from the planning phase up to the construction and operation phase
EU19
26 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Tentang Laporan IniOn The Report
Laporan Keberlanjutan PT Indonesia Power Tahun 2019 merupakan laporan tahun kesembilan yang diterbitkan Perusahaan. Laporan ini merupakan sebuah media untuk menyampaikan pencapaian, kinerja, komitmen, inisiatif program dan pengelolaan dampak dari kegiatan operasi Perusahaan di tahun ini dalam rentang 1 Januari 2019 hingga 31 Desember 2019, data tahun yang telah lalu, juga gagasan dan strategi keberlanjutan di masa mendatang kepada segenap pemangku kepentingan sebagai peran Kami mencapai Tujuan Pembangunan Berkelanjutan (Sustainable Development Goals – SDGs). Laporan sebelumnya diterbitkan pada tanggal 30 Mei 2019. Indonesia Power berkomitmen menerbitkan Laporan Keberlanjutan setiap tahun bersamaan dengan Laporan Tahunan. [GRI 102-50, 102-51, 102-52]
2019 Sustainability Report of PT Indonesia Power is the ninth report published by the Company. This report is a media to convey the achievements, performance, commitments, program initiatives, and impact on the Company’s operational activities for the year of 1 January 2019 to 31 December 2019, the past year’s data, as well as future sustainability ideas and strategies to all stakeholders, as our contribution to achieving the Sustainable Development Goals (SDGs). The previous report was published on 30 May 2019. Indonesia Power is committed to publishing a Sustainability Report every year, simultaneously with the Annual Report. [GRI 102-50, 102-51, 102-52]
Periode, Boundary dan Standar Penyusunan LaporanPeriod, Boundary, and Standard of Report Compilation
Perkembangan Laporan Keberlanjutan Indonesia PowerEvolution of Indonesia Power’s Sustainability Report
2011
2015201620172018
2012 2013 2014
Laporan Keberlanjutan Tahun 2011Penerbitan: Mei 2012Sustainability Report 2011Published: May 2012
Laporan Keberlanjutan Tahun 2015Penerbitan: Mei 2016Sustainability Report 2015Published: May 2016
Laporan Keberlanjutan Tahun 2016Penerbitan: Mei 2017Sustainability Report 2016Published: May 2017
Laporan Keberlanjutan Tahun 2017Penerbitan: Mei 2018Sustainability Report 2017Published: May 2018
Laporan Keberlanjutan Tahun 2018Penerbitan: 30 Mei 2019Sustainability Report 2018Published: May 30, 2019
Laporan Keberlanjutan Tahun 2012Penerbitan: Mei 2013Sustainability Report 2012Published: May 2013
Laporan Keberlanjutan Tahun 2013Penerbitan: Mei 2014Sustainability Report 2013Published: May 2014
Laporan Keberlanjutan Tahun 2014Penerbitan: Mei 2015Sustainability Report 2014Published: May 2015
LAPORAN KEBERLANJUTAN 2017 SUSTAINABILITY REPORT
Penguatan Human Capital Excellence Sebagai Kontribusi Strategis Bagi Ketahanan Ketenagalistrikan NasionalStrengthening Human Capital Excellence as
LAPORAN KEBERLANJUTAN 2017 SUSTAINABILITY REPORT
Penguatan Human Capital Excellence Sebagai Kontribusi Strategis Bagi Ketahanan Ketenagalistrikan NasionalStrengthening Human Capital Excellence as
LAPOR
AN K
EBERLAN
JUTAN
27 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Dalam menentukan isi dan kualitas Laporan Keberlanjutan ini, Indonesia Power berpedoman pada prinsip pelaporan keberlanjutan GRI, yaitu: [GRI 102-46]
Selanjutnya, prinsip-prinsip pelaporan keberlanjutan tersebut diimplementasikan ke dalam lima langkah penyusunan laporan keberlanjutan sebagai berikut:
In determining the content and quality of this Sustainability Report, Indonesia Power refers to the GRI sustainability reporting principles: [GRI 102-46]
Further, these sustainability reporting principles are implemented in five phases of sustainability report preparation as follows:
Langkah Penyusunan LaporanLangkah Penyusunan Laporan
- Kantor Pusat- 4 Power Generation Unit (PGU)- 11 Operation and Maintenance
Services Unit (OMU)- 5 Power Generation and O&M
Services Unit (POMU)- 1 Maintenance Service Unit (MSU)- Khusus untuk data keuangan
bersifat konsolidasi dengan Anak Perusahaan
- Head Office- 4 Power Generation Unit (PGU)- 11 Operation and Maintenance
Services Unit (OMU)- 5 Power Generation and O&M
Services Unit (POMU)- 1 Maintenance Service Unit (MSU)- The financial data is consolidated
with Subsidiaries
Laporan Keberlanjutan Indonesia Power Tahun 2019 disusun sesuai dengan GRI Standards opsi
“Comprehensive” dan menyertakan Electric Utilities Sector Disclosures.
2019 Sustainability Report of Indonesia Power is prepared in accordance with the “Comprehensive” GRI
Standards option and includes the Electric Utilities Sector Disclosures.
Boundary [GRI 102-45]Standar Penyusunan Laporan [GRI 102-54]Report Preparation Standards [GRI 102-54]
Laporan KeberlanjutanIndonesia PowerTahun 2019Sustainability ReportIndonesia Power2019
GRI Reporting PrinciplesGRI Reporting Principles
- Keterlibatan Pemangku Kepentingan- Konteks Keberlanjutan - Materialitas- Kelengkapan
- Kejelasan- Komparabilitas - Keseimbangan- Akurasi- Keandalan- Ketepatan Waktu
- Stakeholder Inclusiveness- Sustainability Context- Materiality- Completeness
- Claritys- Comparability- Balance- Accuracy- Reliability- Timeliness
Isi Content Kualitas Quality
28 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Lima Langkah Penyusunan Laporan KeberlanjutanLima Langkah Penyusunan Laporan Keberlanjutan
Prepare
Connect
Define
Report
Monitor
Plan Reporting Process
Input from Key Stakeholders
Finalize and Distribute Sustainability Report
Define Report Content
Gather and Analyze Information
1. Prepare: Langkah pertama yang dilakukan Indonesia Power dalam penyusunan Laporan Keberlanjutan adalah melakukan identifikasi gap analysis sebagai langkah penyempurnaan atas laporan tahun sebelumnya dan membuat konsep rencana aksi (action plan) dengan melakukan Kick Off Meeting yang telah dilaksanakan pada tanggal 9 Maret 2020.
2. Connect: Pada langkah ini, Indonesia Power menerapkan prinsip Stakeholder Inclusiveness yaitu melakukan identifikasi dan melibatkan Pemangku Kepentingan Internal dan Eksternal Perusahaan melalui pelaksanaan Survei Perilaku Etis kepada Pemasok yang telah dilaksanakan pada periode 16 Desember 2019 – 24 Januari 2020 dan kegiatan penyebaran kuesioner Materiality Assessment kepada Pegawai, Pemerintah (Kementerian Lingkungan Hidup dan Kehutanan dan Puskesmas), Pemegang Saham (PT PLN (Persero)) dan Komunitas/Masyarakat yang telah dilaksanakan pada periode 2-8 April 2020.
3. Define: Pada langkah ini, Indonesia Power menerapkan prinsip Materiality yaitu menentukan topik GRI yang penting bagi Perusahaan maupun Pemangku Kepentingan Perusahaan dengan melakukan Materiality Assessment. Dari hasil tersebut, diperoleh topik-topik material dan boundary laporan ini adalah sebagai berikut: [GRI 102-46]
1. Prepare: Indonesia Power’s first step in preparing the Sustainability Report is to identify the gap analysis as a refinement for the previous year’s report and draft an action plan by conducting a Kick-Off Meeting that was held on 9 March 2020.
2. Connect: In this step, Indonesia Power applies the Stakeholder Inclusiveness, to identify and involve the Company’s Internal and External Stakeholders by conducting an Ethical Behavior Survey to Suppliers that have been carried out on 16 December 2019 - 24 January 2020. On 2-8 April 2020, a Materiality Assessment questionnaire was also distributed to the Employees, the Government (Ministry of Environment and Forestry, and Community Health Centers), Shareholders (PT PLN (Persero)), and Community.
3. Define: In this step, Indonesia Power applies the Materiality principle, to determine the GRI topics that are important to the Company and its Stakeholders by conducting a Materiality Assessment. In conclusion, the material topics and boundary for the Report are as follow: [GRI 102-46]
Tentang Laporan IniOn The Report
29 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Daftar Topik Material dan Boundary Laporan [GRI 102-47, 103-1]Material Topics and Boundary of the Report [GRI 102-47, 103-1]
Topik MaterialMaterial Topics Disclosure Kenapa Topik Ini Material
Why the Topic is Material
Boundary
Kantor Pusat
Head Office
Unit PembangkitGenerating
Unit
Anak PerusahaanSubsidiaries
Ekonomi EconomyKinerja EkonomiEconomic Performance
GRI 201-1, 201-2, 201-3,
201-4
Berdampak signifikan bagi pemangku kepentinganHave significant impacts on the stakeholders
√ √ √
Keberadaan PasarMarket Existence
GRI 202-1, 202-2
Berdampak signifikan bagi pegawaiHave significant impacts on the employees √ √ -
Dampak Ekonomi Tidak LangsungIndirect Economic Impact
GRI 203-1, 203-2
Berdampak signifikan bagi pemangku kepentinganHave significant impacts on the stakeholders
√ √ √
Anti KorupsiAnti-Corruption
GRI 205-1, 205-2, 205-3
Berdampak signifikan bagi keberlangsungan bisnis PerusahaanHave significant impact on the Company’s business sustainability
√ √ -
Penelitian dan Pengembangan PembangkitPower Plant Research and Development
EU8 Berdampak signifikan bagi pembangunan dan keberlangsungan bisnis PerusahaanHave significant impact on the Company’s development and business sustainability
- √ -
Lingkungan EnvironmentEnergiEnergy
GRI 302-1, 302-2, 302-3,
GRI 302-4, 302-5
Berdampak signifikan bagi keberlanjutan lingkungan dan kesehatan masyarakatHave significant impacts on environmental sustainability and public health
√ √ -
Sumber Daya AirWater Resources
GRI 303-1, 303-2, 303-3
Berdampak signifikan bagi keberlanjutan lingkungan dan kesehatan masyarakatHave significant impacts on environmental sustainability and public health
√ √ -
Keanekaragaman HayatiBiodiversity
GRI 304-1, 304-2, 304-3, 304-4, EU13
Berdampak signifikan bagi keberlanjutan lingkungan dan kesehatan masyarakatHave significant impacts on environmental sustainability and public health
- √ -
EmisiEmission
GRI 305-1, 305-2, 305-3, 305-4, 305-5, 305-6, 305-7
Berdampak signifikan bagi keberlanjutan lingkungan dan kesehatan masyarakatHave significant impacts on environmental sustainability and public health
√ √ -
LimbahWaste
GRI 306-1, 306-2, 306-3, 306-4, 306-5
Berdampak signifikan bagi keberlanjutan lingkungan dan kesehatan masyarakatHave significant impacts on environmental sustainability and public health
√ √ -
Sosial SocialKepegawaianEmployment
GRI 401-1, 401-2, 401-3, EU14, EU15, EU16, EU17,
EU18
Berdampak signifikan bagi pegawai dan mitra kerjaHave significant impacts on the employees and partners
√ √ -
Pengelolaan Keselamatan dan Kesehatan KerjaOccupational Health and Safety Management
GRI 403-1, 403-2, 403-3,
403-4
Berdampak signifikan bagi pegawai dan mitra kerjaHave significant impacts on the employees and partners
√ √ -
Pengembangan Kompetensi dan Karir PegawaiEmployees’ Competency and Career Development
GRI 404-1, 404-2, 404-3
Berdampak signifikan bagi pegawaiHave significant impacts on the employees √ √ -
30 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Topik MaterialMaterial Topics Disclosure Kenapa Topik Ini Material
Why the Topic is Material
Boundary
Kantor Pusat
Head Office
Unit PembangkitGenerating
Unit
Anak PerusahaanSubsidiaries
Keberagaman dan Kesetaraan PeluangDiversity and Equal Opportunities
GRI 405-1, 405-2
Berdampak signifikan bagi pegawaiHave significant impacts on the employees √ √ -
Pemberdayaan MasyarakatCommunity Empowerment
GRI 413-1, 413-2, EU19, EU20 EU22
Berdampak signifikan bagi masyarakatHave significant impacts on the community √ √ -
Perencanaan dan Tanggap Darurat/ BencanaDisaster Emergency Planning and Response
EU21 Berdampak signifikan bagi masyarakatHave significant impacts on the community √ √ -
Grafik Materialitas [GRI 102-47]Graph: Materiality [GRI 102-47]
Selanjutnya, topik-topik material tersebut diprioritaskan menjadi tiga tingkatan, yaitu High, Medium dan Low yang dapat dilihat pada grafik berikut ini.
Further, the material topics are prioritized into three levels, i.e. High, Medium, and Low, as shown in the following graph.
Berpengaruh Terhadap PT Indonesia PowerAffecting PT Indonesia Power
1. Pengelolaan Keselamatan dan Kesehatan Kerja Pengelolaan Keselamatan dan Kesehatan Kerja2. Limbah Limbah3. Keanekaragaman Hayati Keanekaragaman Hayati4. Pengembangan Kompetensi dan Karir Pegawai Pengembangan Kompetensi dan Karir Pegawai5. Emisi Emisi
Keterangan Description:
Low
Low
Medium
Medium
High
HighBe
rpen
garu
h Te
rhad
ap P
eman
gku
Kepe
ntin
gan
Affec
ting
Stak
ehol
ders
6. Sumber Daya Air Sumber Daya Air7. Energi Energi8. Perencanaan dan Tanggap Darurat/Bencana Perencanaan dan Tanggap Darurat/Bencana9. Kepegawaian Kepegawaian10. Penelitian dan Pengembangan Pembangkit Penelitian dan Pengembangan Pembangkit
1
2345
678
9
10
111213
14
15
11. Anti Korupsi Anti Korupsi12. Keberagaman dan Kesetaraan Peluang Keberagaman dan Kesetaraan Peluang13. Pemberdayaan Masyarakat Pemberdayaan Masyarakat14. Dampak Ekonomi Tidak Langsung Dampak Ekonomi Tidak Langsung15. Keberadaan Pasar Keberadaan Pasar
Tentang Laporan IniOn The Report
31 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Berdasarkan hasil materiality assessment, pada tahun ini jumlah topik material berbeda dengan tahun sebelumnya, yakni dari 18 topik di tahun 2018 menjadi 16 topik di tahun 2019. Untuk meningkatkan kualitas laporan, terdapat beberapa penyajian ulang (restatement) atas informasi tahun sebelumnya, yaitu mengenai perhitungan penggunaan energi dan bauran energi Perusahaan dikarenakan di tahun 2019 terdapat penambahan komponen energi baru terbarukan yakni energi biofuel (B20) yang mendukung peningkatan porsi EBT pada bauran energi Perusahaan. [GRI 102-48, 102-49]
4. Monitor: Pada langkah ini dilakukan pengumpulan informasi berdasarkan pemenuhan disclosures dari topik material yang dipilih untuk disusun menjadi sebuah Laporan Keberlanjutan. Dalam menyusun Laporan ini, Indonesia Power juga memastikan bahwa kualitas informasi dan penyajian pada Laporan ini telah menerapkan prinsip Keseimbangan, Komparabilitias, Ketepatan, Ketepatan Waktu, Kejelasan dan Keandalan. Untuk meningkatkan kredibilitas dan memastikan bahwa laporan ini dapat diandalkan dan bebas dari kesalahan yang material serta disusun sesuai dengan GRI Standards, pada Laporan Keberlanjutan Indonesia Power Tahun 2019 ini telah diverifikasi dalam penjaminan (assurance) oleh pihak independen, yaitu PT SGS Indonesia yang telah berlisensi AA 1000 Accountability Principles (2018). Pemilihan PT SGS Indonesia dilakukan sesuai dengan kebijakan Perusahaan yang mempertimbangkan keahlian, kompetensi dan reputasi serta dapat dipastikan Indonesia Power tidak memiliki hubungan kerjasama lain dengan PT SGS Indonesia selain pekerjaan assurance Laporan Keberlanjutan Indonesia Power tahun 2019. Proses penetapan PT SGS Indonesia sebagai assurer independen dilakukan melalui persetujuan Dewan Komisaris dan Direksi Perusahaan, yang diwakili oleh Head of GCG & Corporate Information. Proses assurance dilakukan pada periode 15 – 26 Juni 2020 melalui teleconference. Penyataan/opini assurer independen atas Laporan Keberlanjutan Indonesia Power Tahun 2019 disajikan pada halaman .... [GRI 102-32, 102-56]
5. Report: Pada langkah ini, Indonesia Power menyusun laporan, memfinalisasi laporan, yang selanjutnya dikomunikasikan ke Pemangku Kepentingan Perusahaan dan memberikan lembar umpan balik kepada Pemangku Kepentingan Perusahaan sebagai masukan untuk perbaikan Laporan Keberlanjutan di tahun selanjutnya.
Based on the results of the materiality assessment, there are 16 topics this year, different from the previous year, i.e. 18 topics in 2018. There are several restatements of the previous year’s information to improve the report quality, i.e. in relation to the calculation of the Company’s energy consumption energy mix, because, in 2019, there was an addition to the new and renewable energy component, biofuel (B20), which supports the increase in the NRE portion of the Company’s energy mix. [GRI 102-48, 102-49]
4. Monitor: During this step, the Company collects data based on disclosures fulfillment of material topics chosen to be compiled into a Sustainability Report. Reports include positive and negative news about the Company’s performance. In compiling the Report, Indonesia Power also ensures that the quality of information and presentation in this Report has implemented the Balance, Accuracy, Timeliness, Clarity, and Reliability principles. 2019 Sustainability Report of Indonesia Power has been verified in an independent party assurance, namely PT SGS Indonesia, which has an “AA 1000 Accountability Principles (2018)” license to enhance credibility and ensure that this report is reliable and free from material errors, and is prepared in accordance with GRI Standards. The selection of PT SGS Indonesia is carried out in accordance with the Company’s policy with due regard to expertise, competence, and reputation. Indonesia Power ensures that the Company has no other cooperative relationship with PT SGS Indonesia other than the assurance work of the 2019 Sustainability Report of Indonesia Power. The process of appointing PT SGS Indonesia as an independent assurer is carried out through the approval of the Company’s Board of Commissioners and Directors, represented by the Head of GCG & Corporate Information. The assurance process is carried out on 15-26 June 2020 by teleconference. The statement/opinion of the independent assurer of the 2019 Sustainability Report of Indonesia Power is presented on the page .... [GRI 102-32, 102-56]
5. Report: In this step, Indonesia Power prepares and finalizes the report, which is then communicated to the Company’s Stakeholders, who can provide a feedback sheet as input for the improvement of the Sustainability Report for the following year.
32 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Untuk meningkatkan kualitas Laporan Keberlanjutan ini, seluruh pemangku kepentingan dan pembaca dapat menyampaikan pertanyaan, saran, ide, kritik dan tanggapan melalui Lembar Umpan Balik yang dapat ditemukan pada bagian akhir Laporan ini atau dengan menghubungi: [GRI 102-53]
To improve the quality of this Sustainability Report, all stakeholders and reader may submit their questions, suggestions, ideas, critics, and feedbacks through the Feedback Form which can be found in the last chapter of this report, or via contact to: [GRI 102-53]
Kontak InformasiContact Information
PT Indonesia PowerManager of CSR PT Indonesia PowerCentennial Tower , Lantai 7 & 8Jl. Jend. Gatot Subroto Kav.24 & 25 Jakarta 12930
Telephone : (62-21) 5267666Facsimile : (62-21) 5251923, 5252623Website : www.indonesiapower.co.idE-mail : [email protected]
Tentang Laporan IniOn The Report
33 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Kami selaku Dewan Komisaris dan Direksi PT Indonesia Power telah melakukan evaluasi atas konten Laporan Keberlanjutan ini serta menyatakan bahwa laporan telah mencakup seluruh topik keberlanjutan yang material bagi Perusahaan dan Pemangku Kepentingan Perusahaan. Kami bertanggung jawab atas kebenaran isi Laporan Keberlanjutan ini. [GRI 102-32]
Dewan KomisarisBoard of Commisioners
F. X. SutijastotoKomisaris Utama
President Commissioner
M. Ahsin SidqiPLT. Direktur Utama
Acting of President Director
M. Hanafi Nur RifaiPLT. Direktur Operasi I
Acting of Operations Director I
Bambang AnggonoPLT. Direktur Operasi II
Acting of Operations Director II
Susy LiestiowatyPLT. Direktur Keuangan
Acting of Financial Director
Adi SuprionoDirektur Pengembangan dan Niaga
Development and Commerce Director
Okto Rinaldi SagalaPLT. Direktur Sumber Daya Manusia dan Administrasi
Acting of Human Resources and Administration Director
Munir AhmadKomisaris
Commissioner
Tri Setyo NugrohoKomisaris
Commissioner
Agus HernawanKomisaris
Commissioner
Ulil AbsharKomisaris
Commissioner
DireksiBoard of Directors
We, as the Board of Commissioners and Directors of PT Indonesia Power, have evaluated on the content of this Sustainability Report, and declared that this report has covered all material sustainability aspects for the Company and the Company’s Stakeholders. We are fully accountable for the accuracy of the content in this Sustainability Report. [GRI 102-32]
Pernyataan Dewan Komisaris dan Direksi Tentang Tanggung Jawab atas Laporan Keberlanjutan 2019PT Indonesia Power
Statement of Accountability of the Board of Commissioners and Board of Directors to the 2019 Sustainability Report of PT Indonesia Power
Jakarta, 29 Mei 2020Jakarta, May 29, 2020
34 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Keterlibatan Pemangku KepentinganStakeholders’ Involvement
Indonesia Power senantiasa berkomitmen membina hubungan yang harmonis dengan segenap pemangku kepentingan internal dan eksternal. Tujuannya adalah untuk memastikan Perusahaan dapat mengetahui harapan terkini para pemangku kepentingan dan menyelaraskannya dengan program-program kerja dan strategi bisnis Perusahaan. Interaksi dan komunikasi yang dilakukan juga dapat membantu Indonesia Power dalam menentukan keputusan dan menjalankan bisnis dengan penuh tanggung jawab.
Dalam melakukan identifikasi pemangku kepentingan, Indonesia Power merujuk pada AA1000 Stakeholder Enggagement Standard versi 2015, yang membagi proses identifikasi dan interaksi ke dalam lima atribut, yakni: [GRI 102-42]1. Dependency – Individu atau kelompok yang memiliki
ketergantungan baik langsung atau tidak langsung terhadap aktivitas perusahaan atau sebaliknya;
2. Responsibility – Individu atau kelompok yang mana Perusahaan memiliki tanggung jawab secara legal, komersial dan/atau etika;
3. Tension – Individu atau kelompok yang membutuhkan perhatian segera dari Perusahaan terkait isu ekonomi, sosial dan lingkungan;
4. Influence – Individu atau kelompok yang memiliki pengaruh terhadap Perusahaan atau strategi dan kebijakan pemangku kepentingan lain; dan
5. Diverse Perspectives – Individu atau kelompok yang memiliki pandangan berbeda yang dapat mempengaruhi situasi dan mendorong adanya aksi yang tidak ada sebelumnya.
Berdasarkan hasil identifikasi, Indonesia Power membagi pemangku kepentingan ke dalam enam kelompok, yaitu: (1) Pemegang Saham; (2) Pemerintah; (3) Pegawai; (4) Pelanggan; (5) Pemasok; dan (6) Komunitas Penduduk Sekitar Pembangkit. Di bawah ini adalah ringkasan bagaimana Perusahaan melakukan pembinaan hubungan dengan masing-masing pemangku kepentingan:
Indonesia Power is committed to fostering harmonious relationships with all internal and external stakeholders. The objective is to ensure that the Company understands the current expectations of the stakeholders and aligns them with the Company’s work programs and business strategies. Indonesia Power is also assisted by the interaction and communication to make decision and conduct responsible business.
In identifying the stakeholders, Indonesia Power refers to AA1000 Stakeholder Engagement Standard 2015, which categorizes the identification and interaction process into five attributes: [GRI 102-42]
1. Dependency - Individuals or groups who have direct or indirect dependence on the company’s activities or vice versa;
2. Responsibility - Individuals or groups to which the Company has legal, commercial, and/or ethical responsibilities;
3. Tension - Individuals or groups who need immediate attention from the Company related to economic, social, and environmental issues;
4. Influence - Individuals or groups who have influence on the strategies and policies of the Company or other stakeholders; and
5. Diverse Perspectives - Individuals or groups who have different views that can influence the situation and encourage action that was not planned.
Based on the identification results, Indonesia Power categorizes stakeholders into six groups: (1) Shareholders; (2) Government; (3) Employees; (4) Customers; (5) Suppliers; and (6) Community Around the Power Plant. Below is a summary of how the Company fosters relationships with each stakeholder:
35 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Identifikasi dan Pendekatan Keterlibatan Pemangku Kepentingan Perusahaan [GRI 102-21]Identification and Approach to Company’s Stakeholder Engagement [GRI 102-21]
Pemangku KepentinganStakeholders[GRI 102-40]
Ekspektasi pada Perusahaan
Expectations of the Company
[GRI 102-43]
Metode Pelibatan Method of Engagement
[GRI 102-43]
Frekuensi PertemuanFrequency of Meetings
[GRI 102-43]
Informasi Kunci kepada Pemangku
KepentinganKey Information to
Stakeholders [GRI 102-44]
MediaMedia
[GRI 102-43]
PemegangSahamShareholders
1. Pemenuhan kontrak manajemen
2. Tingkat kesehatan Perusahaan yang diukur melalui pencapaian Key Performance Indicator (KPI)
1. Management contract fulfillment
2. Company’s soundness, assessed by the achievement of Key Performance Indicators (KPI)
1. RUPS GMS
1. 2 kali setahun pada tanggal 10 Januari 2019 untuk RUPS RKAP dan 13 Juni 2019 untuk pelaksanaan RUPS LPT
Held two times in 2019, on 10 January 2019 for the WP&B GMS, and 13 June 2019 for the LPT GMS
1. Perkembangan Perusahaan dan pembangkit listrik (termasuk pengembangan usaha, proyek baru, dan sebagainya)
2. Kinerja manajemen dan pembangkit listrik
3. Acara dan kebijakan korporat, dan prestasi korporat
1. The development of the Company and power plant (including business development, new projects, etc.),
2. Management and power plant performance
3. Corporate events and policies, and corporate achievements.
Tatap muka, Laporan manajemen, annual report, sustainability report dan media komunikasi lainnya.Face to face, Management report, annual report, sustainability report, and other communication media.
2. Rapat Internal Dewan Komisaris
Board of Commissioners’ Internal Meeting
2. 7 kali setahun pada 26 Februari, 26 Maret, 29 Mei, 9 Agustus, 25 Oktober, 20 November dan 12 Desember 2019
Held 7 times, on 26 February, 26 March, 29 May, 9 August, 25 October, 20 November, and 12 December 2019
3. Rapat Gabungan Dewan Komisaris dan Direksi
Joint Meetings of the Board of Commissioners and the Board of Directors
3. 11 kali setahun pada 30 Januari, 13 Maret, 7 Mei, 27 Juni, 25 Juli, 28 Agustus, 2 Oktober, 31 Oktober, 1 November, 8 November dan 30 Desember 2019
Held 11 times, on 30 January, 13 March, 7 May, 27 June, 25 July, 28 August, 2 October, 31 October, 1 November, 8 November, and 30 December 2019
4. Rapat ALCO (Asset Liability Committee)
ALCO (Asset Liability Committee) Meeting
4. 11 kali setahun pada tanggal 29 Januari, 27 Februari, 29 April, 28 Mei, 28 Juni, 30 Juli, 27 Agustus, 25 September, 31 Oktober, 27 November dan 18 Desember 2019
Held 11 times, on 29 January, 27 February, 29 April, 28 May 28 June, 30 July, 27 August, 25 September, 31 October, 27 November, and 18 December 2019
36 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Pemangku KepentinganStakeholders[GRI 102-40]
Ekspektasi pada Perusahaan
Expectations of the Company
[GRI 102-43]
Metode Pelibatan Method of Engagement
[GRI 102-43]
Frekuensi PertemuanFrequency of Meetings
[GRI 102-43]
Informasi Kunci kepada Pemangku
KepentinganKey Information to
Stakeholders [GRI 102-44]
MediaMedia
[GRI 102-43]
Pemerintah (Pusat dan Daerah) Government (Central and Local)
Ketaatan atau kepatuhan pada peraturan dan perundang-undangan Compliance with laws and regulations
Pelaporan terkait pengelolaan lingkungan, kepegawaian, perizinan usaha pembangkitan dan proyekReporting related to environmental management, employment, business licensing of generation and projects
PeriodikPeriodic
Proses pembangkit listrik, dampak lingkungan, wajib laporan tenaga kerja, perizinan atas usaha pembangkitan dan proyekPower generation process, environmental impact, mandatory workforce reports, licensing of generation and project
Pelaporan dan koordinasi sesuai bidang masing-masing,berita di media masa, website dan majalah InPowerReporting and coordinating in line with respective fields,news in the mass media, website, and InPower magazine
PegawaiEmployee
1. Peningkatan kepuasan dan kesejahteraan pegawai
2. Keberlanjutan bisnis Perusahaan
3. Keselamatan dan Kesehatan Kerja
4. Siaga dan Tanggap Kondisi Darurat Bencana
1. Increased employees’ satisfaction and welfare
2. Company’s business sustainability
3. Occupational Health and Safety
4. Disaster Emergency Planning and Response
1. Coffee morning Coffee morning
1. 12 kali setahun 12 times a year
1. Sosialiasi program, kebijakan dan kinerja Perusahaan
2. Kegiatan dan prestasi Perusahaan
1. Socialization, Company’s policies and performance
2. Company’s activities and achievements
Email, media sosial, buletin bulanan, poster, intranet dan lain-lainEmail, social media, monthly bulletins, posters, intranets, etc.
2. Pertemuan periodik Regular meeting
2. Minimal sekali dalam 1 semester
At least once in six months
3. Employee Gathering Employee Gathering
3. Sekali setahun Annually
4. Perayaan Hari Ulang Tahun Perusahaan
Company’s Anniversary Celebration
4. Sekali setahun pada tanggal 3 Oktober 2019
Once a year on 3 October 2019
5. Survei Human Resources Satisfaction & Engagement (HRSE)
Human Resources Satisfaction & Engagement (HRSE) Survey
5. Sekali setahun pada tanggal 4 - 8 November 2019
Held once a year on 4-8 November 2019
6. Simulasi Tanggap Darurat Bencana
Disaster Emergency Response Simulation
6. Sekali setahun pada tanggal 2 - 3 September 2019
Held once a year on 2-3 September 2019
7. Assessment Fire Protection
Fire Protection Assessment
7. Pertemuan periodik pada tanggal 25 September - 5 Desember 2020
Regular meetings on 25 September-5 December 2020
Keterlibatan Pemangku KepentinganStakeholders’ Involvement
37 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Pemangku KepentinganStakeholders[GRI 102-40]
Ekspektasi pada Perusahaan
Expectations of the Company
[GRI 102-43]
Metode Pelibatan Method of Engagement
[GRI 102-43]
Frekuensi PertemuanFrequency of Meetings
[GRI 102-43]
Informasi Kunci kepada Pemangku
KepentinganKey Information to
Stakeholders [GRI 102-44]
MediaMedia
[GRI 102-43]
Pelanggan Customer
1. Keandalan2. Kesiapan Pembangkit3. Ketepatan Jadwal
Pemeliharaan4. Harga yang Ekonomis5. Kontinuitas Pasokan6. Keselamatan dan
Kesehatan pelanggan7. Pemenuhan
deployment sebagai persyaratan dalam menjalankan O&M pembangkit
8. Pemenuhan kinerja pembangkit sesuai kontrak (keandalan dan ketepatan waktu)
1. Reliability2. Power Plant Readiness3. Maintenance Schedule
Accuracy4. Economical Prices5. Supply Continuity6. Customer Health and
Safety7. Deployment fulfillment
as requirement in running the power plant O&M
8. Fulfillment of generator performance according to contract (reliability and timeliness)
1. Program Mendengarkan Suara Pelanggan/ Forum Komunikasi Pelanggan/Customer Gathering
Listing to the Customer’s Voice Program/Customer Communication Forum/Customer Gathering
1. Periodik:- Site Visit Grati POMU
dan Olahraga Bersama Pelanggan pada tanggal 12 Juli 2019
- Customer Gathering pada tanggal 27 Juli 2019 (Unit Suralaya, Cilegon, Labuan dan Lontar) dan tanggal 24 Agustus 2019 (Unit Jeranjang) pada tanggal 24 Agustus 2019
- Forum Komunikasi Pelanggan Unit Saguling pada tanggal 24 - 25 Agustus 2019
1. Periodic:- Grati POMU Site
Visit and Sports with Customers on 12 July 2019
- Customer Gathering on 27 July 2019 (Suralaya, Cilegon, Labuan, and Lontar Units) and on 24 August 2019 (Jeranjang Unit)
- Saguling Unit Customer Communication Forum on 24-25 August 2019
1. Kinerja manajemen dan pembangkit listrik, kebijakan, peraturan dan prosedur yang berlaku di lingkungan Indonesia Power
2. Laporan perencanaan pembangkit listrik, proses keuangan dan konfirmasi hutang
1. Management and power plant performance, policies, regulations, and procedures prevailing within Indonesia Power
2. Reports of power plant planning, financial processes, and debt confirmation
Laporan Harian Deklarasi Ketidaksiapan Pembangkit (HDKP), majalah InPower, website, Annual Report, Sustainability Report, email, media sosial dan sebagainyaDaily Statement on Plant Unprepared ness (HDKP), InPower magazine, website, Annual Report, Sustainability Report, email, social media, etc.
2. Rapat Alokasi Energi Energy Allocation
Meeting
2. Sekali dalam sebulan Once a month
3. Kunjungan Pelanggan Customer Visit
3. Periodik Periodic
4. Aplikasi Harian Deklarasi Ketidaksiapan Pembangkit (HDKP)
Daily Statement on Plant Unpreparedness (HDKP)
4. Jika Diperlukan If Necessary
5. Rapat Operasi Sistem Jawa Bali
Java Bali System Operations Meeting
5. Periodik Periodic
6. Survei Kepuasan Pelanggan
Customer Satisfaction Survey
6. Sekali dalam setahun yang dilaksanakan pada periode 08 - 26 Oktober 2019
Held once a year, on 8-26 October 2019
38 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Pemangku KepentinganStakeholders[GRI 102-40]
Ekspektasi pada Perusahaan
Expectations of the Company
[GRI 102-43]
Metode Pelibatan Method of Engagement
[GRI 102-43]
Frekuensi PertemuanFrequency of Meetings
[GRI 102-43]
Informasi Kunci kepada Pemangku
KepentinganKey Information to
Stakeholders [GRI 102-44]
MediaMedia
[GRI 102-43]
Pemasok Suppliers
1. Fleksibilitas pembayaran
2. Transparansi dan kewajaran
3. Kelangsungan bisnis jangka panjang
1. Payment flexibility2. Transparency and
fairness3. Long-term business
sustainability
1. Vendor Gathering Vendor Gathering
1. Sekali setahun untuk Kantor Pusat pada tanggal 5 Desember 2019 dan 2 kali untuk Unit
Held once a year for the Head Office on 5 December 2019, and 2 times for the Units
1. Pemutusan hubungan kerja ketika terjadi fraud dan penyuapan
2. Kebijakan, peraturan dan prosedur pengadaan barang dan jasa yang berlaku di lingkungan Indonesia Power
3. Informasi kegiatan bisnis dan peluang kerja sama, pengumuman terkait pelelangan pengadaan barang dan jasa serta informasi terkait kepatuhan terhadap etika bisnis yang berlaku di Perusahaan
1. Termination of employment when fraud and bribery occur
2. Policies, regulations, and procedures for the procurement of goods and services that are enforced within Indonesia Power
3. Information on business activities and cooperation opportunities, announcements related to the tenders of procurement of goods and services, and information related to compliance with business ethics applicable in the Company
Pertemuan periodik, event masing-masing korporat, website, seminar, email, pameran Regular meetings, corporate events, websites, seminars, emails, exhibitions
2. Survey Perilaku Etis Ethical Behavior
Survey
2. Sekali setahun pada periode 16 Desember 2019 – 24 Januari 2020
Held once a year on 16 December 2019 until 24 January 2020
3. Sales Engineering Support berupa Assessment, Inspection, Consultation
Sales Engineering Support berupa Assessment, Inspection, Consultation
3. Sesuai kebutuhan masing-masing Unit
Per each Unit’s necessity
Keterlibatan Pemangku KepentinganStakeholders’ Involvement
39 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Pemangku KepentinganStakeholders[GRI 102-40]
Ekspektasi pada Perusahaan
Expectations of the Company
[GRI 102-43]
Metode Pelibatan Method of Engagement
[GRI 102-43]
Frekuensi PertemuanFrequency of Meetings
[GRI 102-43]
Informasi Kunci kepada Pemangku
KepentinganKey Information to
Stakeholders [GRI 102-44]
MediaMedia
[GRI 102-43]
Komunitas Penduduk Sekitar Pembangkit:- Masyarakat
di Wilayah Binaan
- LSM Lokal & Internasional
- Tokoh Masyarakat
- Institusi/ Lembaga Profesi
- MediaCommunity Around the Power Plant:- Community in
the Fostered Area
- Local & International NGOs
- Public Figures- Professional
Institutions/Institutions
- Media
1. Dukungan perusahaan terhadap pemberdayaan masyarakat (ekonomi, pendidikan, kesehatan, dan keamanan)
2. Bebas dari pencemaran lingkungan
3. Informasi mengenai Proses pembangkitan listrik serta dampaknya terhadap lingkungan
4. Informasi mengenai tata kelola perusahaan yang baik dan tanggung jawab sosial perusahaan
5. Kebijakan peraturan dan prosedur yang berlaku
6. Kerjasama antar institusi
7. Knoweldge sharing antar institusi
1. Company’s support on the community empowerment (economy, education, health, and safety)
2. Free from environmental pollution
3. Information about the electricity generation process and its impact on the environment
4. Information on good corporate governance and corporate social responsibility
5. Regulatory policies and procedures in force
6. Collaboration between institutions
7. Knowledge sharing between institutions
1. Forum Kemitraan Polisi Masyarakat
Community Police Partnership Forum
1. Minimal sekali dalam setahun
At least once a year
1. Proses pembangkit listrik dan dampak lingkungannya, kebijakan, peraturan dan prosedur yang berlaku di lingkungan Indonesia Power
2. Kegiatan dan prestasi Perusahaan
3. Etika, tata kelola Perusahaan yang baik serta tanggung jawab sosial Perusahaan
1. Power plant generation process and its impact on the environment, policies, regulations, and procedures prevailing within Indonesia Power
2. Company’s activities and achievements
3. Ethics, good corporate governance, and corporate social responsibility
Website, buletin iklan di media masa, majalah, Annual Report, Sustainability Report, tatap muka dan sebagainya Website, advertising bulletin in mass media, magazines, Annual Report, Sustainability Report, face-to-face, etc.
2. Program CSR yang difokuskan pada pemberdayaan masyarakat
CSR programs focused on community empowerment
2. Minimal 4x dalam setahun sejak perencanaan, implementasi monitoring sampai dengan evaluasi program
At least 4 times a year since planning, monitoring, implementation, up to program evaluation
3. Kegiatan CSR (Charity)
CSR activities (Charity)
3. Minimal sekali dalam setahun
At least once a year
4. Forum Warga Community Forum
4. Minimal sekali dalam setahun
At least once a year
40 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Penghargaan dan Sertifikasi Tahun 2019 Awards And Certification in 2019
Penghargaan Tahun 2019Awards in 2019
Kinerja EkonomiEconomic Performance
Penghargaan Indonesia Inhouse Magazine Awards (InMA) 2019 dari Serikat Perusahaan Pers (SPS), dengan perolehan:- Silver Winner pada kategori The Best of Private Company- Bronze Winner pada kategori The Best of E-Magazine Private
CompanyIndonesia Inhouse Magazine Awards (InMA) 2019 from the Press Company Union (SPS), with awards as follow:- Silver Winner in the category of the Best Private Company- Bronze Winner in the category of the Best E-Magazine Private
Company
7 Februari 20197 February 2019
Indonesia Innovation Award 2019 dari Majalah Biskom dan Asosiasi Pengusaha Teknologi Informasi dan Komunikasi Nasional (APTIKNAS), untuk kategori:- Best Innovation in Energy 2019- The Best CEO IIA 2019 – Sripeni
Inten CahyaniIndonesia Innovation Award 2019 from Biskom Magazine and the Indonesian Information and Communication Technology Business Association (APTIKNAS), for the category of:- Best Innovation in Energy 2019- 2019 Best CEO IIA - Sripen Inten
Cahyani
Penghargaan Most Creative Companies 2019 pada ajang Anugerah Indonesia Most Creative Companies 2019 dari Majalah SWAThe 2019 Most Creative Company Award at the 2019 Anugerah Indonesia Most Creative Companies Award from SWA Magazine
Suralaya PGU meraih penghargaan sebagai Runner Up Kategori Pembangkitan pada ajang Learning, Innovation, Knowledge, and Exhibition (LIKE) 2019 dari PT PLN (Persero)Suralaya PGU received an award as the Runner-Up in the Generating Category at the 2019 Learning, Innovation, Knowledge, and Exhibition (LIKE) event from PT PLN (Persero)
Semarang PGU memperoleh penghargaan untuk kategori Power Plant Upgrade of The Year untuk Tambak Lorok Block 2 Gas Turbine Control and Excitation System Project pada ajang Asian Power Awards 2019 dari Asian Power MagazineSemarang PGU received an award for the Power Plant Upgrade of the Year for Block 2 Tambak Lorok Gas Turbine Control and Excitation System Project at the 2019 Asian Power Awards from the Asian Power Magazine
TOP Digital Awards 2019 dari Majalah It Works, dengan perolehan:- TOP DIGITAL Implementation 2019 on Energy Sector #Level Star 4- TOP DIGITAL Transformation Readiness- TOP CIO on Digital Implementation2019 TOP Digital Awards from It Works Magazine, with the awards of:- 2019 TOP DIGITAL Implementation in the Energy Sector # 4
Star Level- TOP DIGITAL Transformation Readiness - TOP CIO on Digital Implementation
28 April 201928 April 2019
17 Juni 201917 June 2019
24 Oktober 201924 October 2019
4 September 20194 September 2019
27 November 201927 November 2019
1
2
4
3
3
4 51 2 3
41 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Kinerja LingkunganEnvironmental Performance
ASEAN Coal Awards dari ASEAN melalui ASEAN Centre for Energy (ACE), dengan perolehan:- Suralaya PGU sebagai 1st Winner kategori Clean Coal Use and
Technology Utilisation Sub Kategori Power Generation - Large Scale
- Jeranjang OMU sebagai 1st Runner Up Kategori Clean Coal Use and Technology Utilisation Sub Kategori Power Generation – Small Scale
- Lontar OMU sebagai 2nd Runner Up Kategori Clean Coal Use and Technology Utilisation Sub Kategori Power Generation - Medium Scale
ASEAN Coal Awards from ASEAN through the ASEAN Center for Energy (ACE), with awards of:- Suralaya PGU as the 1st Winner in the Clean Coal Use
and Technology Utilization category, Large Scale Power Generation
- Jeranjang OMU as the 1st Runner-Up for Clean Coal Use and Technology Utilization, Small Scale Power Generation
- Lontar OMU as the 2nd Runner-Up in the Clean Coal Use and Technology Utilization, Medium Scale Power Generation
Penghargaan Indonesia Green Company Achievement 2019 pada ajang Indonesia Green Company Award & Sri Kehati Appreciation 2019 dari Majalah SWA2019 Indonesia Green Company Achievement Award at the 2019 Indonesia Green Company Award & Sri Kehati Appreciation from SWA Magazine
Subroto Award 2019 dari Kementerian Energi dan Sumber Daya Mineral - Republik Indonesia, dengan perolehan:- Pelabuhan Ratu OMU Bidang Efisiensi Energi Nasional
Kategori Inovasi Khusus Pada Manajemen Energi di Industri Juara
- Banten 3 Lontar OMU Bidang Efisiensi Energi Nasional Kategori Inovasi Khusus Pada Manajemen Energi di Industri Juara
2019 Subroto Award from the Ministry of Energy and Mineral Resources - the Republic of Indonesia, with the awards of:- Pelabuhan Ratu OMU in the National Energy Efficiency,
category of Special Innovation in Energy Management in the Champion Industry
- Banten 3 Lontar OMU in the National Energy Efficiency, category of Special Innovation in Energy Management in the Champion Industry
4 September 20194 September 2019
22 Oktober 201922 October 2019
27 September 2019 27 September 2019
1
3
2
321
42 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Penghargaan dan Sertifikasi Tahun 2019Awards and Certification in 2019
Kinerja Sosial(Kinerja Keselamatan dan Kesehatan Kerja, Sumber Daya Manusia dan Sosial Kemasyarakatan)
Social Performance(Occupational Health and Safety Performance, Human Resources and Social Community)
Penganugerahan Keselamatan dan Kesehatan Kerja (K3) Award Tahun 2019 dari Kementerian Tenaga Kerja dan Transmigrasi Republik Indonesia, untuk kategori:- Penghargaan Zero Accident untuk Mrica PGU, PLTGU Cilegon
OMU, Grati POMU, Saguling POMU, PLTU Jawa Tengah 2 Adipala OMU, Semarang PGU, PLTU Barru OMU, PLTU Banten 3 Lontar OMU, PLTU Jawa Barat 2 Palabuhan Ratu OMU, Kamojang POMU – Gunung Salak, Kamojang POMU – Darajat, PLTU Banten 1 Suralaya OMU, Bali PGU, Suralaya PGU, Priok POMU, Maintenance Services Unit
- Penghargaan SMK3 untuk PLTU Banten 1 Suralaya OMU, Kamojang POMU, Saguling PGU, Semarang PGU, PLTU Banten 2 Labuan OMU, PLTU Banten 3 Lontar OMU, PLTU Jawa Barat 2 Palabuhan Ratu OMU, PLTU Jawa Tengah 2 Adipala OMU
- Penghargaan P2-HIV untuk PLTU Jawa Tengah 2 Adipala OMU, Saguling POMU, Mrica PGU, Bali PGU
2019 Occupational Health and Safety (OHS) Award from the Ministry of Manpower and Transmigration of the Republic of Indonesia, for the category of:• Zero Accident Award for Mrica PGU, CCPP Cilegon OMU, Grati
POMU, Saguling POMU, SPP Central Java 2 Adipala OMU, Semarang PGU, SPP Barru OMU, SPP Banten 3 Lontar OMU, SPP West Java 2 Palabuhan Ratu OMU, Kamojang POMU - Gunung Salak , Kamojang POMU - Darajat, SPP Banten 1 Suralaya OMU, Bali PGU, Suralaya PGU, Priok POMU, Maintenance Services Unit
• SMK3 award for SPP Banten 1 Suralaya OMU, Kamojang POMU, Saguling PGU, Semarang PGU, SPP Banten 2 Labuan OMU, SPP Banten 3 Lontar OMU, SPP West Java 2 Palabuhan Ratu OMU, SPP Central Java 2 Adipala OMU
• P2-HIV Award for SPP Central Java 2 Adipala OMU, Saguling POMU, Mrica PGU, Bali PGU
Penghargaan pada ajang Young Women Future Business Leader 2019 (Fitri Puspitasari dan Meiliana Puspawartiningdyas) dari Majalah SWAAward at the 2019 Young Women Future Business Leader (Fitri Puspitasari and Meiliana Puspawartiningdyas) from SWA Magazine
Penghargaan Top 5 Social Business Innovation Company 2019 pada ajang Green CEO Award 2019 dari Warta EkonomiThe 2019 Top 5 Social Business Innovation Company Award at the 2019 Green CEO Award from Warta Ekonomi
Penghargaan Peringkat Silver (Bidang Pendidikan – PAUD Inklusi Berbasis Lingkungan – Priok POMU) pada ajang Indonesia Sustainable Development Goals Award 2019 dari Corporate Forum For Community Development (CFCD)Silver Ranking (Education Sector – Environmental-Based Early Childhood Education (PAUD) Inclusion - Priok POMU) at the 2019 Indonesia Sustainable Development Goals Award from the Corporate Forum for Community Development (CFCD)
Priok POMU meraih penghargaan dalam Kategori Pemberdayaan Penyandang Masalah Kesejahteraan Sosial (PMKS), Ketunaan Sosial dan Penyampaian Perilaku pada ajang Padmamitra Award 2019 Tingkat Provinsi dari Forum CSR DKI JakartaPriok POMU obtained an award in the Empowerment of People with Social Welfare Problems (PMKS), Social Disability, and Deviant Behavior at the Provincial Level 2019 Padmamitra Award from the DKI Jakarta CSR Forum
22 April 201922 April 2019
31 Juli 2019 31 July 2019
29 Agustus 2019 29 August 2019
6 September 2019 6 September 2019
5 November 2019 5 November 2019
1
2
3
4
1 2 3 4
43 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Kinerja Keberlanjutan LainnyaOther Sustainability Performance
Penghargaan Top 3 Perusahaan Energi & Tenaga Listrik Terpopuler 2019 Kategori Energi dan Tenaga Listrik pada ajang Indonesia Corporate PR Award 2019 dari Warta EkonomiThe Top 3 Most Popular Energy & Electric Power Company Award 2019 in the Energy and Electric Power Category at the 2019 Indonesia Corporate PR Award from Warta Ekonomi
Penghargaan Chief Financial Officer PT Indo Tenaga Hijau (Sjavfitri Sari Dewi) pada ajang Indonesia Best CFO 2019 dari Majalah SWAChief Financial Officer of PT Indo Tenaga Hijau (Sjavfitri Sari Dewi) Award in the 2019 Indonesia Best CFO from SWA Magazine
Juara 2 Kategori Private Non Keuangan Non Listed pada ajang Annual Report Award 2019 dari Otoritas Jasa Keuangan (OJK), Bank Indonesia (BI), Kementerian Badan Usaha Milik Negara (BUMN), Komite Nasional Kebijakan Governance (KNKG), Bursa Efek Indonesia (BEI), Direktorat Jendral Pajak (Ditjen Pajak) dan Ikatan Akuntan Indonesia (IAI)2nd Place in the category of Non-Listed Private Non-Financial at the 2019 Annual Report Award from the Financial Services Authority (OJK), Bank Indonesia (BI), Ministry of State-Owned Enterprises (BUMN), National Committee on Governance Policy (KNKG), Indonesia Stock Exchange (IDX), Directorate General of Taxes (DG Tax) and the Indonesian Institute of Accountants (IAI) Gold Rank Sustainability Reporting Rating pada ajang Asia
Sustainability Reporting Rating (ASRRAT) 2019 dari National Center for Sustainability Reporting (NCSR)Gold Rank Sustainability Reporting Rating at the 2019 Asia Sustainability Reporting Rating (ASRRAT) from the National Center for Sustainability Reporting (NCSR)
Vision Award 2018 dari Internasional League of American Communication Professional (LACP), dengan perolehan:- Silver Award - Annual Report- Top 10 Indonesian Report of 2018 - Annual Report- Silver Award - Sustainability Report- Top 10 Indonesian Report of 2018 - Sustainability Report2018 Vision Award from the International League of American Communication Professional (LACP), with the awards of:- Silver Award - Annual Report- Top 10 Indonesian Report of 2018 - Annual Report- Silver Award - Sustainability Report- Top 10 Indonesian Report of 2018 - Sustainability Report
Penghargaan Culture Leap Promotion 2019 dari PT PLN (Persero), dengan perolehan:- 1st Winner Best Implementor Culture Leap 2019- 1st Winner Best Promotor Culture Leap 2019- 3rd Winner Best Ranger Culture Leap 20192019 Culture Leap Promotion Award from PT PLN (Persero), with awards of:• 1st Winner Best Implementor of 2019 Culture Leap • 1st Winner Best Promoter of 2019 Culture Leap• 3rd Winner of Best Ranger 2019 Culture Leap
26 Juli 201926 July 2019
28 Agustus 201928 August 2019
14 November 201914 November 2019
26 Juli 201926 July 2019
16 Oktober 2019 16 October 2019
23 November 2019 23 November 2019
1
1
3
5
2
4
6
4 63 52
44 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Sertifikasi Tahun 2019 [GRI 102-12]Certification in 2019 [GRI 102-12]
No. Nama OrganisasiOrganization
Tanggal PerolehanDate Obtained
Badan PemberiGrantor
Masa BerlakuPeriod of Validity
FotoFoto
1 ISO 9001:2015(Sistem Manajemen Mutu)ISO 9001:2015(Quality Management System)1. Kantor Pusat Head Office2. Suralaya PGU 3. Priok POMU 4. Saguling POMU 5. Kamojang POMU 6. Semarang PGU 7. Mrica PGU 8. Grati POMU9. Bali PGU 10. MSU11. Suralaya 8 OMU12. Labuan OMU13. Lontar OMU14. Pelabuhan Ratu OMU 15. Adipala OMU16. Cilegon OMU
14 Februari 202014 February 2020
PT Sucofindo 13 Februari 202313 February 2023
2 ISO 14001:2015(Sistem Manajemen Lingkungan)ISO 14001:2015(Environmental Management System)1. Kantor Pusat Head Office2. Suralaya PGU 3. Priok POMU 4. Saguling POMU 5. Kamojang POMU 6. Semarang PGU 7. Mrica PGU 8. Grati POMU9. Bali PGU 10. MSU11. Suralaya 8 OMU12. Labuan OMU13. Lontar OMU14. Pelabuhan Ratu OMU 15. Adipala OMU16. Cilegon OMU
14 Februari 202014 February 2020
PT Sucofindo 13 Februari 202313 February 2023
3 OHSAS 18001:2007(Occupational Health and Safety Management Systems)OHSAS 18001:2007(Occupational Health and Safety Management Systems)1. Kantor Pusat Head Ofice2. Suralaya PGU 3. Priok POMU 4. Saguling POMU 5. Kamojang POMU 6. Semarang PGU 7. Mrica PGU 8. Grati POMU9. Bali PGU 10. MSU11. Suralaya 8 OMU12. Labuan OMU13. Lontar OMU14. Pelabuhan Ratu OMU 15. Adipala OMU16. Cilegon OMU
14 Februari 202014 February 2020
PT Sucofindo 11 Maret 202111 March 2021
Penghargaan dan Sertifikasi Tahun 2019Awards and Certification in 2019
45 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
No. Nama OrganisasiOrganization
Tanggal PerolehanDate Obtained
Badan PemberiGrantor
Masa BerlakuPeriod of Validity
FotoFoto
4 ISO 28000:2007/SNI ISO 28000:2009(Sistem Manajemen Keamanan Pada Rantai Pasokan)ISO 28000:2007 /SNI ISO 28000:2009(Security Management System in the Supply Chain)1. Kantor Pusat Head Office2. Suralaya PGU 3. Priok POMU 4. Saguling POMU 5. Kamojang POMU 6. Semarang PGU 7. Mrica PGU 8. Grati POMU9. Bali PGU 10. Suralaya 8 OMU11. Labuan OMU12. Lontar OMU13. Pelabuhan Ratu OMU 14. Adipala OMU15. Cilegon OMU
14 Februari 202014 February 2020
PT Sucofindo 13 Februari 202313 February 2023
5 Sistem Manajemen Keselamatan dan Kesehatan Kerja (SMK3) Safety and Health Management System (SMK3)(4 PGU, 4 POMU, MSU, 6 OMU FTP-1 Jawa)(4 PGU, 4 POMU, MSU, 6 OMU FTP-1 Java)
Berbeda per unitVaried based on the unit
PT Sucofindo Berbeda per unitVaried based on the unit
6 Sistem Manajemen Pengamanan (SMP) Security Management System (SMP)(8 unit eksisting)(8 existing units)
Sedang Ditangguhkan*Suspended*
PT Sucofindo Sedang Ditangguhkan*Suspended*
7 ISO 55001:2014(Sistem Manajemen Asset)ISO 55001:2014(Asset Management System)1. Kantor Pusat Head Office2. Suralaya PGU 3. Priok POMU 4. Saguling POMU 5. Kamojang POMU 6. Semarang PGU 7. Mrica PGU 8. Grati POMU9. Bali PGU 10. MSU11. Suralaya 8 OMU12. Labuan OMU13. Lontar OMU14. Pelabuhan Ratu OMU 15. Adipala OMU16. Cilegon OMU
13 November 201813 November 2018
PT BSI Group Indonesia
26 Oktober 202126 October 2021
* terkait Perubahan Perkab POLRI Nomor 24 Tahun 2007, maka untuk semetara, Sistem Manajemen Pengamanan (SMP) dari lembaga sertifikasi (PT Sucofindo) ditangguhkan sampai ada kejelasan kembali untuk di sertifikasi kembali
* related to Amendment to the National Chief of Police Regulation No. 24 of 2007, temporarily the Security Management System (SMP) of the certification body (PT Sucofindo) is suspended until there is clarity for re-certification
46 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
No. Nama OrganisasiOrganization
Tanggal PerolehanDate Obtained
Badan PemberiGrantor
Masa BerlakuPeriod of Validity
FotoFoto
8 ISO 50001:2011(Sistem Manajemen Energi)ISO 50001:2011(Energy Management System)1. Kantor Pusat Head Office2. Suralaya PGU 3. Priok POMU 4. Saguling POMU 5. Kamojang POMU 6. Semarang PGU 7. Mrica PGU 8. Grati POMU9. Bali PGU 10. MSU11. Suralaya 8 OMU12. Labuan OMU13. Lontar OMU14. Pelabuhan Ratu OMU 15. Adipala OMU16. Cilegon OMU
15 Juli 201915 July 2019
PT Sucofindo 20 Agustus 202120 August 2021
9 ISO 27001:2013(Sistem Manajemen Keamanan Informasi)ISO 27001:2013(Information Security Management System)(Divison of Information Technology Kantor Pusat)(Head Office’s Information Technology Division)
18 Agustus 201718 August 2017
PT BSI Group Indonesia
17 Agustus 202017 August 2020
10 ISO 22301:2012(Business Continuity Management System)ISO 22301:2012(Business Continuity Management System)(Kantor Pusat dan Priok POMU)(Head Office and Priok POMU)
5 Februari 20185 February 2018
PT BSI Group Indonesia
4 Februari 20214 February 2021
Penghargaan dan Sertifikasi Tahun 2019Awards and Certification in 2019
47 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
No. Nama OrganisasiOrganization
Tanggal PerolehanDate Obtained
Badan PemberiGrantor
Masa BerlakuPeriod of Validity
FotoFoto
11 ISO 17025 Standar Akreditasi Laboratorium Pengujian dan KalibrasiISO 17025 Testing and Calibration Laboratories Accreditation Standards(Suralaya 8 PGU, Labuan OMU, Pelabuhan Ratu OMU dan Adipala OMU)(Suralaya 8 PGU, Labuan OMU, Pelabuhan Ratu OMU, and Adipala OMU)
November 2018 November 2018
Komite Akreditasi Nasional National Accreditation Committee
November 2022November 2022
12 International Sustainability Rating System (ISRS7) Level 4International Sustainability Rating System (ISRS7) Level 4(PLTU Banten 3 Lontar OMU)(SPP Banten 3 Lontar OMU)
3-7 Desember 20183-7 December 2018
DNV-GL 6 Desember 20196 December 2019
48 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Peristiwa Penting Tahun 2019Significant Events in 2019
Pembangkitan PLTU Banten 3 Lontar menerima sertifikat International Sustainability Rating System (ISRS). ISRS merupakan sistem terdepan di dunia untuk mengukur dan memperbaiki kualitas sistem manajemen pada perusahaan agar dapat berjalan secara berkesinambungan khususnya pada aspek-aspek Health Safety Environment (HSE). ISRS dirancang untuk membantu organisasi mengelola risikonya dan mendorong peningkatan berkelanjutan.
SPP Banten 3 Lontar obtained the certificate of the International Sustainability Rating System (ISRS). ISRS is the world-leading system to assess and improve the quality of the management system in a company to run sustainably, specifically in the Health Safety Environment (HSE) aspect. ISRS is designed to assist organizations to manage their risks and drive continuous improvement.
Direktur Utama Indonesia Power, Sripeni Inten Cahyani, bersama Dirut Waskita Karya, I Gusti Ngurah Putra menandatangani perjanjian kerjasama pengolahan instalasi pengolah sampah PLTSa Regional Sarbagita, Bali. Sinergi BUMN yang dilakukan ini bertujuan untuk membantu pemerintah mencapai target 24% penggunaan Energi Baru dan Terbarukan.
President Director of Indonesia Power, Sripeni Inten Cahyani, and President Director of Waskita Karya, I Gusti Ngurah Putra, signed a cooperation agreement for waste processing plant installation at WPP Sarbagita Region, Bali. The Synergy of SOEs is carried out to assist the government in achieving the 24% target of the New and Renewable Energy utilization.
PLTU Banten 3 Lontar OMU Pelopor ISRS Pembangkitan Listrik di IndonesiaSPP Banten 3 Lontar OMU Pioneers the ISRS for Power Generation in Indonesia
Indonesia Power - Waskita KaryaTeken Langkah Strategis KelolaSampah jadi EnergiIndonesia Power - Waskita Karya Signs Strategic Steps to Manage Waste into Energy
11 Januari 201911 January 2019
29 Januari 201929 January 2019
49 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Indonesia Power melakukan penandatanganan Nota Kesepahaman (MoU) dengan PT Wijaya Karya Beton dan PT Mahadaya Mitra Mandiri. Penandatanganan MoU tersebut mengenai potensi kerjasama terkait pemanfaatan limbah bottom ash PLTU Suralaya. Pemanfaatan bottom ash sebagai bahan pengganti beton dan dapat juga untuk menggantikan semen sampai 30% berat semen yang dipergunakan dan dapat menambah daya tahan dan ketahanan terhadap bahan kimia.
Indonesia Power signed a Memorandum of Understanding (MoU) with PT Wijaya Karya Beton and PT Mahadaya Mitra Mandiri. The MoU is signed in relation to the potential for cooperation of the SPP Suralaya bottom ash waste utilization. Bottom ash can be utilized as a substitute for concrete and cement up to 30% of the cement’s weight used. It can also increase durability and resistance to chemicals.
Indonesia Power melakukan penandatanganan Nota Kesepahaman (MoU) dengan Badan Nasional Pencarian dan Pertolongan (BASARNAS). MoU ini merupakan langkah strategis Indonesia Power untuk peningkatan kemampuan di bidang K3. Salah satu dari tujuh poin kerjasama yang disepakati yakni peningkatan kompetensi Indonesia Power melalui kerjasama pelatihan kemampuan SAR serta Quick Access Basarnas terhadap kejadian yang membutuhkan penanganan segera di lingkungan Indonesia Power.
Indonesia Power signed a Memorandum of Understanding (MoU) with the National Search and Rescue Agency (BASARNAS). This MoU is a strategic step for Indonesia Power to improve capabilities in the OHS field. One of the seven agreed key terms is Indonesia Power’s competence enhancement through collaborative training in BASARNAS’ SAR and Quick Access for events that require immediate handling within Indonesia Power.
Indonesia Power Teken MoU Pemanfaatan Limbah Bottom Ash SuralayaIndonesia Power Signs MoU on Bottom Ash Waste Utilization at Suralaya
Tingkatkan Kemampuan K3, Indonesia Power Teken MoU dengan BASARNASImproving OHS Capability, Indonesia Power Signs MoU with BASARNAS
21 Februari 201921 February 2019
28 Februari 201928 February 2019
50 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Indonesia Power laksanakan MoU atau Nota Kesepahaman sebagai dasar atau langkah awal untuk mengkaji, mengembangkan dan memanfaatkan sumber daya alam dan sumber energi terbarukan yang ada di Provinsi Bangka Belitung. Selain itu, juga akan dilaksanakan kegiatan pengembangan, pendidikan dan kegiatan lain yang erat kaitannya dengan tujuan kesepakatan bersama ini untuk kesejahteraan masyarakat umumnya dan khususnya di Provinsi Kepulauan Bangka Belitung.
Indonesia Power implements an MoU or Memorandum of Understanding as an initial step to review, develop, and utilize natural resources and renewable energy sources in Bangka Belitung Province. In addition to the development activities, education and other activities will be carried out with the objectives to improve the welfare of the community in general, and specifically in Bangka Belitung Islands Province.
Indonesia Power dan Pemerintah Provinsi Babel Sepakati Pengembangan Sumber Daya Alam Dan Sumber Energi TerbarukanIndonesia Power and the Babel Provincial Government Enter into Agreement to Develop Natural Resources and Renewable Energy Sources
MoU Indonesia Power – Mitsubishi terkait Diskusi dan Assessment untuk Realisasi Program Reliability dan Efisiensi Pembangkit FTP-1MoU of Indonesia Power - Mitsubishi related to Discussion and Assessment for the FTP-1 Generator Reliability and Efficiency Program
4 April 20194 April 2019
25 April 201925 April 2019
Indonesia Power melakukan penandatanganan Nota Kesepahaman (MoU) dengan Mitsubishi mengenai “Diskusi dan Assessment untuk Realisasi Program Reliability dan Efisiensi Pembangkit FTP-1” di Ruang Suralaya, Gedung Centennial Tower, Jakarta.
Indonesia Power signed a Memorandum of Understanding (MoU) with Mitsubishi regarding “Discussion and Assessment for the FTP-1 Generator Reliability and Efficiency Program” at Suralaya Room, Centennial Tower Building, Jakarta.
Peristiwa Penting Tahun 2019Significant Events in 2019
51 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Indonesia Power menggandeng Kementerian ESDM dan PLN menggelar Ceremony Commercial Operation Pembangkit Listrik Tenaga Air (PLTA) Rajamandala berkapasitas 47 MW yang merupakan wujud dari PLN dan Indonesia Power menggenjot pembangunan pembangkit listrik Energi Baru dan Terbarukan dalam bauran energi sebesar 23%. Melalui transmisi 150 kV Cianjur – Cigereleng PLTA Rajamandala akan memperkuat sistem interkoneksi kelistrikan Jawa – Bali sekaligus sebagai backup system kelistrikan khususnya di wilayah Kabupaten Bandung. PLN dan Indonesia Power sangat komit dengan penggunaan renewable energy, maka PLN yakin jika Indonesia Power akan menjadi leading dalam bidang renewable energy.
Indonesia Power collaborates with the Ministry of EMR and PLN to hold Commercial Operation Ceremony for the 47 MW Rajamandala Hydropower Plant as a manifestation of PLN and Indonesia Power in boosting the construction of a New and Renewable Energy power plant to achieve 23% energy mix. The 150 kV Cianjur-Cigereleng Rajamandala HPP transmission will strengthen the Java-Bali interconnected network and act as electricity backup system, especially in the Bandung Regency area. PLN and Indonesia Power are very committed to utilizing renewable energy. Therefore, PLN is very confident that Indonesia Power will become the leader in the renewable energy field.
Indonesia Power yang mempunyai kompetensi di bidang Operasi dan Pemeliharaan Pembangkit lakukan penandatanganan kesepakatan inplementasi Program IP PINTAR di ruang rapat Bupati Kubu Raya. Diharapkan program IP PINTAR ini dapat dikembangkan lebih baik lagi sehingga mampu meningkatkan daya saing lulusan SMK di Kabupaten Kubu Raya sebagai tenaga kerja yang kompeten dibidang operasi & pemeliharaan pembangkitan.
Indonesia Power, with competence in the Generator Operation and Maintenance field, signed an agreement to implement IP PINTAR Program in the Kubu Raya Regent meeting room. IP PINTAR program is expected to improve to bolster the competitiveness of Vocational High School (SMK) graduates in Kubu Raya Regency as competent workforce in the generator operation & maintenance field.
PLTA Rajamandala Siap Suplai Listrik Jawa-BaliRajamandala HPP is Ready to Supply Java-Bali Electricity
Indonesia Power dan Pemerintah Kabupaten Kubu Raya Sepakat Implementasikan Program IP PINTARIndonesia Power and the Kubu Raya Regency Agree to Implement the IP PINTAR Program
12 Juli 201912 July 2019
22 Juli 201922 July 2019
52 Laporan Keberlanjutan 2019PT Indonesia Power
Gam
bara
nKe
berla
njut
an
Indonesia Power yang telah berkomitmen terhadap upaya pengendalian pencemaran lingkungan melakukan penandatanganan Perjanjian Kerja Sama (PKS) dengan Kementerian Lingkungan Hidup dan Kehutanan (KLHK) Republik Indonesia. Sebelum menandatangani PKS, Indonesia Power Bali PGU juga telah memberikan bantuan terhadap penyiapan ruang pamer, toilet dan lobi lantai I di Kantor P3E Bali Nusra yang kemudian digunakan sebagai Kantor Regional Capacity Center for Clean Seas (RC3S) sebagai upaya pengenalan lebih dalam terhadap pengendalian lingkungan kepada masyarakat.
Indonesia Power is committed to controlling the environmental pollution, and has signed a Cooperation Agreement (PKS) with the Ministry of Environment and Forestry (KLHK) of the Republic of Indonesia. Prior to signing the PKS, Indonesia Power Bali PGU assisted in preparing the showrooms, toilets, and the first-floor lobby at the Bali Nusra P3E Office which was the Regional Capacity Center for Clean Seas (RC3S) Office as an effort to introduce better environmental controls to the public.
Indonesia Power dan PAL Indonesia tanda tangani kesepakatan kontrak kerja pembangunan Barge Mounted Power Plant (BMPP) berkapasitas 2x60MW dan 1x30MW. Ketiga unit pembangkit terapung tersebut rencana akan ditempatkan di Kolaka Sulawesi Tenggara dan Sambelia Nusa Tenggara Barat mengingat pada tahun 2020 kedua daerah tersebut akan membutuhkan listrik yang cukup besar. Selain cocok untuk daerah terpencil, BMPP ini memiliki keunggulan dalam fleksibilitas penggunaan bahan bakar, karena dapat dioperasikan dengan menggunakan bahan bakar Gas atau dapat juga dengan menggunakan BBM (HSD/B20).
Indonesia Power and PAL Indonesia signed a construction contract agreement for 2x60MW and 1x30MW Barge Mounted Power Plant (BMPP). The three floating generating units will be located in Kolaka, Southeast Sulawesi, and Sambelia, West Nusa Tenggara, taking into account that in 2020, both regions will require substantial electricity. In addition to being suitable for remote areas, BMPP has the advantage in the fuel utilization flexibility, as it operates using both Gas fuel and Oil Fuel (HSD/B20).
Indonesia Power Wujudkan Komitmen Nyata Perusahaan Terhadap Upaya Pengendalian Pencemaran LingkunganIndonesia Power Actualizes the Company’s Commitment to Controlling the Environmental Pollution
Kemandirian Pemenuhan Pembangkit Listrik Terapung Di Indonesia Timur Indonesia Power Kerjasama dengan PT PALIndependence in the Fulfillment of Floating Power Plants in Eastern Indonesia, Indonesia Power Cooperates with PT PAL
22 Juli 201922 July 2019
30 September 201930 September 2019
Peristiwa Penting Tahun 2019Significant Events in 2019
53 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y O
verv
iew
Indonesia Power melakukan penandatanganan Nota Kesepahaman (MoU) dengan PD Tebo Holding Company tentang Bahan Baku Biomass untuk Pembangkit Listrik Biomass. Kawasan kabupaten Tebo memiliki tanah konsesi Hutan Tanaman Industri (HTI) seluas 19.000 Hektar dan 9.000 s/d 10.000 Hektar akan digunakan untuk penanaman pohon Kareo dan Kaleandra yang memiliki masa tanam rendah untuk menjadi Biomass. Dengan upaya pemanfaatan HTI ini bisa segera dibangun Pembangkit Listrik Biomass serta membantu perekonomian masyarakat Jambi.
Indonesia Power signed a Memorandum of Understanding (MoU) with PD Tebo Holding Company regarding Biomass Raw Materials for Biomass Power Plant. The Tebo regency area has 19,000 hectares of Industrial Plantation Forest (HTI) concessions and approximately 9,000-10,000 hectares will be utilized to plant Kareo and Kaleandra trees with short planting time to be the biomass raw material. By utilizing HTI, a Biomass Power Plant can be built immediately and supports Jambi people’s economy.
Indonesia Power melakukan peresmian IP Academy berbasis digital learning. Melalui IP Academy, Indonesia Power berupaya memberikan ide perbaikan dan inovasi dalam setiap langkah mencapai Human Capital Excellence. Dengan menggunakan metode digital learning strategy, IP Academy melangkah ke depan dalam rangka menjawab tantangan Industri 4.0, dengan tetap menjaga kaidah implementasi konsep Corporate University yaitu Learning Value Chain (LVC).
Indonesia Power inaugurated digital learning-based IP Academy. Through IP Academy, Indonesia Power strives to provide ideas for improvement and innovation in every step to achieve Human Capital Excellence. By using the digital learning strategy method, IP Academy is moving forward to answer Industry 4.0 challenges, while maintaining the Corporate University concept, i.e. the Learning Value Chain (LVC).
Indonesia Power Serius Bangun Pembangkit Listrik Biomass denganPD Tebo Holding CompanyIndonesia Power is Committed to Constructing Biomass Power Plant with Pd Tebo Holding Company
Resmikan IP Academy, Indonesia Power Siap Hadapi Tantangan Industry 4.0Inaugurating IP Academy, Indonesia Power is Ready to Face Challenges of Industry 4.0
28 November 201928 November 2019
16 Desember 201916 December 2019
54 Laporan Keberlanjutan 2019PT Indonesia Power
ProfilPerusahaanCompany Profile
55 Sustainability Report 2019PT Indonesia Power
Indonesia Power semakin memantapkan langkah, menciptakan strategi cemerlang demi tercapainya
eksekusi ekselen dalam menyediakan pembangkit yang andal, prima, efisien dan berkelanjutan.
Indonesia Power is increasingly solidifying its steps and creating brilliant strategies to achieve excellent execution in providing
reliable, prime, efficient, and sustainable power plants.
56 Laporan Keberlanjutan 2019PT Indonesia Power
Profil
Peru
saha
an
Identitas PerusahaanCompany Identity
PT Indonesia Power 3 Oktober 1995October 3, 1995
Nama PerusahaanCompany Name [GRI 102-1]
Kegiatan, Merek, Produk dan Jasa Perusahaan Company’s Activities, Brands, Products and Services [GRI 102-2]
Tanggal PendirianDate of Establishment
Indonesia Power bergerak di bidang pembangkitan tenaga listrik dengan produk dan layanan sebagai berikut:
Selama tahun 2019, tidak terdapat produk dan layanan Perusahaan yang dilarang dari pasar.
Indonesia Power is engaged in electricity generation with the following products and services:
During 2019, no products and services of the Company were prohibited from the market.
Produk Products
Power Generation Unit (PGU)
Operation and Maintenance Services
Unit (OMU)
Power Generation and O&M Services Unit (POMU)
Maintenance Service Unit (MSU)
Fungsi pembangkitan tenaga listrik melalui 4 PGU dengan total kapasitas terpasang sebesar 5.570,97 MW.Power generation function through 4 PGUs with a total of 5,570.97 MW installed capacity.
Fungsi pengoperasian dan pemeliharaan pembangkit melalui 11 OMU dengan total kapasitas terpasang sebesar 5.264,00 MW.Operation and maintenance of the plant function through 11 OMUs with 5,264 MW of total installed capacity.
Fungsi pembangkitan tenaga listrik dan pengelolaan jasa O&M melalui 5 POMU (5 pembangkit milik sendiri dan 4 jasa O&M) dengan total kapasitas terpasang sebesar 5.720,59 MW.Power generation and O&M Services function through 5 POMUs (5 existing plants and 4 O&M services) with 5,720.59 MW of total installed capacity.
Usaha-usaha yang dikembangkan lainnya sebagai penyedia jasa engineering dan technical services dalam berbagai aspek pembangunan pembangkit listrik dan juga pengoperasian serta pemeliharaannya melalui satu MSU.Other business development is as engineering and technical services provider in various aspects of power plant development and operation and maintenance through one MSU.
Layanan ServicesProgram Pengembangan PembangkitPower Plant Development Program
Penjualan Tenaga ListrikElectricity Sales
Keahlian (Expertise) dalam Jasa PemeliharaanExpertise in Maintenance Services
Jasa Operasi dan PemeliharaanOperation and Maintenance Services
57 Sustainability Report 2019
PT Indonesia Power
Com
pany
Profile
Bentuk Hukumdan KepemilikanLegal Form and Ownership[GRI 102-5]
Kantor PusatHead Office
Status PerusahaanCompany Status
Dasar Hukum PendirianLegal Basis for Establishment
Kepemilikan SahamShareholdings
Anak Perusahaan PT PLN (Persero) Subsidiary of PT PLN (Persero)
1. Akta Pendirian PT PLN Pembangkitan Tenaga Listrik Jawa-Bali I (PT PLN PJB I) tanggal 3 Oktober 1995
2. Akta Perubahan Nama dari PT PLN PJB I menjadi PT Indonesia Power tanggal 3 Agustus 2000, dibuat dihadapan notaris Siti Pertiwi Henny Singgih, SH dengan Akta Nomor 8 tanggal 3 Agustus 2000
Kantor Pusat PT Indonesia PowerCentennial Tower Lt. 7-8Jl. Jend. Gatot Subroto Kav. 24-25 Jakarta Selatan 12950, Indonesia (62-21) 5267666 (hunting) (62-21) 5252623 www.indonesiapower.co.id
Head Office of PT Indonesia Power Centennial Tower 7 - 8 FloorJl. Jend. Gatot Subroto Kav. 24-25 Jakarta Selatan 12950, Indonesia (62-21) 5267666 (hunting) (62-21) 5252623 www.indonesiapower.co.id
1. Deed of Establishment of PT PLN Pembangkitan Tenaga Listrik Jawa-Bali I
(PT PLN PJB I) dated 3 October 19952. Deed of Change of Name from PT PLN PJB I
to PT Indonesia Power dated 8 August 2000, and was approved through a Decree of the Minister of Law and Legislation of the Republic of Indonesia dated 1 September 2000
99,99%PT PLN (Persero)
0,01%Yayasan Pendidikan dan Kesejahteraan PT PLN (Persero) Foundation for Education and Welfare (YPK) PT PLN (Persero)
58 Laporan Keberlanjutan 2019PT Indonesia Power
Profil
Peru
saha
an
Skala Organisasi Perusahaan [GRI 102-7]Company’s Organizational Scale [GRI 102-7]
UraianDescription
SatuanUnit
Tahun Year
2017 2018 2019
Jumlah Pegawai Employees Orang People 4.209 4.209 4.320Jumlah Pendapatan UsahaTotal Revenues Rp Juta Million 39.436.418 43.038.300 42.583.849
Laba Tahun BerjalanIncome for the Year Rp Juta Million 3.232.323 3.501.624 7.370.309
Jumlah Aset Total Assets Rp Juta Million 218.339.042 196.133.125 189.705.596
Jumlah Liabilitas Total Liabilities Rp Juta Million 9.208.877 8.095.689 7.712.395
Jumlah Ekuitas Total Equity Rp Juta Million 209.130.165 188.037.436 181.993.199Jumlah Kapasitas Daya Terpasang Jawa-Bali (Grid dan Embedded)Installed Capacity in Java-Bali(Grid and Embedded)
MW 8.783 8.644 8.954
Kapasitas O&M O&M Capacity MW 6.039 6.954 7.109
Kepemilikan Saham ShareholdingsPT Perusahaan Listrik Negara (PLN) (Persero) % 99,99% 99,99% 99,99%
Yayasan Pendidikan dan Kesejahteraan (YPK) PT PLN (Persero)Foundation for Education and Welfare (YPK) PT PLN (Persero)
% 0,01% 0,01% 0,01%
59 Sustainability Report 2019
PT Indonesia Power
Com
pany
Profile
Visi, Misi, Kompetensi Inti dan Budaya Perusahaan [GRI 102-16] Corporate Vision, Mission, Core Competence and Culture [GRI 102-16]
Menjadi perusahaan energi tepercaya yang tumbuh berkelanjutan.
VisiVision
To be a trusted energy company with sustainable growth.
Operasi dan Pemeliharaan PembangkitPengelolaan pembangkit dengan kekuatan pada pengoperasian dan pemeliharaan berdasarkan tata kelola sesuai praktik terbaik (best practice) dan metode rekayasa (engineering method) yang ekselen.Power Plant Operations and MaintenancePower plant management with an advantage in the operations and maintenance based on a governance that refers to the best practices and excellent engineering methods.
Pengembangan PembangkitPengembangan bisnis pembangkit, energi dan jasa terkait, dengan kekuatan pada enjiniring dan prokurmen. (Enjiniring meliputi basic design, engineering review, project supervision dan project integrator).Power Plant DevelopmentThe business development of power plants, energy, and relevant services, with advantage in engineering and procurement areas. (Engineering covers basic design, engineering review, project supervision, and project integrator).
Kompentensi Inti PerusahaanCorporate Core Competence
Menyelenggarakan bisnis pembangkitan tenaga listrik dan jasa terkait yang bersahabat dengan Lingkungan.Carrying out environmentally-friendly power generation business and relevant services.
MisiMission
60 Laporan Keberlanjutan 2019PT Indonesia Power
Profil
Peru
saha
an
Visi, Misi, Kompetensi Inti dan Budaya Perusahaan [Gri 102-16]Corporate Vision, Mission, Core Competence and Culture [GRI 102-16]
Indonesia Power telah merumuskan pedoman tata nilai Perusahaan yang berperan dalam pembentukan karakter insan Indonesia Power yang disebut dengan IP AKSI (Intergritas, Profesional, Proaktif, Sinergi) serta pedoman cara berpikir (The Way We Think), cara bertindak (The Way We Act) dan cara berbisnis (The Way We Do Business) yang disebut Indonesia Power Way.
Indonesia Power has formulated guidelines for the Company’s values with a role in shaping the character of Indonesia Power’s personnel called IP AKSI (Integrity, Professional, Proactive, Synergy), The Way We Think, The Way We Act, and The Way We Do Business, set forth in Indonesia Power Way.
Budaya PerusahaanCompany Culture
TANDA PANAH ke atas menunjukkan gerakan kegiatan usaha Perusahaan yang selalu fokus pada peningkatan Kinerja secara terus menerus dalam
mencapai visi Perusahaan.
An ARROW pointing upward signifies the Company’s business activities that are constantly focused on sustainable
improvements of Performance in the realization of the Company’s vision.
SUDUT – SUDUT panah yang fleksible (tidak runcing) menggambarkan keluwesan Perusahaan memanfaatkan peluang dan menjawab tantangan Perubahan.
Flexible (rounded) CORNERS of the arrow illustrate the Company’s flexibility in taking advantages of opportunities and answering the challenges of Change.
PONDASI digambarkan berupa pita bertuliskan motto Trust Us For Power Excellence menunjukkan
kepercayaan dari para stakeholders yang diperoleh dari layanan ekselen Perusahaan.
The FOUNDATION is symbolized by a ribbon bearing the Motto written “Trust Us for Power Excellence”, implying
the trust gained from the shareholders as a result of the Company’s excellent services.
Eksternal: Membangun Kepercayaan stakeholder melalu keunggulan Indonesia Power dalam pengelolaan pembangkit listrik.
Internal: Membangun rasa saling percaya antar insan Indonesia
External: Building stakeholder trust through Indonesia Power’s excellence in power plant management.
Internal: Building trust among Indonesia Power Personnel in order to establish excellent process and Human Resources.
IP AkSiDi tengah lingkaran ada gerakan dinamis motor IP AkSi yang menggerakkan dan menguatkan bangunan, berakar pada nilai – nilai universal Integritas, Professional, Proaktif dan luwes dalam ber Sinergi memanfaatkan Peluang dan menjawab tantangan Perubahan untuk mencapai tujuan perusahaan.
IP AkSiAt the center of the circle lies IP AkSi motor with its dynamic movement that drives and strengthens the building, founded on the universal values of Integrity, Professional, Proactive, and flexible in creating Synergy for taking advantages of the Opportunities and answering the challenges of Change to achieve the Company’s goals.
LINGKARAN dengan tanda panah bergradasi menunjukkan siklus berkesinambungan 3 cara khas
mencakup cara berpikir (The way we think), cara bertindak (The way we
act) dan cara berbisnis (The way we do business) yang saling terkait dalam
proses peningkatan maturitas.
A CIRCLE with three arrows in gradient color symbolizes an unbroken cycle of three (3) unique, interconnected ways
that cover the way we think, the way we act, and the way we do business in the process of maturity improvement.
HIJAU dibuat mengelilingi Motto (Trust us for power Excellence) yang artinya semangat Perusahaan untuk
tetap selaras dan peduli terhadap lingkungan.
The GREEN line wrapping around the Motto (“Trust Us for Power
Excellence”) symbolizes the Company’s spirit to maintain harmony with and
awareness of the environment.
61 Sustainability Report 2019
PT Indonesia Power
Com
pany
Profile
62 Laporan Keberlanjutan 2019PT Indonesia Power
Profil
Peru
saha
an
Struktur Organisasi Perusahaan [GRI 102-18] Company’s Organization Structure [GRI 102-18]
PLT. Direktur UtamaActing of President Director
M. Ahsin Sidqi
Direktur Pengembangan dan NiagaDirector of Development and Commerce
Adi Supriono
Division of Business Development I
M Wahyudi
Department of Internal Audit
Rachmanto Kusumonegoro
Division of Power Generation I
Pelitabaru Pakpahan
Division of Power Generation II-1
Hari Cahyono
Division of Business Development II
Flavianus Erwin Putranto
Department of Corporate Strategic Planning, Performing and Risk
Management
Tarwaji
Division of Primary Energy I
Irwan Edi Syahputra Lubis
Division of Power Generation II-2
Moch. Padang Dirgantara
Division of Business Development III
Hendry Asdayoka Putra
Department of Research Innovation and Engineering
Herry Nugraha
Division of Commerce and Customer Relation I
Sigit Ariefiatmoko
Division of Primary Energy and Settlement II
Muhammad Mursid
Division of Project Management and Pre-construction
Usvizal Z
Corporate Secretariat
I G A N Subawa Putra
Fungsional / Expertise(Eksekutif Senior)
Division of Primary Energy and Business Development Procurement
Endi Novaris Syamsudin
Division of Health, Safety and Environment
Hendres Wayen P
Division of Spare Parts and Services Procurement
Aliansyah Abdullah
Division of Technology Information
Didik Harjanto
Division of Corporate Legal
R. Bagoes Bawono K
Anak PerusahaanSubsidiaries
Usaha PatunganJoint Venture
Fungsional / Expertise(Eksekutif Senior)
Fungsional / Expertise(Eksekutif Senior)
PLT. Direktur Operasi I Acting of Operations Director I
M. Hanafi Nur Rifai
PLT. Direktur Operasi IIActing of Operations Director II
Bambang Anggono
Mek
anis
me
RUPS
Ana
k Pe
rusa
haan
/Usa
ha P
atun
gan
GSM
mec
hani
sm o
f Sub
sidi
arie
s/Jo
int V
entu
re
63 Sustainability Report 2019
PT Indonesia Power
Com
pany
Profile
General Manager of Project Unit
GM of Suralaya Power Generation Unit
Amlan
GM of PLTU Jawa Barat 2 Pelabuhan Ratu Operation & Maintenance Service Unit
Rolly
GM of PLTGU Cilegon Operation & Maintenance Service Unit
Muhammad Imaduddin
GM of PLTU Banten 2 Labuan Operation& Maintenance Service Unit
Zuhdi Rahmanto
GM of Semarang Power Generation Unit
Suparlan
GM of PLTU Jawa Tengah 2 Adipala Operation & Maintenance
Service Unit
Rita Triani
GM of Mrica Power Generation Unit
Slamet Suwardi
Manager of PLTU Barru Operation& Maintenance Service Unit
Jimkerr
GM of Kamojang Power Generation Unit
Budi Wibowo
Manager of PLTU Sintang Operation & Maintenance Service Unit
Tantan Rustandi
GM of Priok Power Generation and O&M Service Unit
Rachmad Handoko
GM of PLTU Banten Lontar 3 Pelabuhan Ratu Operation & Maintenance
Service Unit
Rahmat Syahputra Lubis
GM of Saguling Power Generation and O&M Service Unit
Rusdiansyah
GM of PLTU Pangkalan Susu Operation & Maintenance Service Unit
Kukuh Pambudi
GM of Grati Power Generation and O&M Service Unit
Mulyadi
GM of PLTU Banten 1 Suralaya Operation & Maintenance Service Unit
Hendra
GM of Bali Power Generation Unit
Igan Wardiana Yasa
Manager of Jeranjang Operation & Maintenance Service Unit
Melky Victor Borsalino
GM Maintenance Service Unit
Tri Tjahjonoputro
Manager of PLTU Sanggau Operation & Maintenance Service Unit
Ade Arifin
Manager of Holtekamp Operation & Maintenance Service Unit
Rian Kuspratomo
Division of Budgeting
Andri Febriyanto
Division of Human Capital and Change Management
Teuku Yusuf
Division of Treasury and Tax
Susi Ashsera
Division of Human Capital Development
Furqan Tanzala
Division of Accounting and Assurance
Moch. Choirul
Division of Talent Management
Imam Adi Prihantoro
Division of Subsidiaries andCorporate Funding
Arief Syafarianto
Division of Industrial Relations and Remuneration
Asep Yanyan Herdiyana
PLT. Direktur KeuanganActing of Finance Director
Susy Liestiowaty
PLT. Direktur Sumber Daya Manusia dan Administrasi
Acting of Human Resources and Administration Director
Okto Rinaldi Sagala
Direksi (Board of Director)
64 Laporan Keberlanjutan 2019PT Indonesia Power
Profil
Peru
saha
an
Wilayah Kerja Perusahaan Operational Area
Indonesia Power berkantor pusat di Centennial Tower Lt. 7-8, Jl. Jend. Gatot Subroto Kav. 24-25 Jakarta Selatan 12950, Indonesia. Wilayah operasi Perusahaan tersebar di seluruh Indonesia, diantaranya Pulau Sumatera, Kalimantan, Jawa, Bali, Sulawesi, Nusa Tenggara dan Papua. [GRI 102-3, 102-4, 102-6]
PLTU SPP Pangkalan Susu(2x220 MW)
1. PLTU SPP Suralaya #8: 625 MW2. PLTU SPP Labuan #1,2: 600 MW3. PLTU SPP Lontar #1,2,3: 945 MW4. PLTU SPP Plb Ratu #1,2,3: 1.050 MW5. PLTGU CCPP Cilegon: 739 MW
PLTU SPP Adipala (660 MW)
Suralaya PGU (3.400 MW) PLTU SPP Batubara #1-7
Kamojang POMU 377 MW PLTP GPP Kamojang #2,3: 142 MW PLTP GPP Derajat #1: 55 MWPLTP GPP Salak #1,2,3: 180 MW
Semarang PGU (1.238 MW) PLTU SPP: 200 MWPLTGU CCPP: 1.034 MWPLTD DPP: 4 MW
Saguling POMU (797 MW)PLTA HPP Saguling #1,2,3,4: 700 MWPLTA HPP Area: 97 MW
Mrica PGU (310 MW)PLTA HPP Sudirman: 181 MWPLTA HPP Area: 129 MW
PLTGU CCPP #3: 740 MW PLTGU CCPP #4: 600 MW
PLTGU CCPP #1,2: 1.180 MW
Priok POMU (2.520 MW)
PLTU SPP Sanggau (2x8,5 MW) Kalbar
PLTU SPP Sintang (3x7 MW) Kalbar
65 Sustainability Report 2019
PT Indonesia Power
Com
pany
ProfileIndonesia Power is headquartered at Centennial Tower 7th-8th Floor, Jl. Jend. Gatot Subroto Kav. 24-25 South Jakarta 12950,
Indonesia. The Company’s operational areas cover Indonesia, including the islands of Sumatra, Kalimantan, Java, Bali, Sulawesi, Nusa Tenggara, and Papua. [GRI 102-3, 102-4, 102-6]
PLTP GPP Ulumbu #1,2,3,4: 4x2,4 MW
PLTU SPP Barru (2x50 MW) Sulsel
PLTU SPP Jeranjang (2x30 MW) Lombok
PLTA HPP Orya Genyem (2x10 MW) Jayapura
PLTU SPP Holtekamp (2x12 MW) Jayapura
Bali PGU (557 MW) PLTDG GPP Pesanggaran: 200 MW PLTG GTPP Pesanggaran: 125 MW
PLTG GTPP Pemaron: 98 MW PLTG GTPP Gilimanuk: 134 MW
Grati POMU (1.067 MW)
PLTGU CCPP: 462 MWPLTG GTPP: 302 MW
PLTGU CCPP #3: 303 MW
66 Laporan Keberlanjutan 2019PT Indonesia Power
Profil
Peru
saha
an
Berdasarkan data operasional Jawa Bali, pada tahun 2019 realisasi energi listrik wilayah Jawa-Bali adalah sebesar 194.560 GWh, meningkat 3,71% dari tahun 2018 yaitu sebesar 187.605 GWh. Dari total pasokan tersebut, pada tahun 2019 Indonesia Power memasok sebesar 19,22% atau sebesar 37.391 GWh, dimana hasil produksi ini dijual kepada induk Perusahaan yaitu PT Perusahaan Listrik Negara (Persero) sebagai single buyer. Jumlah tersebut menurun 6,87% dari tahun 2018 yang disebabkan adanya faktor variasi musim, operasinya Priok Blok 4 dan Grati Blok 3 (O&M IP) yang lebih efisien dibandingkan dengan Blok 1-2 serta penurunan salah satu pasokan gas Tambak Lorok, di samping dengan bertambahnya pembangkit Jawa Bali di tahun 2019 antara lain PLTGU Grati ST 3.0, PLTGU Priok ST 4.0, PLTU Jawa 7 dan PLTU Jawa 8. Untuk itu, Indonesia melakukan upaya untuk meningkatkan pangsa pasar dengan cara menjaga keandalan PLTU Batubara, berkoordinasi aktif dengan PLN P2B untuk optimalisasi pengoperasian PLTGU dan meningkatkan pengoperasian PLTA sesuai dengan sumber daya air yang ada serta melakukan upaya penambahan pembangkit renewable energy.
Sementara itu, pada tahun 2019 untuk Unit O&M yang dikelola oleh Indonesia Power Indonesia Power memasok sebesar 17,45% atau sebesar 33.947 GWh. Jumlah tersebut meningkat 19,25% dari tahun 2018 antara lain dikarenakan operasi Combine cycle PLTGU Priok dan Blok 4 serta Merit order yang lebih baik PLTU O&M.
Based on Java Bali operational data, in 2019, the realization of electricity in the Java-Bali region amounted to 194,560 GWh, increased by 3,71% from 2018, 2018 which was 187,605 GWh. In 2019, of the total supply, Indonesia Power supplied 19.22% or 37,391 GWh of power, sold to the parent company, PT Perusahaan Listrik Negara (Persero) as a single buyer. The number decreased by 6.87% from 2018 due to seasonal variations, Priok Block 4 and Grati Block 3 (O&M IP) operations that were more efficient than Block 1-2, and a decline in one of Tambak Lorok gas supplies, in addition to the increase of Java-Bali power plants in 2019, which included Grati CCPP ST 3.0, Priok ST CCPP 4.0, Java 7 SPP, and Java 8 SPP. Thus, Indonesia Power strives to increase market share by maintaining the reliability of Coal-Fired SPP, actively coordinating with PLN P2B to optimize the CCPP operations, and increasing HPP operations in line with existing water resources and striving to add renewable energy plants.
Meanwhile, in 2019, the O&M Unit managed by Indonesia Power supplied 17.45% or equal to 33,947 GWh. The number increased by 19.25% from 2018, due to the Priok Combined Cycle Power Plant and Block 4 CPP, as well as a better Merit order for O&M SPP.
Pangsa Pasar Market Share
Perusahaan Company
2017 2018 2019
GWh (%) GWh (%) GWh (%)
PT Indonesia Power* 40.387 22,53 40.151 21,40 37.391 19,22
PT PJB 23.834 13,30 24.825 13,23 22.338 11,48
UB Tanjung Jati B 18.132 10,12 19.529 10,41 20.390 10,48
IPP 46.625 26,01 48.322 25,76 51.553 26,50Unit O&M dikelola oleh IPO&M Units managed by IP 26.335 14,69 28.466 15,17 33.947 17,45
Unit O&M dikelola oleh PJBO&M Units managed by PJB 23.938 13,35 25.932 13,82 28.574 14,69
Proyek Projects - - 379 0,20 346 0,18Sistem Jawa Bali Java Bali System 179.250 100,00 187.605 100,00 194.539 100,00
Pangsa Pasar Energi Listrik Jawa Bali Tahun 2017-2019 [GRI 102-6]Market Share of Java-Bali Electricity in 2017-2019 [GRI 102-6]
* Jumlah pasokan energi listrik Indonesia Power didapat dari penjualan listrik pembangkit milik sendiri dan pembelian tenaga listrik yang tersambung dalam jaringan interkoneksi Jawa-Bali.
* The amount of Indonesia Power’s electricity supply is from the sales of existing power plants and the purchase of power connected to the Java-Bali interconnection network.
67 Sustainability Report 2019
PT Indonesia Power
Com
pany
Profile
Pangsa Pasar Indonesia Power [GRI 102-6]Market Share of Indonesia Power [GRI 102-6]
PT Indonesia Power
PT PJB
UB Tanjung Jati B
IPP
Proyek Project
Unit O&M dikelola oleh IPO&M Units managed by IP
Unit O&M dikelola oleh PJBO&M Units managed by PJB
26,50%
10,48%0,18%
17,45%14,69%
19,22%
11,48%
Rantai Pasokan Perusahaan [GRI 102-9] Company’s Supply Chain [GRI 102-9]
Proses bisnis penyediaan energi listrik terdiri dari tiga bagian, yaitu pembangkitan, transmisi dan distribusi, dimana Indonesia Power berada pada bagian pembangkitan. Tenaga listrik yang diperlukan oleh konsumen akhir dihasilkan oleh pembangkit listrik (pembangkit milik sendiri maupun dari pembangkit milik pihak lain yang dikelola oleh Perusahaan) yang disalurkan melalui sistem penyaluran (transmisi) dan didistribusikan melalui jaringan distribusi oleh PT PLN (Persero) sebagai klien utama Perusahaan.
Indonesia Power memerlukan pemasok (penyedia barang/jasa) dalam menjalankan operasional Perusahaan yaitu pemasok energi primer (batubara, gas, panas bumi) serta pemasok suku cadang yang semuanya disinergikan sehingga energi listrik dapat dibangkitkan dan disalurkan kepada klien.
The business process of supplying electricity consists of three parts: generation, transmission, and distribution. Indonesia Power is in the generation part. The electricity needed by end consumers is generated by power plants (self-owned plants or owned by other parties managed by the Company) that are transmitted through the distribution network by PT PLN (Persero) as the Company’s main client.
Indonesia Power requires suppliers (providers of goods/services) in carrying out the Company’s operations, i.e. suppliers of primary energy (coal, gas, geothermal), and spare parts suppliers. All suppliers are synergized to ensure the electricity can be generated and distributed to the clients.
68 Laporan Keberlanjutan 2019PT Indonesia Power
Profil
Peru
saha
an
Skema Distribusi Tenaga Listrik Kepada PelangganElectricity Distribution Mechanism to Customer
Rantai Pasokan Perusahaan [GRI 102-9]Company’s Supply Chain [GRI 102-9]
Selama tahun 2019, Indonesia Power bekerjasama dengan berbagai kelompok jenis penyedia barang/jasa sebanyak 1.733 penyedia yang terdiri dari penyedia batubara, investasi dan operasi yang berasal dari Indonesia maupun luar negeri yaitu Jepang, Swiss, China, Jerman, Korea, Belanda, USA, Brazil, Australia dan Italia dengan rincian sebagai berikut:
During 2019, Indonesia Power collaborated with various groups of goods/service suppliers, consisting of 1,733 suppliers of coal providers, investment, and operations, originating from Indonesia and abroad, i.e. Japan, Switzerland, China, Germany, Korea, the Netherlands, USA, Brazil, Australia, and Italy, under the following details:
Operator PembangkitPlant Operator
Pembangkit GeotermalGeothermal Power Plant
Pemasok energi PrimerPrimary Energy Supplier
Rekanan Pemasok &KontraktorSupplier & Contractor Partners
Pembangkit TermalThermal Power Plant
Pembangkit HydroHydro Power Plant
69 Sustainability Report 2019
PT Indonesia Power
Com
pany
Profile
No. Jasa PenyediaType of Supplier
Nilai Purchase Order (PO) (Rp Juta)Purchase Order (PO) Value (Rp million)
1 Batubara Coal 10.262.866,47
2 Investasi Investation 7.685.029,10
3 Operasi (exclude Batubara) Operation (exclude Coal) 3.285.608,17
Jumlah Total 21.233.503,74
Rantai Pasokan Indonesia Power Tahun 2019Indonesia Power Supply Chain in 2019
Konsumen AkhirEnd Consumer
Transmisi/DistribusiTransmission/Distribution
70 Laporan Keberlanjutan 2019PT Indonesia Power
Profil
Peru
saha
an
Perubahan Signifikan Tahun 2019 [GRI 102-10]Significant Changes in 2019 [GRI 102-10]
Selama tahun 2019, terdapat beberapa perubahan signifikan yang terjadi pada Perusahaan diantaranya yaitu:1. Perubahan penyebutan unit pembangkit dikarenakan
mengikuti kebijakan PLN sebagai induk perusahaan, dimana penyebutan Unit Pembangkitan (UP) berubah menjadi Power Generation Unit (PGU), Unit Jasa Pembangkitan (UJP) berubah menjadi Operation and Maintenance Services Unit (OMU) dan Unit Pembangkitan dan Jasa Pembangkitan (UPJP) berubah menjadi Power Generation and O&M Services Unit (POMU);
2. Restrukturisasi organisasi dan unit kerja Perusahaan yang ditetapkan dalam Keputusan Direksi Nomor: 57.K/010/IP/2019 Tanggal 28 Mei 2019 tentang Organisasi PT Indonesia Power. Hal ini bertujuan untuk mendukung pencapaian sasaran utama Perusahaan dan penguatan fungsi pengawasan pada pengelolaan energi primer, sebagai tindak lanjut atas arahan RUPS 2018 tentang sinergi PT PLN (Persero) dan Anak Perusahaan melalui kewajiban ratifikasi ketentuan yang berlaku di PT PLN (Persero) serta untuk mendukung program SOLID di lingkungan PLN Group;
3. Perubahan jumlah PGU dari 5 PGU di tahun 2018 menjadi 4 PGU di tahun 2019, perubahan jumlah OMU dari 13 OMU di tahun 2018 menjadi 11 OMU di tahun 2019 dan perubahan jumlah POMU dari 3 POMU di tahun 2018 menjadi 5 POMU di tahun 2019;
4. Perubahan lokasi Kantor Pusat Indonesia Power per 18 Februari 2019;
5. Commercial Operation Date (COD) PLTA Rajamandala dan PLTD Senayan;
6. Pembangunan pembangkit-pembangkit baru di sejumlah wilayah di Tanah Air;
7. Menggunakan energi biofuel (B20) yang mendukung peningkatan porsi EBT pada bauran energi Perusahaan;
8. Pemberlakuan 0283.P/DIR/2016 tentang pemakaian tenaga listrik PT PLN (Persero) untuk penyedia tenaga listrik non
PT PLN (Persero).
During 2019, there were several significant changes to the Company:1. Changes in the designation of generating units to comply
with PLN’s policy as the holding company. The Generating Unit (UP) designation changed into Power Generation Unit (PGU), the Generating Services Unit (UJP) changed into the Operation and Maintenance Services Unit (OMU), and the Generating Unit and Services (UPJP) changed into Power Generation and O&M Services Unit (POMU);
2. Organizational restructuring of the Company and work units, as stipulated in the Board of Directors’ Decree No. 57.K/010/IP/2019 dated 28 May 2019 on the Organization of PT Indonesia Power. The objective is to support the achievement of Company’s main goal and strengthen the supervisory function in primary energy management, as a follow-up to the directives of the 2018 GMS on the synergy of PT PLN (Persero) and Subsidiaries through the obligation to ratify the provisions in force at PT PLN (Persero) and to support the SOLID program within the PLN Group;
3. The total PGUs changed from 5 PGUs in 2018 to 4 PGUs in 2019. The total OMUs changed from 13 OMUs in 2018 to 11 OMUs in 2019. The total POMUs changed from 3 POMUs in 2018 to 5 POMUs in 2019;
4. The Head Office of Indonesia Power changed as of 18 February 2019;
5. Commercial Operation Date (COD) of the Rajamandala HPP and Senayan DPP;
6. Development of new power plants in several areas in the country;
7. Using biofuel energy (B20) which supports the increase in the NRE to the Company’s energy mix;
8. Enactment of 0283.P/DIR/2016 on the use of PT PLN (Persero)’s electricity for non-PT PLN (Persero) electricity providers.
71 Sustainability Report 2019
PT Indonesia Power
Com
pany
Profile
Unit-Unit Indonesia Power [EU1]Units of Indonesia Power [EU1]
No. UnitJumlah UnitNumber of
Units
Kapasitas Terpasang (MW)
Installed Capacity (MW)
Jenis PembangkitType of Power Plant
LokasiLocation
1 Suralaya PGUSuralaya PGU
7 3.400,00 Thermal (Batubara) (Coal)
Cilegon (Banten)
2 Mrica PGUMrica PGU
30 322,14 Hydro Banjarnegara (Jawa Tengah) (Central Java)
3 Semarang PGUSemarang PGU
9 1.238 Thermal (Gas/Minyak) (Gas/Oil)
Semarang (Jawa Tengah) (Central Java)
4 Bali PGUBali PGU
22 610,53 Thermal Gas/Minyak) (Gas/Oil)
Denpasar (Bali)
Power Generation Unit (PGU) Indonesia PowerPower Generation Unit (PGU) Indonesia Power
No. Unit
Existing Jasa O&MO&M Service Unit
LokasiLocation
Jumlah Unit
Number of Units
Kapasitas Terpasang
(MW)Installed Capacity
(MW)
Jenis Pembangkit
Type of Power Plant
Jumlah Unit
Number of Units
Kapasitas Terpasang
(MW)Installed Capacity
(MW)
Jenis Pembangkit
Type of Power Plant
1 Priok POMUPriok POMU
14 1.285,30 Thermal(Gas/Minyak)(Gas/Minyak)
Tanjung Priok (Jakarta)
Priok Blok 3Priok Block 3
3 710 Thermal (Gas)
Tanjung Priok (Jakarta)
Priok Blok 4Priok Block 4
2 600 Thermal (Gas)
Tanjung Priok (Jakarta)
2 Saguling POMU
29 797,36 Hydro Rajamandala – Bandung (Jawa Barat)(West Java)
3 Kamojang POMU
7 377,00 Geothermal Garut (Jawa Barat)(West Java)
Ulumbu 4 10,00 Geothermal Ulumbu (Nusa Tenggara Timur)(East Nusa Tenggara)
4 Grati POMU 8 768,08 Thermal(Gas/Minyak)(Gas/Minyak)
Pasuruan(Jawa Timur)(East Java)
Grati Blok 3 Grati Blok 3
3 501 Thermal (Gas)
Pasuruan (Jawa Timur)(East Java)
5 PLTU Holtekamp POMUPLTU Holtekamp POMU
2 24,00 Thermal (Batubara Coal)
Jayapura (Papua)
Power Generation and O&M Services Unit (POMU) Indonesia PowerPower Generation and O&M Services Unit (POMU) Indonesia Power
72 Laporan Keberlanjutan 2019PT Indonesia Power
Profil
Peru
saha
an
Unit-Unit Indonesia Power [EU1]Unit-Unit Indonesia Power [EU1]
No. UnitJumlah UnitNumber of
Units
Kapasitas Terpasang (MW)
Installed Capacity (MW)
Jenis PembangkitType of Power
Plant
LokasiLocation
1 PLTU Banten 1 Suralaya OMUSPP Banten 1 Suralaya OMU
1 625,00 Thermal (Batubara) (Coal)
Cilegon (Banten)
2 PLTU Banten 2 Labuan OMUSPP Banten 2 Labuan OMU
2 600,00 Thermal (Batubara) (Coal)
Pandeglang (Banten)
3 PLTU Banten 3 Lontar OMUSPP Banten 3 Lontar OMU
3 945,00 Thermal (Batubara) (Coal)
Tangerang (Banten)
4 PLTU Jawa Barat 2 Pelabuhan Ratu OMUSPP Jawa Barat 2 Pelabuhan Ratu OMU
3 1.050,00 Thermal (Batubara) (Coal)
Sukabumi (Jawa Barat)(West Java)
5 PLTU Jawa Tengah 2 Adipala OMUSPP Jawa Tengah 2 Adipala OMU
1 660,00 Thermal (Batubara) (Coal)
Cilacap (Jawa Tengah)(Central Java)
6 PLTU Pangkalan Susu OMUSPP Pangkalan Susu OMU
2 440,00 Thermal (Batubara) (Coal)
Medan (Sumatera Utara)(North Sumatera)
7 PLTGU Cilegon OMUCCPP Cilegon OMU
3 740,00 Thermal (Gas) Cilegon(Banten)
8 PLTU Barru OMUSPP Barru OMU
2 100,00 Thermal (Batubara) (Coal)
Barru (Sulawesi Selatan)(South Sulawesi)
9 PLTU Jeranjang OMUSPP Jeranjang OMU
2 60,00 Thermal (Batubara) (Coal)
Lombok Barat (Nusa Tenggara Barat) (West Nusa Tenggara)
10 PLTU Sanggau OMUSPP Sanggau OMU
2 17,00 Thermal (Batubara) (Coal)
Sanggau (Kalimantan Barat)(West Kalimantan)
11 PLTU Sintang OMUSPP Sintang OMU
3 27,00 Thermal (Batubara) (Coal)
Sintang(Kalimantan Barat)(West Kalimantan)
Operation and Maintenance Services Unit (OMU) Indonesia PowerOperation and Maintenance Services Unit (OMU) Indonesia Power
Pembelian Tenaga Listrik di Pembangkit Area BaliPurchase of Power in Bali Area Generator
Pembangkit Milik Perusahaan di Area Sumatera Self-Owned Plants in Sumatra Areas
PembangkitPower Plant
Kapasitas Terpasang (MW)Installed Capacity (MW)
Jenis PembangkitType of Power Plant
LokasiLocation
Nusa Penida 11,00 Thermal (Minyak) (Oil) Klungkung (Bali)
PembangkitPower Plant
Kapasitas Terpasang (MW)Installed Capacity (MW)
Jenis PembangkitType of Power Plant
LokasiLocation
Keramasan* 20,10 Thermal (Gas) Palembang (Sumatera Selatan)(South Sumatera)
Jambi* 20,10 Thermal (Gas) Batanghari (Jambi)
Indralaya 1 48,80 Thermal (Gas) Palembang (Sumatera Selatan)(South Sumatera)
* Pembangkit Keramasan dan Batanghari di tahun 2019 sudah habis kontrak sehingga status unit pembangkit dikembalikan kembali ke Indonesia Power
* In 2019, Keramasan and Batanghari power plants finished the contracts. The power plants are returned to Indonesia Power
73 Sustainability Report 2019
PT Indonesia Power
Com
pany
Profile
Keanggotaan Asosiasi Indonesia PowerIndonesia Power’s Association Membership
Dalam rangka meningkatkan wawasan, mengembangkan strategi adaptif dengan perkembangan lingkungan bisnis serta memperluas jaringan kemitraan strategis terkait bisnis pembangkitan tenaga listrik, Indonesia Power bergabung dengan berbagai asosiasi di lingkup nasional maupun internasional sebagai berikut:
Indonesia Power joins the national and international associations to enhance insight, develop adaptive strategies with the development of the business environment, and expand strategic partnership networks related to the electricity generation business, as follows:
Keanggotaan Asosiasi [GRI 102-13] Association Membership [GRI 102-13]
Masyarakat Ketenagalistrikan (MKI)The Indonesian Electrical Power Society (MKI)
Forum Komunikasi Satuan Pengawas Intern (FKSPI) Komisariat Bidang Energi dan Sumber Daya MineralCommunication Forum of the Internal Control Committee (FKSPI) Commissariat for Energy and Mineral Resources
Institute of Electrical and Electronic’s Engineers (IEEE)
Danareksa SekuritasDanareksa Sekuritas
Mitra PajakkuMitra Pajakku
Komite Nasional Indonesia untuk Bendungan Besar (KNI-BB)Indonesian National Committee on Large Dams (INACOLD)
Indonesia Gas Association (IGA)Indonesia Gas Association (IGA)
Electric Power ResearchInsitute (EPRI)
Justika Siar MustikaJustika Siar Mustika
Asosiasi Perusahaan PenyediaListrik Nasional (APPELIN)National Electricity ProviderAssociation (APPELIN)
Ikatan Akuntan Indonesia (IAI)Institute of Indonesia Chartered Accountants (IAI)
Majelis Pembimbing Mabisaka Kalpataru (Mabisaka)Supervising Council of Mabisaka Kalpataru (Mabisaka)
The Association of Electricity Supply Industry of East Asia and the Western Pacific (AESIEAP)
Posisi : AnggotaLingkup : Nasional
Posisi : AnggotaLingkup : Nasional
Posisi : AnggotaLingkup : Nasional
Posisi : AnggotaLingkup : Nasional
Posisi : AnggotaLingkup : Nasional
Posisi : AnggotaLingkup : Nasional
Posisi : AnggotaLingkup : Nasional
Posisi : AnggotaLingkup : Nasional
Posisi : AnggotaLingkup : Nasional
Posisi : AnggotaLingkup : Nasional
Posisi : AnggotaLingkup : Nasional
Posisi : AnggotaLingkup : Nasional
Posisi : AnggotaLingkup : Nasional
Position : MemberScope : National
Position : MemberScope : National
Position : MemberScope : National
Position : MemberScope : National
Position : MemberScope : National
Position : MemberScope : National
Position : MemberScope : National
Position : MemberScope : National
Position : MemberScope : National
Position : MemberScope : National
Position : MemberScope : National
Position : MemberScope : National
Position : MemberScope : National
74 Laporan Keberlanjutan 2019PT Indonesia Power
Tata Kelola Keberlanjutan
Sustainability Governance
75 Sustainability Report 2019PT Indonesia Power
Penerapan tata kelola keberlanjutan ditujukan untuk menjamin keberlanjutan bisnis Perusahaan dengan memastikan
kepatuhan terhadap peraturan-peraturan yang berlaku di setiap aspek operasional, menghindari konflik kepentingan dan pelanggaran etika bisnis, kejelasan lingkup pelaporan internal, kejelasan peran, kewenangan dan tanggung jawab dari setiap komponen Perusahaan. Bagi Indonesia Power, penerapan tata kelola yang baik sama pentingnya dengan pencapaian kinerja
bisnis dan operasi.
Sustainability governance is implemented to guarantee the sustainability of the Company’s business by ensuring compliance with prevailing
regulations in every aspect of operations, avoiding conflicts of interest and violations of business ethics, clarifying the scope of internal reporting,
segregation of duties, authorities, and responsibilities of every Company’s component. Indonesia Power considers good governance as important as
achievement of business and operating performance.
76 Laporan Keberlanjutan 2019PT Indonesia Power
Tata
Kel
ola
Kebe
rlanj
utan
Secara garis besar struktur tata kelola Perusahaan tergambarkan pada organ utama Perusahaan yaitu Rapat Umum Pemegang Saham (RUPS), Dewan Komisaris dan Direksi. Struktur tata kelola Perusahaan bertanggung jawab dalam pelaksanaan prinsip-prinsip tata kelola agar dapat berjalan secara efektif dengan peran dan tanggung jawab yang jelas sehingga tercipta mekanisme kontrol check and balance.
RUPS merupakan organ yang mempengaruhi dan mengarahkan jalannya Perusahaan. RUPS memiliki wewenang yang tidak diberikan kepada Dewan Komisaris dan Direksi, dalam batas yang ditentukan dalam Undang-Undang atau Anggaran Dasar. Dalam penyelenggaraannya RUPS Perusahaan terdiri dari RUPS Tahunan dan RUPS Luar Biasa. Dewan Komisaris dan Direksi adalah organ yang bertanggung jawab atas kinerja bisnis dan konteks keberlanjutan Perusahaan.
In general, the structure of the Company’s governance is reflected in the Company’s main organs, i.e. the General Meeting of Shareholders (GMS), the Board of Commissioners, and the Board of Directors. The Company’s governance structure is responsible for implementing the governance principles to run effectively with clear roles and responsibilities in order to create a check and balance control mechanism.
GMS is an organ that influences and directs the Company’s direction. GMS has the rights not granted to the Board of Directors or Board of Commissioners, within the scope stipulated in the Law or Articles of Association. The Company’s GMS consists of the Annual GMS and the Extraordinary GMS. The Board of Commissioners and Directors are the organs responsible for business performance and the sustainability of the Company.
Struktur Tata Kelola Perusahaan Corporate Governance Structure
Struktur Tata Kelola Perusahaan [GRI 102-18, 102-22]Corporate Governance Structure [GRI 102-18, 102-22]
Rapat Umum Pemegang Saham (RUPS)General Meeting of Shareholders (GMS)
Dewan KomisarisBoard of Commissioners
DireksiBoard of Directors
Komite AuditAudit Committee
Department of Internal Audit
Komite Manajemen RisikoRisk Management Committee
Department of Corporate Secretary
Department of Corporate Strategic Planning,
Performance and Risk Management
Check & Balance
Fungsi Komite Nominasi dan Remunerasi
Nomination & Remuneration Committee Function
77 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y G
over
nanc
eBerikut susunan dan komposisi Dewan Komisari dan Direksi periode tahun 2019:
The following is the structure and composition of the Board of Commissioners and the Board of Directors in 2019:
NamaName
JabatanPosition
Jenis KelaminGender
Dasar Hukum Penunjukan Pertama KaliLegal Basis of First Appointment
Periode JabatanTerm of Office
F. X. Sutijastoto Komisaris UtamaPresident
Commissioner
Pria Male
RUPS Sirkuler Pemegang Saham tanggal 23 September 2019Shareholders’ Circular GMS dated 23 September 2019
2019 - 2023
Munir Ahmad KomisarisCommissioner
Pria Male
RUPS Sirkuler Pemegang Saham tanggal 25 Agustus 2016Shareholders’ Circular GMS dated 25 August 2016
2016 - 2020
Tri Setyo Nugroho KomisarisCommissioner
Pria Male
RUPS Sirkuler Pemegang Saham tanggal 25 Agustus 2016Shareholders’ Circular GMS dated 25 August 2016
2016 - 2020
Agus Hernawan KomisarisCommissioner
Pria Male
RUPS Sirkuler Pemegang Saham tanggal 25 Agustus 2016Shareholders’ Circular GMS dated 25 August 2016
2016 - 2020
Ulil Abshar KomisarisCommissioner
Pria Male
RUPS Sirkuler Pemegang Saham tanggal 23 September 2019Shareholders’ Circular GMS dated 23 September 2019
2019 - 2023
NamaName
JabatanPosition
Jenis KelaminGender
Dasar Hukum Penunjukan Pertama KaliLegal Basis of First Appointment
Periode JabatanTerm of Office
M. Ahsin Sidqi PLT Direktur UtamaActing President Director
Pria Male
RUPS Sirkuler Pemegang Saham tanggal 19 Juni 2019Shareholders’ Circular GMS dated 19 June 2019
2019 - 2023
Hanafi Nur Rifai PLT Direktur Operasi IActing Director of
Operations I
Pria Male
RUPS Sirkuler Pemegang Saham tanggal 24 Januari 2018Shareholders’ Circular GMS dated 24 January 2018
2018 - 2022
Bambang Anggono
PLT Direktur Operasi IIActing Director of
Operations II
Pria Male
RUPS Sirkuler Pemegang Saham tanggal 4 Januari 2019 Shareholders’ Circular GMS dated 4 January 2019
2019 - 2023
Susy Liestiowaty PLT Direktur KeuanganActing Director of Finance
Wanita Female
RUPS Sirkuler Pemegang Saham tanggal 10 Januari 2019 Shareholders’ Circular GMS dated 10 January 2019
2019 - 2023
Adi Supriono Direktur Pengembangan dan Niaga
Director of Development and Commerce
Pria Male
RUPS Sirkuler Pemegang Saham tanggal 21 Maret 2016Shareholders’ Circular GMS dated 21 March 2016
2016 - 2020
Okto Rinaldi S PLT Direktur Sumber Daya Manusia dan Administrasi
Acting Director of Human Resources and
Administration
Pria Male
RUPS Sirkuler Pemegang Saham tanggal 24 Januari 2018Shareholders’ Circular GMS dated 24 January 2018
2018 - 2022
Susunan dan Komposisi Dewan Komisaris Periode Tahun 2019 [GRI 102-22]Structure and Composition of the Board of Commissioners in 2019 [GRI 102-22]
Susunan dan Komposisi Direksi Periode Tahun 2019 [GRI 102-22]Structure and Composition of the Board of Directors in 2019 [GRI 102-22]
78 Laporan Keberlanjutan 2019PT Indonesia Power
Tata
Kel
ola
Kebe
rlanj
utan
Struktur Tata Kelola PerusahaanCorporate Governance Structure
KeteranganDescription
2017 2018 2019
Dewan Komisaris
Board of Commi-ssioner
DireksiBoard of Director
KomiteCommi-
tteeTotal
Dewan Komisaris
Board of Commi-ssioner
DireksiBoard of Director
KomiteCommi-
tteeTotal
Dewan Komisaris
Board of Commi-ssioner
DireksiBoard of Director
KomiteCommi-
tteeTotal
Jenis Kelamin Gender
Pria Male 6 5 5 16 6 4 6 16 6 5 6 17
Wanita Female - 1 1 2 - 2 - 2 - 1 - 1
Jumlah Total 6 6 6 18 6 6 6 18 6 6 6 18
Usia Age
< 30 tahun years - - - - - - - - - - - 0
30 – 50 tahun years 2 1 - 3 1 2 2 5 1 - 1 2
> 50 tahun years 4 5 6 15 5 4 4 13 5 6 5 16
Jumlah Total 6 6 6 18 6 6 6 18 6 6 6 18
Komposisi Badan Tata Kelola Perusahaan berdasarkan Jenis Kelamin dan usia [GRI 102-22]Corporate Governance Composition by Gender and Age [GRI 102-22]
Direktur Perusahaan menjalankan dan bertanggung jawab atas pengurusan Perusahaan untuk kepentingan Perusahaan dan sesuai dengan maksud dan tujuan Perusahaan yang telah ditetapkan dalam Anggaran Dasar dan bertindak selaku pimpinan dalam pengurusan tersebut. Direktur Utama merupakan pengambil keputusan tertinggi yang bertanggung jawab terhadap komitmen keberlanjutan Perusahaan. Dalam praktiknya, Direktur Utama dapat mendelegasikan tugasnya kepada Direktur lain berdasarkan aspek keberlanjutan yang terkait yakni aspek ekonomi, sosial dan lingkungan. [GRI 102-18, 102-20, 102-23]
Dalam proses penyempurnaan strategi keberlanjutan Perusahaan, Indonesia Power melakukan serangkaian aktivitas komunikasi dengan pemangku kepentingan untuk dapat memberikan pandangan dan harapannya sebagai bagian dari komitmen terhadap pertumbuhan Perusahaan yang berkelanjutan. Sebagai badan tata kelola tertinggi, salah satu tugas Direksi adalah untuk memperhatikan isu keberlanjutan dalam memformulasikan strategi Perusahaan, menentukan, mengawasi sekaligus memantau pengelolaan faktor-faktor Environmental, Social and Governance (ESG) yang penting bagi Perusahaan. [GRI 102-26]
The Company’s Board of Directors carries out and is responsible for the Company’s management for the interests of the Company, in accordance with the vision and objectives of the Company as stipulated in the Articles of Association, and acts as the leader in such management. The President Director is the highest decision-maker responsible for the Company’s commitments to sustainability. In practice, the President Director may delegate his duties to other Directors based on related aspects of sustainability, i.e. economic, social, and environmental aspects. [GRI 102-18, 102-20, 102-23]
In the process of refining the Company’s sustainability strategy, Indonesia Power carries out a series of communication forum with stakeholders to be able to provide their views and expectations as part of a commitment to the Company’s sustainable growth. As the highest governance body, one of the duties of the Board of Directors is to take into account the sustainability issues in formulating the Company’s strategy, determining, supervising, and monitoring the management of Environmental, Social, and Governance (ESG) factors that are important to the Company. [GRI 102-26]
79 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y G
over
nanc
e
Indonesia Power telah membentuk organ pendukung di bawah Dewan Komisaris dan Direksi untuk mendelegasikan wewenang dan tugas tertentu di samping pelaksanaan tugas utama masing-masing anggota Dewan Komisaris dan Direksi. Struktur organ pendukung tersebut ditinjau dan dievaluasi setiap tahun untuk memastikan efektivitas masing-masing organ. Untuk topik ekonomi, sosial dan lingkungan, Indonesia Power belum memiliki organ khusus yang bertugas untuk mengawasi dan meninjau jalannya kinerja masing-masing topik di Perusahaan. Sementara ini, Indonesia Power membentuk Divisi/Departemen khusus untuk menangani isu-isu yang terkait dengan topik ekonomi, lingkungan dan sosial diantaranya yaitu Direktorat Sumber Daya Manusia dan Administrasi; Division of Health, Safety and Environment; Departemen Bidang Komunikasi yang berada di bawah Corporate Secretariat; dan Section Power Generation Technology and Renewable Energy Research.[GRI 102-19]
Uraian lebih lengkap terkait struktur tata kelola Perusahaan yang mencakup kebijakan pendukung, pedoman dan mekanisme penerapan tata kelola Perusahaan, serta uraian wewenang dan tanggung jawab struktur tata kelola Perusahaan dan organ pendukung lainnya dapat dilihat pada Laporan Tahunan PT Indonesia Power tahun 2019.
Indonesia Power has established supporting organs reporting directly to the Board of Commissioners and Directors to delegate certain authorities and duties, in addition to carrying out the main tasks of each member of the Board of Commissioners and Directors. The structure of the supporting organs is reviewed and evaluated annually to ensure the effectiveness of every organ. Indonesia Power is yet to have a special organ with the responsibility to supervise and review the performance of economic, social, and environmental topics in the Company. Meanwhile, Indonesia Power has established a Division/Department specifically to deal with issues related to economic, environmental, and social topics: the Directorate of Human Resources and Administration; Division of Health, Safety, and Environment; the Communication Department, which is under the Corporate Secretariat; and Section Power Generation Technology and Renewable Energy Research.[GRI 102-19]
A more detailed description regarding the Company’s governance structure that covers the supporting policies, guidelines, and mechanisms for the corporate governance, as well as a description of the authorities and responsibilities of the corporate governance structure and other supporting organs can be referred to in the 2019 Annual Report of PT Indonesia Power.
Pengangkatan dan pemberhentian anggota Dewan Komisaris dan Direksi Perusahaan dilakukan melalui RUPS, serta telah melalui proses fit and proper test sesuai peraturan perundang-undangan yang berlaku dan ketentuan GCG dengan mempertimbangkan aspek keragaman dan tanpa diskriminasi. Anggota Direksi dipilih dan diangkat melalui RUPS, dengan masa jabatan lima tahun. Keahlian dan pengalaman masing-masing calon anggota badan tata kelola yang berkaitan dengan topik ekonomi, lingkungan dan sosial juga menjadi kriteria yang dipertimbangkan. [GRI 102-24]
The GMS appoints and dismisses members of the Company’s Board of Commissioners and Board of Directors, and the selected members have passed the process of fit and proper test in accordance with prevailing laws and regulations and GCG provisions, with due regards to the diversity and free of discrimination. Members of the Board of Directors are selected and appointed through the GMS, with a five years’ tenure. The expertise and experience of each prospective member of the governance body relating to economic, environmental, and social topics are also considered. [GRI 102-24]
Menominasikan dan Memilih Badan Tata Kelola TertinggiNominating and Selecting the Highest Governance Agency
80 Laporan Keberlanjutan 2019PT Indonesia Power
Tata
Kel
ola
Kebe
rlanj
utan
Indonesia Power mengatur ketentuan mengenai benturan kepentingan dengan disusunnya Pedoman Benturan Kepentingan yang disahkan melalui Keputusan Direksi Nomor 166.K/10/IP/2014 tanggal 10 Oktober 2014 tentang Benturan Kepentingan di Lingkungan Perusahaan. Pedoman tersebut mengatur terkait proses penanganan benturan kepentingan yang berpotensi terjadi sehingga dapat ditangani sesuai dengan prinsip-prinsip GCG.
Dewan Komisaris dan Direksi Indonesia Power melaksanakan tugasnya secara independen sesuai dengan peraturan perundang-undangan termasuk menghindari benturan kepentingan dengan pihak manapun. Selama tahun 2019, baik Dewan Komisaris maupun Direksi Indonesia Power tidak memiliki hubungan keluarga dan keuangan dengan sesama anggota Dewan Komisaris, Anggota Direksi dan Pemegang Saham Utama dan/atau Pengendali.
Indonesia Power regulates the provisions regarding conflicts of interest by compiling Conflict of Interest Guidelines that were ratified by the Board of Directors’ Decree No. 166.K/10/IP/2014 dated 10 October 2014 concerning Conflicts of Interest within the Company. The guideline regulates the process of handling conflicts of interest that could potentially occur so that the handling of conflicts is in accordance with GCG principles.
The Board of Commissioners and Board of Directors of Indonesia Power carry out their duties independently, in line with the prevailing regulations, including preventing any conflict of interest. During 2019, both the Board of Commissioners and the Board of Directors of Indonesia Power have no familial and financial relations with fellow members of the Board of Commissioners, members of the Board of Directors, and Major and/or Controlling Shareholders.
Benturan Kepentingan [GRI 102-22, 102-25]Conflict of Interest [GRI 102-22, 102-25]
Struktur Tata Kelola PerusahaanCorporate Governance Structure
Setiap Komisaris Independen menandatangi surat pernyataan tidak mempunyai hubungan afiliasi dengan Perusahaan, anggota Dewan Komisaris, anggota Direksi, atau Pemegang Saham dan tidak mempunyai hubungan usaha baik langsung maupun tidak langsung yang berkaitan dengan kegiatan Perusahaan. Selain itu, untuk menjamin independensi Dewan Komisaris, seluruh anggota Dewan Komisaris Perusahaan telah menandatangani surat pernyataan bebas benturan kepentingan yang menyatakan tidak adanya hubungan afiliasi dengan anggota Direksi maupun anggota Dewan Komisaris lainnya. Pada praktiknya, seluruh Dewan Komisaris Independen Perusahaan telah memenuhi aspek independensi lainnya mencakup kepemilikan saham dan rangkap jabatan.
Setiap anggota Direksi Indonesia Power bertindak secara independen dan tidak bertentangan dengan peraturan perundang-undangan dan Anggaran Dasar Perusahaan. Selama tahun 2019, seluruh anggota Direksi Perusahaan tidak merangkap jabatan yang dilarang oleh peraturan perundang-undangan yang berlaku tentang pelaksanaan GCG. Pernyataan tidak memiliki benturan kepentingan ditandatangani pada awal pengangkatan sebagai Direktur dan diperbaharui setiap awal
Every Independent Commissioner signs a statement of relationship that stated that they do not have any affiliation with the Company, members of the Board of Commissioners, members of the Board of Directors, or Shareholders, and do not have a business relationship directly or indirectly related to the Company’s activities. In addition, the Company’s Board of Commissioners has signed the Declaration of Absence of Conflict of Interest to guarantee the independence of the Board of Commissioners, stating that they have no affiliation with members of the Board of Directors or fellow members of Board of Commissioners. In practice, every Company’s Independent Commissioner has fulfilled the independence aspects, including shareholdings and concurrent positions.
Every member of the Board of Directors of Indonesia Power acts independently and is not in violations of laws and regulations and the Company’s Articles of Association. During 2019, all members of the Company’s Board of Directors do not hold concurrent positions which is prohibited in the prevailing rules on the GCG implementation. The statement of Declaration of Absence of Conflict of Interest shall be signed at the appointment of the Directors, and shall be renewed annually
Independensi Dewan KomisarisIndependence of the Board of Commissioners
Independensi DireksiBoard of Directors’ Independence
81 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y G
over
nanc
e
Untuk mengakomodasi pengembangan dan peningkatan pengetahuan serta kompetensi Dewan Komisaris dan Direksi terkait isu-isu keberlanjutan, Indonesia Power telah memfasilitasi sejumlah pelatihan eksekutif, program pendidikan, pelaksanaan seminar dan konferensi terkait isu-isu keberlanjutan yang selaras dengan perkembangan terbaru dalam industri pada bidangnya masing-masing. Selama tahun 2019, Direksi Perusahaan terlibat dalam program seminar, conference dan workshop terkait tempat olah sampah setempat untuk listrik kerakyatan (permasalahan sampah dan kendala beroperasinya PLTSa di Indonesia) yang dilaksanakan oleh YPK PLN PT Sentra Teknologi Terapan di Kuta Bali dan terkait Renewable Energy Development “Indonesia Renewable Energy Market: Landscape and Opportunities” yang dilaksanakan oleh British Embassy Jakarta di Singapore.
Indonesia Power facilitates several executive training, educational programs, seminars, and conferences, related to sustainability issues that are in line with the latest developments in the industry in the fields of the Board of Commissioners and Directors to accommodate the development and enhancement of the knowledge and competencies of the Board of Commissioners and Directors regarding the sustainability issues. During 2019, the Company’s Board of Directors was involved in seminar, conference, and workshop about local waste management for people’s electricity (issues related to waste and operations of WEPP in Indonesia), held by YPK PLN PT Sentra Teknologi Applied at Kuta, Bali, and about Renewable Energy Development “Indonesia’s Renewable Energy Market: Landscape and Opportunities”, held by the British Embassy Jakarta in Singapore.
Pengembangan Kompetensi Dewan Komisaris dan Direksi [GRI 102-27]Competency Development of the Board of Commissionersand Board of Directors [GRI 102-27]
Transaksi material yang dilakukan dengan pihak yang berafiliasi/berelasi, baik yang dilakukan dengan/tidak dengan persyaratan dan kondisi yang sama sebagaimana dilakukan dengan pihak ketiga, diungkapkan dalam laporan keuangan konsolidasian. Selama tahun 2019, tidak terdapat transaksi yang mengandung benturan kepentingan, sehingga tidak terdapat informasi yang diungkapkan. Informasi lebih lanjut terkait definisi pihak-pihak yang berelasi, sifat hubungan, daftar nama pihak yang berelasi serta tujuan dan nilai transaksi yang dilakukan dengan pihak berelasi periode tahun 2019 dapat dilihat dalam Laporan Tahunan Indonesia Power tahun 2019.
Every transaction carried out by the affiliates/related parties, both within or not within the terms and conditions as those carried out with a third party, shall be disclosed in the consolidated financial statement. Throughout 2019, there is no transaction with conflict of interest, so there is no information to be disclosed. Further information regarding the definition of related parties, the nature of the relationship, list of related parties, and the objective and value of transactions conducted with related parties for the 2019 period can be referred to in the 2019 Annual Report of Indonesia Power.
Transaksi Material yang Berpotensi Mengandung Benturan KepentinganMaterial Transaction with Potential Conflict of Interests
tahun sebagai pernyataan bahwa anggota Direksi maupun keluarganya tidak mempunyai kepemilikan saham maupun menjadi pengurus pada perusahaan maupun kegiatan usaha yang berkaitan baik secara langsung maupun tidak langsung dengan bidang usaha Perusahaan.
Selama tahun 2019, seluruh anggora Direksi Perusahaan tidak memiliki rangkap jabatan di Perusahaan lain dan tidak terdapat anggota Direksi yang memiliki saham Perusahaan mencapai 5% maupun kepemilikan saham pada perusahaan lainnya yang berkedudukan di dalam maupun di luar negeri.
as a statement that the members of the Board of Directors or their families do not have share ownership or become the Company’s management, or have business activities that are related directly or indirectly to the Company’s field of business.
During 2019, all members of the Company’s Board of Directors have no concurrent positions in other companies. There are no members of the Board of Directors who own 5% of the Company’s shares or share ownership in other companies domiciled both domestically and abroad.
82 Laporan Keberlanjutan 2019PT Indonesia Power
Tata
Kel
ola
Kebe
rlanj
utan
Penetapan remunerasi Dewan Komisaris dan Direksi ditetapkan oleh RUPS dengan memperhatikan usulan Dewan Komisaris dengan sebelumnya mendapatkan rekomendasi dari Fungsi Nominasi dan Remunerasi. Rekomendasi Fungsi Nominasi dan Remunerasi tersebut diserahkan kepada Dewan Komisaris dan disampaikan kepada RUPS untuk mendapatkan persetujuan. Keputusan Pemegang Saham menetapkan dasar remunerasi bagi Direktur Utama dan Dewan Komisaris dengan mengacu pada Peraturan Menteri Badan Usaha Milik Negara RI Nomor PER-04/MBU/2014 tentang Pedoman Penetapan Penghasilan Direksi, Dewan Komisaris, dan Dewan Pengawas Badan Usaha Milik Negara tanggal 10 Maret 2014 dan perubahannya Nomor PER-02/MBU/06/2016 tanggal 20 Juni 2016. Indonesia Power saat ini tidak melibatkan konsultan independen terkait penentuan remunerasi Dewan Komisaris dan Direksi.[GRI 102-36, 102-37]
Proses penetapan remunerasi Dewan Komisaris dan Direksi Indonesia Power berdasarkan peraturan yang berlaku dengan mekanisme penetapan sebagai berikut:
Determination of remuneration of the Board of Commissioners and Board of Directors is set forth in the GMS by taking into account the input from the Board of Commissioners, with a prior recommendation from the Nomination and Remuneration Function. The recommendation from the Nomination and Remuneration Function is submitted to the Board of Commissioners and is delivered to the GMS in order to get approval. The Shareholders’ Decree stipulates the basis for remuneration for the President Director and the Board of Commissioners, with reference to the Minister of State-Owned Enterprises Regulation No. PER-04/MBU/2014 on Income Allocation Guidance for the Board of Directors, Board of Commissioners, and Supervisory Agency of the State-Owned Enterprises dated 10 March 2014, and its amendment No. PER-02/MBU/06/2016 dated 20 June 2016. Indonesia Power currently does not involve independent consultants in regards to the determination of remuneration for the Board of Commissioners and Directors. [GRI 102-36, 102-37]
The process of determining the remuneration of the Board of Commissioners and Directors of Indonesia Power is based on prevailing regulations with the mechanism as follows:
Kebijakan Remunerasi Dewan Komisaris dan DireksiRemuneration Policy of the Board of Commissioners and Board of Directors
Struktur Tata Kelola PerusahaanCorporate Governance Structure
Skema Penetapan Remunerasi Dewan Komisaris dan Direksi [GRI 102-36]Determination of the Remuneration of the Board of Commissioners and Board of Directors [GRI 102-36]
1 2 3
Fungsi Nominasi dan RemunerasiNomination and Remuneration
Function
Dewan KomisarisBoard of Commissioners
Rapat Umum Pemegang SahamGeneral Meeting of
Shareholders
- Melakukan kajian- Membuat rekomendasi kepada
Dewan Komisaris- Review- Give recommendation to Board of
Commissioners
- Mempelajari rekomendasi dari Fungsi Nominasi dan Remunerasi
- Mengusulkan kepada RUPS- Review recommendation from
Nomination and Remuneration Function
- Purposed the recommendation to GMS
- Memberikan persetujuan dan menetapkan remunerasi bagi Dewan Komisaris dan Direksi
- Give approval and determine the remuneration for Board of Commissioners and Board of Directors
83 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y G
over
nanc
e
Remunerasi Dewan Komisaris dan Direksi tahun 2019 ditetapkan berdasarkan Keputusan Pemegang Saham secara sirkuler perihal Persetujuan Tantiem Tahun Buku 2018 dan Remunerasi Tahun Buku 2019 bagi Direksi dan Dewan Komisaris, serta Bonus Karyawan Tahun Buku 2018. Besaran remunerasi yang diberikan kepada delapan Anggota Dewan Komisaris sebesar Rp9.979.915.000 yang terdiri dari:
1. Honorarium;2. Tunjangan Hari Raya;3. Tunjangan Transportasi;4. Asuransi Purna Jabatan;5. Fasilitas Kesehatan;6. Bantuan Hukum; dan7. Tantiem.
Remunerasi Direksi Indonesia Power untuk tahun buku 2019 adalah sebesar Rp19.643.075.757 diberikan kepada sembilan anggota Direksi yang terdiri dari:1. Honorarium;2. Tunjangan Hari Raya;3. Tunjangan Perumahan;4. Asuransi Purna Jabtan;5. Fasilitas Kendaraan Dinas;6. Fasilitas Kesehatan;7. Bantuan Hukum; dan8. Tantiem.
Besaran remunerasi Dewan Komisaris dan Direksi yang diberikan akan menyesuaikan dengan capaian kinerja tahun berjalan, skala usaha, inflasi, serta kondisi dan kemampuan Perusahaan. Dalam hal perhitungan honorarium/gaji dengan memperhatikan faktor-faktor yang menyebabkan honorarium lebih rendah dari pada tahun sebelumnya, maka honorarium yang dipakai adalah sama dengan honorarium/gaji tahun sebelumnya. [GRI 102-35]
Pada tahun 2019, rasio antara total kompensasi Direktur Utama dibanding dengan total kompensasi seluruh pegawai (tidak termasuk Direktur Utama) adalah 14:1 (14 kali). Sedangkan rasio kenaikan kompensasi total antara kenaikan kompensasi yang diterima Direktur Utama dengan total kenaikan kompensasi yang diterima oleh pegawai adalah 3:1. [GRI 102-38, 102-39]
In 2019, the remuneration of the Board of Commissioners and Board of Commissioners in 2019 is set forth based on the Circular Decree of Shareholders, on Tantiem Approval for the 2018 Fiscal Year and Remuneration for the 2019 Fiscal Year for the Board of Directors and Board of Commissioners, as well as Employee Bonus for the 2018 Fiscal Year. The amount of remuneration provided to eight Members of the Board of Commissioners is Rp9,979,915,000 consisting of:1. Honorarium;2. Religious Holiday Allowance;3. Transportation Allowance;4. Full-Position Insurance;5. Health Benefits;6. Legal Aid; and7. Tantiem.
The remuneration of the Directors of Indonesia Power for 2019 fiscal year amounted to Rp19,643,075,757, provided to nine members of the Board of Directors, consisting of:1. Honorarium;2. Religious Holiday Allowance;3. Housing Allowances;4. Full-Position Insurance;5. Vehicle Facilities;6. Health Benefits;7. Legal Aid; and8. Tantiem.
The remuneration amount of the Board of Commissioners and Board of Directors granted will be adjusted to the achievements of the current year’s performance, business scale, inflation, as well as the Company’s condition and capability. In calculating the honorarium/salary, if the factors are considered and it causes the honorarium to be lower than the previous year, then the honorarium used is the same with honorarium/salary of the previous year. [GRI 102-35]
In 2019, the ratio between the total compensation of the President Director to the total compensation of all employees (excluding the President Director) was 14 to 1. The ratio of the total compensation raise between the compensation increase received by the President Director and the total compensation increase received by employees is 3 to 1.[GRI 102-38, 102-39]
84 Laporan Keberlanjutan 2019PT Indonesia Power
Tata
Kel
ola
Kebe
rlanj
utan
Struktur Tata Kelola PerusahaanCorporate Governance Structure
Kebijakan mengenai penilaian kinerja Dewan Komisaris dan Direksi mengacu pada Board Manual Perusahaan. Indikator pelaksanaan penilaian kinerja Dewan Komisaris dilakukan berdasarkan pada keberhasilan pelaksanaan tugas dan tanggung jawab pengawasan dan pemberian nasihat oleh Dewan Komisaris kepada Direksi yang disampaikan pada saat RUPS Tahunan, serta berdasarkan Assessment GCG terkait aspek Dewan Komisaris. Penilaian kinerja Direksi didasarkan pada rencana kerja Direksi dan pelaksanaan tugas dan tanggung jawab Direksi yang dituangkan dalam indikator kinerja Direksi (Key Performance Indicators/KPI) dan penilaian GCG Direksi.
Pada tahun 2019, pencapaian KPI Direksi secara kolegial adalah sebesar 90,66 dimana aspek yang mencapai target adalah fokus tenaga kerja dan kepemimpinan, tata kelola dan tanggung jawab kemasyarakatan. Selanjutnya penilaian atas GCG Direksi tahun 2019 mencapai skor 92,74 dengan kualitas penerapan GCG “Sangat Baik”.
The performance assessment of the Board of Commissioners and Directors refers to the Company’s Board Manual. The indicators of the performance assessment of the Board of Commissioners are based on the successful implementation of the duties and responsibilities of supervision and provisions of advice by the Board of Commissioners to the Board of Directors, submitted at the Annual GMS, and based on GCG Assessment related to the Board of Commissioners aspect. The performance assessment of the Board of Directors is based on the work program of the Directors and the implementation of the duties and responsibilities as outlined in the Board of Directors’ Key Performance Indicators (KPI) and the GCG assessment of the Board of Directors.
In 2019, the Board of Directors’ collective achievement of KPI is 90.66, with targeted aspects of employment and leadership, governance, and corporate responsibility. Further, the Board of Directors’ GCG assessment in 2019 scored 92.74 with “Very Good” GCG implementation quality.
Evaluasi atas Kinerja Dewan Komisaris dan Direksi [GRI 102-28]Performance Assessment of the Board of Commissionersand Directors [GRI 102-28]
85 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y G
over
nanc
e
Indonesia Power memiliki prinsip dimana pun Perusahaan beroperasi, kami senantiasa akan menegakkan transparansi dan menjunjung tinggi etika bisnis. Indonesia Power meyakini bahwa hal tersebut akan dapat mempertahankan integritas di mata para pemangku kepentingan dan menjadi wujud tekad kami untuk menjadi Perusahaan yang tepercaya dan tumbuh berkelanjutan di bidang pembangkitan energi.
Dalam rangka penguatan integritas, Indonesia Power memandang perlu adanya penguatan pada standar etika Perusahaan. Standar etika ini mengatur tentang aktivitas bisnis Perusahaan secara etis dengan tujuan untuk mendapatkan keuntungan tanpa melanggar peraturan perundang-undangan maupun kepentingan stakeholders sebagai penjabaran prinsip-prinsip GCG yaitu Transparency, Accountability, Responsibility, Independence, and Fairness (TARIF).
Penerapan standar etik atau kode etik berperan penting sebagi pedoman perilaku yang mengatur hubungan etika kerja antar elemen dan Perusahaan. Pokok-pokok kode etik Indonesia Power secara garis besar memuat lima bagian utama yaitu:1. Pernyataan Visi dan Misi;2. Pentingnya Pedoman Etika Perusahaan;3. Nilai Budaya;4. Petunjuk Pelaksanaan Pedoman Etika Perusahaan; dan
5. Kebijakan Etika Perusahaan.
Indonesia Power berupaya menegakan kode etik dalam bentuk sikap, perbuatan, dan komitmen yang dilakukan dengan penuh kesadaran melalui beberapa kegiatan yaitu:1. Pernyataan Kepatuhan terhadap Pedoman Etika;
2. Pernyataan Bebas Benturan Kepentingan; dan3. Pakta Integritas.
Sosialisasi penerapan kode etik kepada seluruh insan Indonesia Power dilakukan melalui berbagai media komunikasi anatara lain e-mail, website, intranet, visual manajemen dan forum lainnya.
Penegakan Kode Etik Perusahaan, Indonesia Power melakukan pemantauan secara berkala terhadap penegakan dan menyediakan fasilitas bagi pengaduan terhadap pelanggaran Pedoman Etika tersebut. Pegawai dapat melaporkan dugaan pelanggaran atas Pedoman Etika Perusahaan tersebut kepada atasan, Pejabat Yang Berwenang Menindak (PYBM) serta melalui mekanisme Whistle Blowing System (WBS). Seluruh laporan tersebut harus disertai data dan/atau bukti-bukti akurat sehingga pelanggaran dapat diproses lebih lanjut. Setiap pelanggaran atas Pedoman Etika Perusahaan akan dikenakan sanksi sesuai dengan peraturan yang berlaku dan pengenaan sanksi tersebut tidak bersifat diskriminatif. [GRI 102-17]
Indonesia Power upholds a principle of wherever we operate, the Company shall uphold transparency and business ethics. Indonesia Power believes that the principle shall maintain integrity in the stakeholders’ perspective and is a form of our determination to be a trusted and sustainable company in the field of energy generation.
Indonesia Power acknowledges the need to strengthen the Company’s code of conduct to strengthen integrity. Code of Conduct governs the Company’s business activities ethically with the objective to gain profits without violating the laws and regulations and the interests of stakeholders as an elaboration to the GCG principles: Transparency, Accountability, Responsibility, Independence, and Fairness (TARIF).
The implementation of the code of conduct plays an important role as the code that governs the relationship of work ethics between elements and the Company. The main points of Indonesia Power’s code of conduct contain five main sections:1. Statement of Vision and Mission;2. The Importance of the Company’s Code of Conduct;3. Culture Values;4. Guidelines for Implementing the Company’s Code of
Conduct; and5. Company’s Ethics Policy.
Indonesia Power strives to uphold the Code of Conduct in the form of attitudes, actions, and commitments, conducted with full awareness through numerous activities: 1. Statement of Compliance with the Company’s Code of
Conduct;2. Declaration of Absence of Conflict of Interest; and3. Integrity Pact.
The code of conduct is disseminated to all Indonesia Power’s personnel through various communication media, including e-mail, websites, intranets, visual management, and other forums.
Enforcement of the Company’s Code of Conduct. Indonesia Power conducts periodical monitoring of the enforcement and provides facilities for reporting the violations of said Code of Conduct. Employee may report alleged violations of the Company’s Code of Conduct to supervisor, Authorized Officials (PYBM), and Whistleblowing System (WBS) mechanism. Every report must be accompanied by data and/or accurate proof so that the violation may be processed further. Every violation of the Company’s Code of Conduct shall be subject to sanctions in accordance with the prevailing regulations, and the imposition of such sanctions is not discriminatory. [GRI 102-17]
Standar Etika dan Integritas [GRI 102-16] Code of Conduct and Integrity [GRI 102-16]
86 Laporan Keberlanjutan 2019PT Indonesia Power
Tata
Kel
ola
Kebe
rlanj
utan
Standar Etika dan Integritas [GRI 102-16]Code of Conduct and Integrity [GRI 102-16]
Pendekatan Manajemen Topik Anti Korupsi[GRI 103-1, 103-2, 103-3]Management Approach to Anti-Corruption[GRI 103-1, 103-2, 103-3]
Topik Anti Korupsi menjadi topik yang penting karena Indonesia Power meyakini bahwa korupsi tidak hanya bertentangan dengan hukum, namun juga dapat merugikan Perusahaan dan seluruh pemangku kepentingan terkait.
Anti-Corruption is an important topic because Indonesia Power believes that corruption is not only against the law, but also able to harm the Company and all relevant stakeholders.
Program Anti KorupsiAnti-Corruption Program
Kebijakan Perusahaan- Kebijakan Direksi Nomor 161.K/020/IP/2014 tentang
Pedoman Indonesia Power Bersih- Surat Keputusan Direksi Nomor 039.K/010/IP/2018 tentang
Pedoman Pengendalian Gratifikasi- Surat Edaran Direksi Nomor 015.E/012/IP/2018 tentang
Larangan Pemberian dan Penerimaan Gratifikasi- Surat Keputusan Direksi Nomor 235.K/010/IP/2018 tentang
Pedoman Laporan Harta Kekayaan Pejabat di Lingkungan PT Indonesia PowerKetentuan Umum- Undang-Undang Nomor 20 Tahun 2001 tentang Perubahan
atas UU Nomor 31 tahun 1999 tentang Pemberantasan Tindak Pidana Korupsi
Company’s Policies- Board of Directors’ Policy No. 161.K/020/IP/2014 on
Indonesia Power Bersih Guidelines- Board of Directors’ Decree No. 039.K/010/IP/2018 on
Gratification Control Guidelines- Board of Directors’ Decree No. 015.E/012/IP/2018 on
Prohibition of Granting and Accepting Gratuity- Board of Directors’ Decree No. 235.K/010/IP/2018 on
Guidelines on Report of State Official Assets within PT Indonesia Power
General Provisions- Law No. 20 of 2001, on the Amendment to Law No. 31 of
1999 on the Corruption Eradication
KebijakanPolicy
87 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y G
over
nanc
e
Komitmen Bersama Pengendalian Gratifikasi dan Sistem Manajemen Anti Penyuapan (SMAP) pada Rapat Koordinasi Awal Tahun 2019 tanggal 10 Januari 2019.
Joint Commitment to Gratification Control and Anti-Bribery Management System (SMAP) at the Coordination Meeting on 10 January 2019.
Penguatan Infrastruktur untuk comply terhadap ISO 37001 Sistem Manajemen Anti Penyuapan.
Infrastructure Strengthening to comply with ISO 37001 Anti-Bribery Management System.
Persiapan Set Up ISO 37001 memasuki tahap penyiapan dokumen Audit. Audit Sertifikasi akan dilaksanakan pada Awal Tahun 2020.
The preparation to set up ISO 37001 has entered the Audit documents preparation. Certification Audit will be carried out at the beginning of 2020.
- Peluncuran aplikasi IP PRO GCG;- Penandatanganan Komitmen Pengendalian
Gratifikasi secara Digital melalui Aplikasi;- Sosialisasi dan Pelatihan Anti Korupsi dan
Gratifikasi;- Penyusunan Kebijakan Gratifikasi;- Survei Implementasi GCG mengenai Persepsi
Pegawai terhadap Gratifikasi; dan- Set Up ISO 37001 Sistem Manajemen Anti
Penyuapan.
- Launching the IP PRO GCG application;- Signing of Commitment to Digital
Gratification Control through Application;- Anti-Corruption and Gratification
Socialization and Training;- Formulation of Gratuity Policy;- GCG Survey regarding Employees’
Perceptions of Gratuities; and- Setting up ISO 37001 Anti-Bribery
Management System.
- Head of Compliance and Consultation selaku Fungsi Kepatuhan
- Head of Corporate Risk Management selaku Koordinator Risk Assessment
- Head of GCG and Corporate Information selaku Pengelola Kegiatan Kepatuhan GCG
- Head of Compliance and Consultation as Compliance Function
- Head of Corporate Risk Management as the Coordinator of Risk Assessment
- Head of GCG and Corporate Information as Manager of GCG Compliance Activities
- Pelaksanaan kegiatan sosialisasi dan pelatihan anti korupsi; dan
- Pelaporan melalui Whistle Blowing System.
- Implementation of anti-corruption socialization and training; and
- Reporting through the Whistleblowing System.
KomitmenCommitment
RealisasiRealization
Sasaran dan TargetGoals and Targets
EvaluasiEvaluation
Program/InisiatifProgram/Initiative
Penanggung JawabPerson in Charge
88 Laporan Keberlanjutan 2019PT Indonesia Power
Tata
Kel
ola
Kebe
rlanj
utan
Indonesia Power memiliki komitmen tinggi untuk memerangi segala bentuk tindak kejahatan korupsi dan penyalahgunaan wewenang (fraud) sebagai bagian dari komitmen terhadap peningkatan kualitas implementasi prinsip-prinsip GCG terbaik. Indonesia Power telah memiliki kebijakan anti korupsi seperti yang dinyatakan dalam pedoman perilaku dan peraturan Perusahaan.
Secara garis besar, berdasarkan Laporan Manajemen Risiko Perusahaan terkini risiko-risiko utama yang dihadapi Perusahaan terbagi menjadi lima kategori risiko yakni risiko strategis, keuangan, legal, operasional dan proyek. Dari kelima kategori risiko tersebut, yang paling berdampak pada tindak pidana korupsi adalah risiko keuangan dan legal. Untuk itu, Perusahaan memberikan perhatian penuh dan memprioritaskan mitigasi/rekomendasi pengendalian pada risiko-risiko tersebut. Hingga akhir tahun 2019, Indonesia Power belum melakukan assessment untuk mengidentifikasi tahapan operasional yang berisiko terjadinya tindak pidana korupsi. Namun, Perusahaan memberikan perhatian penuh terhadap mekanisme pengelolaan rantai pasokan, yang berpotensi menimbulkan penyimpangan, korupsi dan benturan kepentingan lainnya. [GRI 205-1]
Untuk meningkatkan kesadaran dari setiap pegawai terkait pentingnya menghindari tindak pidana korupsi, Indonesia Power secara berkala melakukan sosialisasi dan pelatihan anti korupsi setiap tahunnya. Media sosialisasi yang digunakan juga menyasar kepada pihak eksternal Perusahaan terutama kepada stakeholder. Berikut media yang digunakan selama tahun 2019:
Indonesia Power is highly committed to fighting against all forms of corruption and abuse of authority (fraud) as part of a commitment to improving the quality of the best GCG principles implementation. Indonesia Power has an anti-corruption policy as stated in the Company’s Code of Conduct and regulations.
Based on the latest Company’s Risk Management Report, the main risks faced by the Company are grouped into five risk categories: strategic, financial, legal, operational, and project risks. From all of the five risk categories, the risk with the most impact on corruption is financial and legal risk. Therefore, the Company focuses its full attention and prioritizes control mitigation/recommendations for said risks. As of the end of 2019, Indonesia Power has not conducted an assessment to identify operational phases with the risk of corruption. However, the Company focuses on the supply chain management mechanism, which has the potential to cause deviations, corruption, and other conflicts of interest. [GRI 205-1]
Indonesia Power annually conducts anti-corruption socialization and training to increase the awareness of every employee on the importance of avoiding corruption acts. The Company also uses socialization media to target the external parties, especially the stakeholders. The following media are used during 2019:
Tanggal PelaksanaanDate
KegiatanActivities
Januari January
Penandatanganan Komitmen Bersama Pengendalian Gratifikasi Direksi dan Senior LeaderSigning of the Joint Commitment of Gratification Control for the Board of Directors and Senior Leaders
April April Deklarasi Implementasi Sistem Manajemen Anti Penyuapan Declaration on the Anti-Bribery Management System Implementation
Maret March
Workshop Gift Register bagi Pengelola GCG seluruh UnitGift Register Workshop for GCG Managers of all Units
Januari – DesemberJanuary – December
Set UP ISO 37001:2016 Sistem Manajemen Anti PenyuapanSet up ISO 37001:2016 Anti-Bribery Management System
November November
Sosialisasi komitmen 3T (Tidak Suap, Tidak Gratifikasi, Tidak Fraud)3T commitment socialization (No Bribery, No Gratuity, No Fraud)
Desember December
Sosialisasi Pengendalian Gratifikasi kepada Mitra KerjaGratification Control Socialization to PartnersPeringatan Hari Anti Korupsi Sedunia (HAKORDIA)World Anti-Corruption Day (HAKORDIA)
Implementasi Praktik Anti Korupsi Tahun 2019Implementing Anti-Corruption Practices in 2019
Standar Etika dan Integritas [GRI 102-16]Code of Conduct and Integrity [GRI 102-16]
89 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y G
over
nanc
e1. Sosialisasi Tatap Muka (Pegawai dan Mitra Kerja) melalui Program Gerakan Tolak Gratifikasi;
2. Publikasi Desktop (Seluruh Pegawai);3. Publikasi website https://supplier.indonesiapower.co.id/
supplier/ (Seluruh Supplier/Mitra Kerja);4. Publikasi Standing Banner & Poster (Pegawai dan Mitra
Kerja);5. Sosialisasi Melalui Email oleh Agen Perubahan (Seluruh
Pegawai Unit Kerja);6. Buletin Mingguan Inpower Weekly News (Seluruh Pegawai);7. Majalah Indonesia Power (Pegawai, Mitra Kerja dan
Stakeholder); dan8. Materi Code of Conduct (CoC) Budaya (Seluruh Pegawai).
1. Face-to-face socialization (Employees and Partners) through the Anti-Gratification Movement Program;
2. Desktop Publication (All Employees);3. Publication on website https://supplier.indonesiapower.
co.id/supplier/ (All Suppliers);4. Publication of Standing Banners & Posters (Employees and
Partners);5. Email by Agent of Change (All Employees’ Work Units);
6. Inpower Weekly News Bulletin (All Employees);7. Indonesia Power Magazine (Employees, Partners, and
Stakeholders); and8. Code of Conduct (CoC) Culture Material (All Employees).
Tidak boleh ada suap-menyuap, sogok-menyogok, pemerasan.Tidak boleh meminta/memberi baik berupa uang, barang/janji yang berhubungan dengan jabatan. There should be no bribery, bribery, extortion. Must not ask/give in the form of money, goods/promises relating to the position.
Tidak boleh menerima/memberi uang, barang, discount, komisi dan fasilitas lainnya yang tidak sesuai ketentuan Perusahaan.May not accept/give money, goods, discounts, commissions and other facilities that are not in accordance with company regulations.
Berupa penyimpanan atas aset yang meliputi penyalahgunaan/pencurian aset atau harta Perusahaan atau pihak lain, pernyataan palsu atau salah pernyataan dan korupsi.In the form of devictions from assets that include misuse/theft of assets or property of companies or other parties, fake statements or false statements and corruption.
NOBRIBERY
NOGRATUITIES
NOFRAUD
Komitmen 3T dalam Mendukung Sistem Manajemen Anti PenyuapanThree Commitment for Anti Bribery Management System
Sosialisasi terkait anti korupsi diberikan kepada pegawai Perusahaan tanpa terkecuali di seluruh jenjang jabatan dan unit Perusahaan. Seluruh anggota badan tata kelola yang terdiri dari anggota Dewan Komisaris dan Direksi yang berjumlah 11 orang dan pegawai yang berjumlah 4.320 orang telah 100% dikomunikasikan mengenai kebijakan dan prosedur anti-korupsi organisasi melalui media internal Perusahaan.[GRI 205-2]
Pelatihan anti-korupsi di Indonesia Power diberikan khususnya kepada pegawai pada bagian tata kelola perusahaan yakni Group of GCG and Corporate Information, Group of Compliance and Consultation dan Group of Corporate Risk Management. Untuk itu, pada tahun 2019 sebanyak 116 insan Indonesia Power di seluruh jenjang jabatan dan unit bisnis Perusahaan termasuk head office telah mengikuti pelatihan anti korupsi.
Anti-corruption is disseminated to the Company’s employees without exception at all Company’s levels and units. The governance body consists of 11 members of the Board of Commissioners and Directors, and 4,320 employees, all of whom have received 100% communication in relation to the organization’s anti-corruption policies and procedures through the Company’s internal media. [GRI 205-2]
Anti-corruption training in Indonesia Power is provided specifically to employees in the corporate governance section, i.e. Group of GCG and Corporate Information, Group of Compliance and Consultation, and Group of Corporate Risk Management. Therefore, in 2019, 116 people of Indonesia Power’s personnel from all Company’s positions and business units, including the head office, attended anti-corruption training.
Publikasi website anti penyuapan kepada seluruh supplier/mitra kerja melalui situs https://supplier.indonesiapower.co.id/supplier/ Publication of anti-bribery website to all suppliers/partners on https://supplier.indonesiapower.co.id/supplier/
90 Laporan Keberlanjutan 2019PT Indonesia Power
Tata
Kel
ola
Kebe
rlanj
utan
Jumlah ini mewakili 2,69% dari total pegawai Perusahaan yang berjumlah 4.320 orang. Berikut ini informasi realisasi pelaksanaan pelatihan anti-korupsi pegawai yang disajikan berdasarkan level jabatan dan unit bisnis.
The number represents 2.69% of the total Company’s employees, which amounted to 4,320 people. The following is information on the realization of employees’ anti-corruption training by position level and business unit.
Jumlah Pegawai yang Mengikuti Pelatihan Anti Korupsi [GRI 205-2]Employees Participating in Anti-Corruption Training [GRI 205-2]
Unit BisnisBusiness Unit
Jumlah PegawaiEmployees
Jumlah Peserta PelatihanJumlah Peserta Pelatihan
% Jumlah Peserta Pelatihan dibandingkan Jumlah Pegawai
% Training Participants to the Number of Employees
Ekse-kutif
Utama Chief
Execu-tive
Ekse-kutif
SeniorSenior Execu-
tive
Ekse-kutif
Execu-tive
Penye-lia
Super-visor
Pelak-sana
Practi-tioner
JumlahTotal
Ekse-kutif
Utama Chief
Execu-tive
Ekse-kutif
SeniorSenior Execu-
tive
Ekse-kutif
Execu-tive
Penye-lia
Super-visor
Pelak-sana
Practi-tioner
JumlahTotal
Ekse-kutif
Utama Chief
Execu-tive
Ekse-kutif
SeniorSenior Execu-
tive
Ekse-kutif
Execu-tive
Penye-lia
Super-visor
Pelak-sana
Practi-tioner
JumlahTotal
Head Office 4 62 153 231 167 617 1 61 5 2 - 69 25,00% 98,39% 3,27% 0,87% - 11,81%
Suralaya PGU 1 3 14 256 423 697 - 3 - 1 - 4 - 100,00% - 0,39% - 0,57%
Priok POMU 1 2 7 119 207 336 - 1 1 1 - 3 - 50,00% 14,29% 0,84% - 0,89%
Saguling POMU - 1 5 84 100 190 - 1 - 1 - 2 - 100,00% - 1,19% - 1,05%
Kamojang POMU - 1 4 92 136 233 - 1 - 1 - 2 - 100,00% - 1,09% - 0,86%
Semarang PGU - 1 5 109 159 274 - 1 - 1 - 2 - 100,00% - 0,92% - 0,73%
Mrica PGU - 1 4 86 70 161 - 1 - 1 - 2 - 100,00% - 1,16% - 1,24%
Grati POMU - 1 5 101 99 206 - 1 - 1 - 2 - 100,00% - 0,99% - 0,97%
Bali PGU - 1 5 106 90 202 - 1 - 1 - 2 - 100,00% - 0,94% - 0,99%
MSU 1 5 24 106 198 334 - 3 - 1 - 4 - 60,00% - 0,94% - 1,20%
PLTU SPP Banten 1 Suralaya OMU - 1 6 59 29 95 - 1 - 1 - 2 - 100,00% - 1,69% - 2,11%
PLTU SPP Banten 2 Labuan OMU - 1 5 76 34 116 - 1 - 1 - 2 - 100,00% - 1,32% - 1,72%
PLTU SPP Banten 3 Lontar OMU - 1 6 92 61 160 - 1 - 1 - 2 - 100,00% - 1,09% - 1,25%
PLTU SPP Jawa Barat 2 Pelabuhan Ratu OMU
- 1 6 90 49 146 - 1 - 1 - 2 - 100,00% - 1,11% - 1,37%
PLTU SPP Jawa Tengah 2 Adipala OMU
- 1 6 66 31 104 - 1 - 1 - 2 - 100,00% - 1,52% - 1,92%
PLTU SPP Pangkalan Susu OMU
- 1 5 74 44 124 - 1 - 1 - 2 - 100,00% - 1,35% - 1,61%
PLTGU CCPP Cilegon OMU - 1 5 54 47 107 - 1 - 1 - 2 - 100,00% - 1,85% - 1,87%
PLTU SPP Barru OMU - - 1 27 30 58 - - - 1 - 1 - - - 3,70% - 1,72%
PLTU SPP Jeranjang OMU - - 1 44 37 82 - - 1 1 - 2 - - 100,00% 2,27% - 2,44%
PLTU SPP Sanggau OMU - - 1 - - 1 - - - 1 - 1 - - 100,00% - - 100,00%
PLTU SPP Sintang OMU - - 1 - - 1 - - - 1 - 1 - - 100,00% - - 100,00%
Holtekamp POMU - - 1 1 - 2 - - 1 1 - 2 - - 100,00% 100,00% - 100,00%
PLTA HPP Orya Genyem OMU - - - - - - - - 1 1 - 2 - - - - - -
Project Unit 1 2 16 18 37 74 - - - 1 - 1 - - - 5,56% - 1,35%
Total 8 87 286 1.891 2.048 4.320 1 81 11 25 - 116 12,50% 93,10% 3,85% 1,32% - 2,69%
Standar Etika dan Integritas [GRI 102-16]Code of Conduct and Integrity [GRI 102-16]
91 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y G
over
nanc
eSelain kepada pihak internal Perusahaan, Indonesia Power juga telah mengkomunikasikan kebijakan anti korupsi tersebut kepada mitra bisnis di masing-masing unit melalui serangkaian kegiatan sosialisasi, email, vendor gathering dan lainnya. Kategori mitra bisnis yang dikomunikasikan dibagi menjadi dua jenis yakni mitra/pemasok nasional dan internasional. Pada tahun 2019, sosialisasi vendor gathering diadakan pada tanggal 5 Desember 2019. Dalam acara ini juga dilakukan penandatanganan komitmen pengendalian gratifikasi dan komitmen sistem manajemen anti penyuapan oleh seluruh vendor yang hadir. Berikut ini informasi realisasi pelaksanaan sosialisasi anti-korupsi untuk mitra Perusahaan.
In addition to the Company’s internal parties, Indonesia Power has communicated the anti-corruption policy to business partners in each unit through a series of outreach activities, emails, vendor gatherings, etc. The business partners are categorized into two types, national and international partners/suppliers. In 2019, vendor gathering socialization was held on 5 December 2019. In this event, all vendors who attended also signed the gratuity control commitment and anti-bribery management system commitment. The following is the realization of anti-corruption information dissemination for the Company’s partners.
Unit BisnisBusiness Unit
Jumlah Mitra/ Pemasok
Number of Partners/Suppliers
Jumlah Mitra/Pemasok yang Telah Diberikan SosialisasiNumber of Partners/
Suppliers That Have Been Given
Socialization
% Jumlah Peserta Sosialisasi dibandingkan Jumlah Mitra/Pemasok
% Participants of Socialization to Number of Partners/Suppliers
Head Office 62 35 56,45%
PLTU SPP Jawa Tengah 2 Adipala OMU 123 21 17,07%
PLTU SPP Banten 2 Labuan OMU 155 40 25,81%
Bali PGU 40 25 62,50%
PLTU SPP Banten 3 Lontar OMU 99 31 31,31%
Suralaya 8 123 26 21,14%
PLTGU CCPP Cilegon OMU 69 17 24,64%
PLTU SPP Jawa Barat 2 Pelabuhan Ratu OMU
183 41 22,40%
Kamojang POMU 98 45 45,92%
Mrica PGU 92 39 42,39%
MSU 148 26 17,57%
PLTU SPP Pangkalan Susu OMU 178 38 21,35%
Suralaya PGU 267 54 20,22%
Semarang PGU 124 36 29,03%
Priok POMU 111 45 40,54%
Saguling POMU 61 46 75,41%
PLTU SPP Barru OMU 52 19 36,54%
Grati POMU 97 46 47,42%
PLTU SPP Jeranjang OMU 51 30 58,82%
Total 2.133 660 30,94%
Jumlah Mitra/Pemasok yang Mengikuti Pelatihan Anti-Korupsi [GRI 205-2]Number of Partners/Suppliers Participating in Anti-Corruption Training [GRI 205-2]
92 Laporan Keberlanjutan 2019PT Indonesia Power
Tata
Kel
ola
Kebe
rlanj
utan
Selama tahun 2019, Indonesia Power tidak menerima pengaduan terkait tindakan korupsi atau pelanggaran yang bersifat fraud yang dilakukan insan Perusahaan. Indonesia Power juga tidak menerima pengaduan tentang korupsi yang masuk melalui whistle blowing system, yang juga diindikasikan dengan tidak ada pemutusan hubungan kerja atau sanksi disiplin karena korupsi, pemutusan kontrak atau tidak diperpanjang dengan mitra bisnis diakhiri karena pelanggaran terkait korupsi maupun pengaduan terkait kasus hukum publik. [GRI 205-3]
During 2019, Indonesia Power did not receive complaints related to acts of corruption or fraud committed by the Company’s personnel. Indonesia Power also did not receive complaints about corruption through the whistleblowing system, which is also indicated by no termination of employment or disciplinary sanctions due to corruption, termination of contracts, or ending contracts with business partners due to corruption-related violations or complaints in regards to public law cases. [GRI 205-3]
Deklarasi Komitmen: Wujudkan Sistem Manajemen AntisuapDeclaration of Commitment: Actualizing Anti-Bribery Management System
Untuk mewujudkan tata kelola perusahaan yang baik dan terbebas dari praktik suap, sejumlah perusahaan telah menerapkan ISO 37001:2016 dalam menjalankan proses bisnisnya. Begitu pun dengan Indonesia Power, yang telah menerapkan Sistem Manajemen Antisuap dengan sertifikasi ISO 37001:2016 sebagai komitmen Perusahaan dalam mencegah segala bentuk praktik suap dan korupsi.
Untuk itu, dalam rangka menguatkan komitmen terhadap penerapan ISO 37001, Indonesia Power membuktikannya melalui penandatanganan Deklarasi Komitmen oleh jajaran Dewan Komisaris dan Dewan Direksi Indonesia Power pada 24 April 2019. Kegiatan yang diselenggarakan di Hotel Bidakara, Jakarta ini disaksikan pula oleh jajaran senior leader dan general manager.
Several companies has implemented ISO 37001:2016 in their business processes to realize good corporate governance and free from bribery. Likewise, Indonesia Power has implemented an Anti-Bribery Management System with ISO 37001:2016 certification as the Company’s commitment to preventing all forms of bribery and corruption.
Therefore, Indonesia Power’s Board of Commissioners and Board of Directors signed the Declaration of Commitment as proof to strengthen the Company’s commitment to implementing ISO 37001. The activity that was held at the Bidakara Hotel, Jakarta, was also witnessed by senior leaders and general managers
Standar Etika dan Integritas [GRI 102-16]Code of Conduct and Integrity [GRI 102-16]
93 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y G
over
nanc
e
Whistle Blowing System (WBS) adalah mekanisme pengelolaan penerimaan dan penyelesaian pengaduan pelanggaran dari pemangku kepentingan (stakeholder) sebagai upaya pengungkapan berbagai pelanggaran yang tidak sesuai dengan standar etika yang berlaku di perusahaan secara rahasia, anonim dan mandiri (independen) yang digunakan untuk mengoptimalkan peran serta Insan Indonesia Power dan mitra kerja dalam mengungkap pelanggaran yang terjadi di lingkungan Perusahaan. Penerapan WBS di Indonesia Power merupakan upaya perusahaan dalam menyediakan sebuah saluran pengaduan yang dapat menjamin efektivitas penyelesaian pengaduan pelanggaran sesuai ketentuan yang berlaku.
Pelaksanaan WBS di lingkungan Perusahaan diatur dalam Keputusan Bersama Direksi dan Dewan Komisaris Nomor 250.K/010/IP/2019 dan Nomor 020.SK/DEKOM-IP/2019 tentang Kebijakan Pengelolaan Pengaduan Pelanggaran (Whistle Blowing System/WBS) Indonesia Power. [GRI 103-2]
Whistle Blowing System (WBS) is a mechanism for managing the receipt and resolution of complaints of violations from stakeholders in order to disclose violations of ethical standards that prevail in the Company, in a confidential, anonymous, and independent manner to optimize the participation of Indonesia Power’s Personnel and business partners in disclosing violations that occur within the Company. The WBS implementation in Indonesia Power is the Company’s effort to provide a reporting channel to guarantee the effectiveness of resolving complaints of violation, in accordance with the prevailing regulations.
The WBS implementation within the Company is regulated in the Joint Decree of the Board of Commissioners and Directors No. 250.K/010/IP/2019 and No. 020.SK/DEKOM-IP/2019 concerning the Indonesia Power Whistleblowing ManagementPolicy. [GRI 103-2]
Whistle Blowing System [GRI 102-33, 103-2, 103-3]Whistle Blowing System [GRI 102-33, 103-2, 103-3]
Websitehttp://www.indonesiapower.co.id
Pesan Singkat/Telepon SMS/phone081 1979 8888
Surat Resmi Letteru.p. Tim Pengelola Pengaduan Pelanggaranu.p. Violation Reporting Management TeamJl. Jend. Gatot SUbroto Kav. 24 & 25Jakarta 12930
Laporkan pelanggaran disiplin Perusahaan melalui:Report the violations of Company’s discipline through:Whistle Blowing
System
94 Laporan Keberlanjutan 2019PT Indonesia Power
Tata
Kel
ola
Kebe
rlanj
utan
Selama tahun 2019, pelaporan yang masuk adalah sebanyak delapan laporan. Dari laporan yang masuk tersebut, seluruhnya telah selesai ditindaklanjuti oleh Perusahaan.
During 2019, there were eight reports received. All of them have been followed-up by the Company.
Mekanisme Penanganan Pengaduan [GRI 102-34, 103-2, 103-3]Complaint Handling Mechanism [GRI 102-34, 103-2, 103-3]
Jumlah Pengaduan dan Status Pengaduan Number and Status of Complaints
TahunYear
Status Pengaduan Status of Complaints
Jumlah PengaduanNumber of Complaints
Tindak Lanjut Follow Up
Dalam ProsesIn Progress
Selesai DitindaklanjutiFinished
2017 10 - 10
2018 11 1 10
2019 12 2 10
Tim Pengelola Pengaduan PelangganViolation Reporting Management Team
Tim InvestigasiInvestigation Team
Hasil InvestigasiInvestigation Result
Fungsi KepatuhanCompliance Function
Direksi & Tim Pengelola Pengaduan Pelanggaran
Board of Directors and Violation Reporting Management Team
Dewan Komisaris & Tim Pengelola Pengaduan Pelanggaran
Board of Commissioners and Violation Reporting Management Team
Dewan Komisaris & Tim Pengelola Pengaduan Pelanggaran
Board of Commissioners and Violation Reporting Management Team
Pemegang SahamShareholders
SelesaiFinished
SelesaiFinished
Proses VerifikasiVerification
InvestigasiInvestigation
Tidak Memenuhi SyaratIneligible
Memenuhi SyaratEligible
Ya Yes
Tidak No
Pelapor Melaporkan Pelanggaran yang Dilakukan
Whistleblower Reports Violations Committed
Terduga Oknum Pegawai
Suspected Employee
Terduga Oknum Anggota Direksi
Suspected Member of the Board of Directors
Terduga Oknum Anggota Organ Pendukung Dewan Komisaris
Suspected Member of the Supporting Organs of the Board
of Commissioners
Terduga Oknum Dewan Komisaris
Suspected Member of the Board of Commissioners
Standar Etika dan Integritas [GRI 102-16]Code of Conduct and Integrity [GRI 102-16]
95 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y G
over
nanc
e
TanggalDate
PelaporWhistleblower
Kategori Laporan PelanggaranViolation Report Category
PenangananHandling
26 Januari 201926 January 2019
Perorangan Individual
Indikasi Pelanggaran Proses Pengadaan Indication of Procurement Process Violations
Dilakukan Klarifikasi dan VerifikasiClarification and Verification
15 Februari 201915 February 2019
Perorangan Individual
Indikasi penyalahgunaan wewenangIndication of abuse of authority
Dilakukan Klarifikasi dan VerifikasiClarification and Verification
15 Februari 201915 February 2019
Perorangan Individual
Masalah PribadiPersonal Problem
Sudah ada penyelesaian dan perdamaian Settlement
1 Maret 20191 March 2019
Perorangan Individual
Indikasi Pelanggaran Aturan Indication of Violation of Rules
Bukan ranah WBS, diarahkan untuk membuat Pelaporan GratifikasiNot within the authority of WBS. The Whistleblower is directed to report it to the Gratification Reporting
17 Maret 201917 March 2019
Perorangan Individual
Indikasi Pelanggaran Aturan Indication of Violation of Rules
Dilakukan Klarifikasi dan VerifikasiClarification and Verification
11 April 201911 April 2019
Perorangan Individual
Indikasi Pelanggaran Proses Pengadaan Indication of Procurement Process Violations
Dilakukan Klarifikasi dan Audit Khusus dan Operasional Clarification and Special and Operational Audits are conducted
25 April 2019 25 April 2019
Perorangan Individual
Indikasi Pelanggaran Proses Pengadaan Indication of Procurement Process Violations
Dilakukan Klarifikasi dan VerifikasiClarification and Verification
3 Agustus 20193 August 2019
Perorangan Individual
Indikasi Pelanggaran Aturan Indication of Violation of Rules
Dilakukan Klarifikasi dan Tindaklanjut Investigasi oleh Direktur Utama Clarification and Follow-Up of Investigations are carried out by the President Director
7 November 2019 7 November 2019
Perorangan Individual
Indikasi Pelanggaran Proses Pengadaan Indication of Procurement Process Violations
Dilakukan Klarifikasi dan VerifikasiClarification and Verification
2 Desember 2019 2 December 2019
Perorangan Individual
Indikasi Pelanggaran EtikaIndication of Violation of Code of Conduct
Dilakukan Klarifikasi dan VerifikasiClarification and Verification
16 Desember 201916 December 2019
Perorangan Individual
Indikasi penyalahgunaan wewenangIndication of abuse of authority
Dilakukan Klarifikasi dan Audit Khusus dan Operasional Clarification and Special and Operational Audits are conducted
Pengaduan WBS dan Penanganannya pada Tahun 2019 [GRI 102-34] WBS Complaints and Handling in 2019 [GRI 102-34]
96 Laporan Keberlanjutan 2019PT Indonesia Power
Tata
Kel
ola
Kebe
rlanj
utan
Manajemen Risiko Keberlanjutan[GRI 102-11, 102-15, 102-30, 102-31] Sustainability Risk Management [GRI 102-11, 102-15, 102-30, 102-31]
Pengelolaan risiko, khususnya risiko sosial dan lingkungan yang berpengaruh pada pencapaian keberlanjutan bisnis, telah dilakukan oleh Perusahaan dengan mengintegrasikannya ke dalam manajemen risiko Perusahan (Enterprise Risk Management/ERM). Hal itu berarti, risiko sosial dan lingkungan telah diintegrasikan ke dalam seluruh aktivitas, fungsi dan proses bisnis Perusahaan.
Dalam mengidentifikasi dan mengelola dampak ekonomi, lingkungan dan sosial, Dewan Komisaris Perusahaan memiliki kewajiban mengawasi dan memberikan nasihat kepada anggota Direksi mengenai efektivitas penerapan manajemen risiko namun memberikan wewenang penuh kepada manajemen untuk mengelola risiko yang ada dalam proses bisnis Perusahaan. Untuk mendapat gambaran yang tepat terkait isu ekonomi, lingkungan dan sosial yang memberikan pengaruh pada bisnis Perusahaan, Dewan Komisaris dan Direksi mendapatkan masukan dari pemangku kepentingan dalam bentuk laporan-laporan berkala. [GRI 102-29]
Proses identifikasi, penilaian dan bentuk pengelolaan risiko sosial dan lingkungan yang efektif merupakan dasar dari pendekatan kami untuk berkontribusi pada pembangunan berkelanjutan. Perusahaan juga telah membuat rencana respon untuk melakukan tindakan mitigasi dan pencegahan untuk mengantisipasi risiko yang mungkin terjadi terkait aspek ekonomi, lingkungan dan sosial. Khusus untuk aspek sosial masyarakat, Perusahaan telah melakukan identifikasi risiko, namun aspek tersebut masuk ke dalam kategori low risk yang tidak menjadi perhatian Perusahaan sehingga tidak terdapat rencana mitigasi yang Perusahaan lakukan. Berikut risiko dan tindakan mitigasi risiko keberlanjutan Perusahaan tahun 2019:
The Company has carried out risk management, particularly social and environmental risks that affect business sustainability, by integrating them into Enterprise Risk Management (ERM). Therefore, social and environmental risks have been integrated into all of the Company’s business activities, functions, and processes.
In identifying and managing economic, environmental, and social impacts, the Company’s Board of Commissioners has the obligation to supervise and provide advice to members of the Board of Directors on the effectiveness of the risk management, but grant full authority to management to manage the risks that exist in the Company’s business processes. The Board of Commissioners and Board of Directors obtained their inputs from stakeholders in the form of periodic reports to have appropriate descriptions related to economic, environmental, and social issues that affect the Company’s business.[GRI 102-29]
The process of identifying, assessing, and managing effective forms of social and environmental risk is the basis of our approach to contribute to sustainable development. The Company has made a response plan to carry out mitigation and prevention measures to anticipate risks that may occur related to economic, environmental, and social aspects. Particularly for the community social aspect, the Company has identified the risks. However, it falls into the low-risk category that is not the Company’s focus. Thus, there is no mitigation plan for the community’s social aspect. The following is the risks and mitigation actions of the Company’s sustainability in 2019:
Upaya Mitigasi terhadap Risiko Keberlanjutan [GRI 102-11] Mitigation to Sustainability Risks [GRI 102-11]
No Jenis RisikoRisk Type
Rencana MitigasiMitigation Measure
1 Terancamnya keberlangsungan usaha PerusahaanThe threat to the Company’s business continuity
Pengembangan pembangkit baru: PLTU, PLTMG, PLTGU, MPP, PLTA dan PLTSNew power plant development: SPP, Gas Engine Power Plant, CCPP, MPP, HPP, and SoPP
2 Penyelesaian pengurusan perijinan terlambatCompletion of licensing is delayed
1. Pendampingan dengan lembaga eksternal yang kompeten di bidang lingkungan
2. Koordinasi dan monitoring rutin dengan stakeholder perizinan1. Assistance with competent external institutions in the environmental
field2. Regular coordination and monitoring with licensing stakeholders
3 Perselisihan harga tanahLand price disputes
Kerjasama dengan pemerintah desa setempatCooperation with the local village government
97 Sustainability Report 2019
PT Indonesia Power
Sust
aina
bilit
y G
over
nanc
e
No Jenis RisikoRisk Type
Rencana MitigasiMitigation Measure
4 Kompetensi SDM perusahaan belum memenuhi standar best practiceThe Company’s HR competencies has yet to meet best practice standards
1. Pelaksanaan program expertise2. Implementasi manajemen talenta melalui talent pool3. Pelaksanaan sertifikasi personil1. Expertise programs2. Talent management through a talent pool3. Personnel certification
5 Kebutuhan Human capital belum memenuhi formasi jabatanHuman capital has yet to meetthe formation of positions
1. Pengembangan IP Academy2. Pelaksanaan Diklat Akselerasi Kompetensi1. IP Academy Development2. Competency Acceleration Training
6 Terjadi kecelakaan kerjaThere was a work accident
1. Implementasi SMK32. Perbaikan dan penggantian peralatan fire fighting1. OHSMS Implementation2. Repair and replacement of firefighting equipment
7 Terjadi tuntutan hukum dari stakeholderLawsuits from stakeholders
1. Pelaksanaan program pengelolaan lingkungan sesuai ISO 14001:2015
2. Sertifikasi peralatan pembangkit3. Penerapan Good Corporate Gorvenance1. Environmental management programs in accordance with ISO
14001:20152. Generator equipment certification3. Good Corporate Governance
Manajemen risiko dilaksanakan di seluruh lini proses dan kegiatan Perusahaan oleh masing-masing pemilik program atau pemilik proses sebagai pemilik risiko (risk owner). Dalam struktur tata kelola Perusahaan, manajemen risiko dilakukan dari tingkat tertinggi badan tata kelola perusahaan, yaitu Komite Manajemen Risiko yang berkedudukan sebagai organ pendukung Dewan Komisaris. Selanjutnya, untuk memastikan efektivitas pengelolaan risiko agar selaras dengan kebijakan dan ketentuan yang berlaku, Perusahaan menugaskan Departemen Corporate Strategic Planning, Performance and Risk Management (SPR) sebagai organ pendukung Direksi.
Kebijakan manajemen risiko Perusahaan dilengkapi dengan Dokumen Manajemen Risiko (DMR) untuk mengatur efektivitas penerapan manajemen risiko pada masing-masing risk owner. DMR berisi berbagai kajian mengenai topik ekonomi, lingkungan dan sosial yakni meliputi Kajian Kelayakan Operasi, Kajian Kelayakan Lingkungan, Kajian Hukum, Kajian Kelayakan Finansial dan Kajian Risiko. Departemen SPR bertugas untuk memberikan coaching, mentoring dan verifikasi atas DMR yang disusun oleh Satuan Kerja, Divisi maupun Unit Perusahaan. Selain itu, Departemen SPR juga melaksanakan berbagai kajian risiko strategis dalam mendukung pengambilan keputusan Direksi dan proses permohonan persetujuan Dewan Komisaris atau RUPS. Dewan Komisaris juga dapat meminta kepada Direksi untuk menyampaikan laporan berkala setiap tahun terkait perkembangan pelaksanaan manajemen risiko. Melalui pendekatan ini, maka seluruh keputusan yang diambil telah berbasis risiko. [GRI 102-30, 102-31]
Risk management is carried out in all lines of the Company’s processes and activities by each program owner or process owner as the risk owner. In the corporate governance structure, risk management is carried out from the highest level of the corporate governance body, i.e. the Risk Management Committee, which is a supporting organ of the Board of Commissioners. Further, the Company assigned the Corporate Strategic Planning, Performance, and Risk Management (SPR) Department as a supporting organ of the Board of Directors, to ensure the effectiveness of risk management in accordance with prevailing policies and regulations.
The Company’s risk management policy is equipped with a Risk Management Document (DMR) to regulate the effectiveness of the risk management of each risk owner. DMR contains various studies on economic, environmental, and social topics, which cover Operational Feasibility Studies, Environmental Feasibility Studies, Legal Analysis, Financial Feasibility Studies, and Analysis. SPR Department has the responsibility to provide coaching, mentoring, and verification of the DMR prepared by the Work Unit, Division, and the Company’s Unit. In addition, the SPR Department conducts various strategic risk analysis to support the decision making of the Board of Directors and the process for requesting approval from the Board of Commissioners or GMS. The Board of Commissioners may request the Board of Directors to submit periodic reports annually concerning the risk management development. With this approach, all decisions made will be risk-based. [GRI 102-30, 102-31]
98 Laporan Keberlanjutan 2019PT Indonesia Power
Meningkatkan KinerjaUsaha, Optimalkan
Kontribusi Bagi NegeriEnhancing Business Performance,
Optimizing Contribution to The State
EKONOMI ECONOMY
99 Sustainability Report 2019PT Indonesia Power
Tahun 2019 Indonesia Power mengukuhkan komitmen untuk mencapai strategi eksekusi Perusahaan melalui berbagai langkah strategis dalam peningkatan kinerja
operasi, keandalan dan efisiensi pengelolaan pembangkit. Hal ini bertujuan untuk mencapai target kinerja usaha
Perusahaan sekaligus menjaga keberlangsungan bisnis Perusahaan untuk senantiasa mengoptimalkan kontribusi
bagi pembangunan ekonomi nasional maupun daerah demi satu tujuan mulia, yakni menerangi negeri kita tercinta.
In 2019, Indonesia Power strengthened its commitment to achieving the Company’s execution strategy through various
strategic steps to enhance the operating performance, reliability, and efficiency of the plant management. The
objective is to achieve the Company’s business performance targets while simultaneously maintain the Company’s business
sustainability to continuously optimize its contribution to national and regional economic development for a noble goal,
to illuminate our beloved country.
100 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Meningkatkan Kinerja Usaha,Optimalkan Kontribusi Bagi NegeriEnhancing Business Performance,Optimizing Contribution to The State
Pendekatan ManajemenTopik Kinerja Ekonomi[GRI 103-1, 103-2, 103-3]Management Approach toEconomic Performance [GRI 103-1, 103-2, 103-3]
Kebijakan Perusahaan- Rencana Jangka Panjang Perusahaan (RJPP)- Rencana Kerja dan Anggaran Perusahaan (RKAP)- Key Performance Indicator (KPI)Ketentuan Umum- Rencana Usaha Penyediaan Tenaga Listrik PT PLN
(Persero) 2019 – 2028
Company’s Policies:- Company’s Long Term Plan (RJPP)- Corporate’s Work Program and Budget (WP&B)- Key Performance Indicator (KPI)General Provisions- 2019-2028 Electricity Supply Business Plan of PT
PLN (Persero)
- Vice President of Accounting and Assurance- Vice President of Treasury and Tax- Vice President of Budgeting- Vice President of Commerce and Customer Relation I- Vice President of Primary Energy and Settlement II- Vice President of Project Management and Pre-Construction
- Vice President of Accounting and Assurance- Vice President of Treasury and Tax- Vice President of Budgeting- Vice President of Commerce and Customer Relation I- Vice President of Primary Energy and Settlement II- Vice President of Project Management and Pre-Construction
Topik Kinerja Ekonomi menjadi topik yang penting bagi Indonesia Power karena berperan untuk mencapai target pembangunan pembangkit listrik nasional 35.000 MW sesuai dengan Rencana Usaha Penyediaan Tenaga Listrik PT PLN (Persero) 2019 – 2028 merupakan komitmen PT Indonesia Power guna menghasilkan kinerja ekonomi yang positif sehingga dapat menjamin keberlangsungan bisnis Perusahaan.
Economic Performance is an important topic for Indonesia Power because it plays a role in achieving the 35,000 MW national power plant development target, in accordance with the 2019-2028 Electricity Supply Business Plan of PT PLN (Persero), which is a commitment of PT Indonesia Power to generating positive economic performance to guarantee the Company’s business sustainability.
KebijakanPolicy
Penanggung JawabPerson in Charge
101 Sustainability Report 2019
PT Indonesia Power
Econ
omy
- Meningkatkan volume produksi energi listrik;
- Menurunkan Biaya Pokok Produksi (BPP) energi listrik;
- Meningkatkan kinerja operasi dan kinerja keuangan; dan
- Menjaga Commercial Operation Date (COD) tepat waktu, biaya dan mutu.
- Increasing the volume of electricity generation;
- Reducing the Electricity Generation Cost (BPP);
- Enhancing operating and financial performance; and
- Maintaining Commercial Operation Date (COD) on time, on cost, and at quality.
- Volume produksi energi listrik 39.154,63 GWh
- Volume penjualan energi listrik 37.338,55 GWh
- Pendapatan usaha Rp49.802.194 juta
- Laba tahun berjalan Rp5.196.267 juta
- The volume of electricity generation is 39,154.63 GWh
- Electricity sales is 37,338.55 GWh
- Operating revenues amounted to Rp49,802,194 million
- Income for the year amounted to Rp5,196,267 million
- Volume produksi energi listrik sebesar 39.112,86 GWh, dengan pencapaian 99,89% dari target RKAP
- Volume penjualan energi listrik sebesar 37.535,45 GWh, dengan pencapaian 100,53% dari target RKAP
- Pendapatan usaha sebesar Rp42.583.849 juta, dengan pencapaian 85,51% dari target RKAP
- Laba tahun berjalan sebesar Rp7.370.309 juta, dengan pencapaian 141,84% dari target RKAP
- The volume of electricity generation is 39,112.86 GWh, achieving 99.89% of the WP&B target
- Electricity sales amounted to 37,535.45 GWh, achieving 100.53% of the WP&B target
- Operating revenues amounted to Rp42,583,849 million, achieving 85.51% of the WP&B target
- Income for the year amounted to Rp7,370,309 million, achieving 141.84% of the WP&B target
- Commercial Operation Date (COD) PLTA Rajamandala dengan kapasitas 47 MW tanggal 12 Mei 2019 dan PLTD Senayan dengan kapasitas 101 MW tanggal 5 Desember 2019;
- Proyek Beroperasi: MPP Merauke 2 dengan kapasitas 20 MW, MPP Sorong dengan kapasitas 20 dan 30 MW serta MPP Biak 2 dengan kapasitas 10 MW; dan
- Pengembangan proyek-proyek pembangkit renewable energy.
- Commercial Operation Date (COD) of the Rajamandala Hydroelectric Power Plant with a capacity of 47 MW on 12 May 2019, and Senayan Diesel Power Plant with a capacity of 101 MW on 5 December 2019;
- Projects Operating: MPP Merauke 2 with a capacity of 20 MW, MPP Sorong with a capacity of 20 MW and 30 MW, and MPP Biak 2 with a capacity of 10 MW; and
- Development of renewable energy power generation projects.
- Melaksanakan monitoring, pencatatan dan analisa sebagai bagian dari evaluasi kinerja keuangan di tahun 2019; dan
- Melaksanakan proyek investasi pengembangan usaha sesuai dengan proses bisnis yang ditetapkan Perusahaan, menjaga keandalan pembangkit dan berkoordinasi aktif dengan pelanggan sebagai bagian dari evaluasi kinerja operasi di tahun 2019.
- Conducting monitoring, recording, and analysis as part of financial performance evaluation in 2019; and
- Conducting business development investment projects in accordance with the business processes established by the Company, maintaining plant reliability and actively coordinating with customers as part of operating performance evaluation in 2019.
KomitmenCommitment
RealisasiRealization
Sasaran dan TargetGoals and Targets
EvaluasiEvaluation
Program/InisiatifProgram/Initiative
102 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Ikhtisar PencapaianKinerja Operasi dan KeuanganOperation and Financial Performance Achievements Highlight
Pada tahun 2019, pencapaian demi pencapaian berhasil dibukukan yang semakin menguatkan keunggulan-keunggulan yang dimiliki Indonesia Power. Dari sisi pengembangan proyek strategis yang meningkatkan kapasitas produksi listrik nasional, Indonesia Power telah menyelesaikan pembangunan pembangkit PLTA Rajamandala hingga pembangkit tersebut beroperasi secara komersial (Commercial Operation Date – COD). Pembangkit yang berlokasi di Cianjur, Jawa Barat ini memiliki kapasitas sebesar 47 MW dan telah siap memasok listrik bagi sistem kelistrikan Jawa-Bali. Kehadiran PLTA Rajamandala sekaligus menjadi wujud komitmen Indonesia Power guna mendukung pencapaian target 23% Energi Baru Terbarukan (EBT) dalam bauran energi nasional pada tahun 2025 mendatang.
Selain PLTA Rajamandala, Indonesia Power di tahun ini juga telah berhasil mengoperasikan secara komersial PLTD Senayan dengan kapasitas 101 MW. Pembangkit ini dibangun untuk meningkatkan keandalan kelistrikan di DKI Jakarta, terutama untuk cadangan (back-up) lapis kedua Moda Raya Terpadu (MRT) tempat-tempat krusial di Jakarta. Selain itu, PLTD ini juga berfungsi sebagai tenaga pemulih sistem kelistrikan (black start power) sistem kelistrikan DKI Jakarta untuk unit pembangkit Muara Karang dan Tanjung Priok saat sistem Jawa-Bali padam total.
Di tahun 2019, juga tercatatkan telah beroperasinya MPP Merauke 2 20 MW, MPP Sorong 20 MW, MPP Sorong 30 MW dan MPP Biak 2 10 MW. Proyek strategis lainnya yang menunjukkan kemajuan positif (tahap konstruksi) adalah PLTM Harjosari 3x3,3 MW, PLTM Gunungwugul 2x1,5 MW, PLTM Lambur 2x4 MW, Add on Grati Blok 2 183 MW, PLTGU Peaker Jawa Bali 1 Tambak Lorok 779 MW, MPP Manokwari 2 20 MW, MPP Nabire 10 MW, MPP Timika 10 MW dan PLTU Kalbar 1 200 MW yang ditargetkan/direncanakan beroperasi pada tahun 2020.
Pada tahun 2019, Indonesia Power juga berhasil merealisasikan kinerja positif dari sisi produksi dan penjualan. Realisasi produksi tenaga listrik pada tahun 2019 sebesar 39.112,86 GWh dengan pencapaian 99,89% dari target Rencana Kerja dan Anggaran Perusahaan (RKAP) yang disebabkan karena adanya variasi musim (pola normal ke kering) yang berpengaruh kepada kinerja PLTA, pengoperasian PLTDG dan PLTG Pesanggaran dioptimalkan 22-25 BBTUD lebih rendah dari rencana 29 BBTUD dan rekonduktoring Balaraja - Lengkong - Gandul (BALEGA) yang berpengaruh pada pencapaian produksi Suralaya. Realisasi penjualan tenaga listrik pada tahun 2019 sebesar 37.535,45 GWh dengan pencapaian 100,53% atau tercapai terhadap target RKAP penjualan tahun 2019.
In 2019, Indonesia Power successfully recorded achievements to further strengthen the Company’s excellence. In terms of developing strategic projects that increase national electricity production capacity, Indonesia Power has completed the construction of the Rajamandala hydropower plant until the plant operates commercially (Commercial Operation Date - COD). The power plant, located in Cianjur, West Java, has a capacity of 47 MW, and is ready to supply electricity for the Java-Bali electricity system. Rajamandala Hydroelectric Power Plant is also a form of Indonesia Power’s commitment to supporting the achievement of the 23% New Renewable Energy (NRE) target in the national energy mix by 2025.
In addition to the Rajamandala Hydroelectric Power Plant, this year, Indonesia Power also succeeded in commercially operating the Senayan DPP with a capacity of 101 MW. Senayan DPP is built to improve the reliability of electricity within DKI Jakarta, especially for the second-tier backup of Mass Rapid Transit (MRT) in crucial sites in Jakarta. In addition, the SPP also functions as a black start power for DKI Jakarta electricity system for the Muara Karang and Tanjung Priok generating units when the Java-Bali system experienced blackout.
In 2019, the MPP Merauke 2 20 MW, MPP Sorong 20 MW, MPP Sorong 30 MW, and MPP Biak 2 10 MW also started operating. Other strategic projects showed positive progress (construction phase), i.e. Harjosari MHPP 3x3.3 MW, Gunungwugul MHPP 2x1.5 MW, Lambur MHPP 2x4 MW, Add on Grati Block 2 183 MW, Peaker Java Bali 1 Tambak Lorok CCPP 779 MW, Manokwari MPP 2 20 MW, Nabire MPP 10 MW, Timika MPP 10 MW, and Kalbar SPP 1,200 MW, which is targeted/planned to start operating in 2020.
In 2019, Indonesia Power also managed to realize positive production and sales performance. In 2019, electricity generation amounted to 39,112.86 GWh, achieving 99.89% of the Corporate’s Work Program and Budget (WP&B) target due to seasonal variations (normal to dry) that affect the performance of HPP, the operation of DGPP and Pesanggaran GPP that were optimized from 22-25 BBTUD, lower than the planned 29 BBTUD, and Balaraja-Lengkong-Gandul (BALEGA) reconductoring, which influences the Suralaya production. The realization of electricity sales in 2019 amounted to 37,535.45 GWh, achieving 100.53% of the WP&B sales target.
103 Sustainability Report 2019
PT Indonesia Power
Econ
omy
Ikhtisar Pencapaian Kinerja OperasiOperational Performance Highlight
Proyek Strategis Pembangunan Pembangkit Listrik NasionalStrategic Project for the National Power Plant Development
- PLTD Senayan dengan kapasitas 101 MW
- Rajamandala Hydropower Plant with a capacity of 47 MW
- Senayan DPP with a capacity of 101 MW
- MPP Merauke 2 dengan kapasitas 20 MW
- MPP Sorong dengan kapasitas 20 dan 30 MW
- MPP Biak 2 dengan kapasitas 10 MW
- Merauke 2 MPP with a capacity of 20 MW
- Sorong MPP with a capacity of 20 and 30 MW
- Biak 2 MPP with a capacity of 10 MW
- PLTM Harjosari dengan kapasitas 3x3,3 MW- PLTM Gunungwugul dengan kapasitas 2x1,5 MW- PLTM Lambur dengan kapasitas 2x4 MW- Add on Grati Blok 2 dengan kapasitas 183 MW- PLTGU Peaker Jawa Bali 1 Tambak Lorok dengan
kapasitas 779 MW- MPP Manokwari 2 dengan kapasitas 20 MW- MPP Nabire dengan kapasitas 10 MW- MPP Timika dengan kapasitas 10 MW- PLTU Kalbar 1 dengan kapasitas 200 MW- Harjosari MHPP with a capacity of 3x3.3 MW- Gunungwugul MHPP with a capacity of 2x1.5 MW- Lambur MHPP with a capacity of 2x4 MW- Add on Grati Block 2 with a capacity of 183 MW- Peaker of Java Bali 1 Tambak Lorok CCPP with a
capacity of 779 MW - Manokwari 2 MPP with a capacity of 20 MW- Nabire MPP with a capacity of 10 MW- Timika MPP with a capacity of 10 MW- Kalbar 1 SPP with a capacity of 200 MW
Proyek Beroperasi Komersial
Projects Operating Commercially
Proyek BeroperasiOperational Projects
Proyek Tahap KonstruksiConstruction Phase Projects
Produksi Energi Listrik Indonesia Power (GWh)Indonesia Power’s Electricity Generation (GWh)
Penjualan Tenaga Listrik Indonesia Power (GWh)Indonesia Power’s Electricity Sales (GWh)
39.1
54,6
3
37.3
38,5
5
39.1
12,8
6
37.5
35,4
5
Target (RKAP) 2019Target (RKAP) 2019
Target (RKAP) 2019Target (RKAP) 2019
RealisasiRealisasi
RealisasiRealisasi
104 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Dari sisi kinerja keuangan, Indonesia Power berhasil mencatatkan laba bersih tahun berjalan sebesar Rp7.370.309 juta dengan pencapaian 141,84% dari target RKAP yang disebabkan karena adanya penurunan komponen energi primer atas kurs dan volume serta tidak terealisasinya skema Asset Management Contract Jeranjang & Barru. Selanjutnya, realisasi pendapatan usaha Indonesia Power tahun 2019 sebesar Rp42.583.849 juta dengan pencapaian 85,51% dari target RKAP yang disebabkan karena adanya penurunan pendapatan energi primer atas kurs dan volume.
In terms of financial performance, Indonesia Power recorded a net Income for the Year amounted to Rp544,755 million, or 141.84% of the target, due to a decrease in the primary energy component on the exchange rate, decrease in volume, as well as the unrealized Jeranjang & Barru Asset Management Contract scheme. Further, in 2019, Indonesia Power realized operating revenues of Rp42,583,849 million, achieving 85.51% of the WP&B target due to a decrease in primary energy income on the exchange rate and volume.
Ikhtisar Pencapaian Kinerja Operasi dan KeuanganOperation and Financial Performance Achievements Highlight
Pendapatan Usaha (Rp Juta)Revenues (Rp million)
Laba Tahun Berjalan (Rp Juta)Income for the Year (Rp million)
49.8
02.1
94
5.19
6.26
7
42.5
83.8
49
7.3
70.3
09
Target (RKAP) 2019Target (RKAP) 2019
Target (RKAP) 2019Target (RKAP) 2019
RealisasiRealisasi
RealisasiRealisasi
Ikhtisar Pencapaian Kinerja KeuanganFinancial Performance Highlight
105 Sustainability Report 2019
PT Indonesia Power
Econ
omy
Sepanjang tahun 2019, Indonesia Power berhasil mencatatkan peningkatan nilai ekonomi langsung yang dihasilkan sebesar 0,62% dari Rp42.971.703 juta di tahun 2018 menjadi Rp43.239.883 juta di tahun 2019. Nilai ekonomi langsung yang dihasilkan ini diperoleh dari pendapatan usaha (pendapatan tenaga listrik, pendapatan konsesi jasa dan pendapatan jasa) dan pendapatan di luar operasional. Sebagian dari pendapatan yang diperoleh, Indonesia Power didistribusikan kepada pemangku kepentingan Perusahaan yakni kepada Pemerintah melalui pembayaran pajak, biaya pegawai dan biaya pemberdayaan masyarakat dengan nilai sebesar Rp34.388.335 juta yang menurun 12,16% dari tahun 2018 yaitu sebesar Rp39.147.619 juta. Hal ini dikarenakan adanya penurunan beban energi primer atas kurs dan volume, efisiensi biaya konsesi jasa, efisiensi biaya penyusutan serta efisiensi biaya pemeliharaan. [GRI 201-1]
During 2019, Indonesia Power recorded an increase in direct economic value generated by 0.62%, from Rp42,971,703 million in 2018 to Rp43,239,883 million in 2019. The direct economic value generated is derived from operating revenues (electricity income, revenue of service concession, and service revenues) and non-operational income. Indonesia Power distributed part of the income earned to the Company’s stakeholders, i.e. the Government through tax payments, employee expenses, and community empowerment expenses of Rp34,388,335 million, which decreased by 12.16% from 2018 of Rp39,147,619 million. This is due to a decrease in the primary energy liabilities on exchange rates and volume, efficiency of service concession costs, depreciation costs, and maintenance costs. [GRI 201-1]
Penciptaan dan Pendistribusian Nilai EkonomiCreation and Distribution of Economic Values
106 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Penciptaan dan Pendistribusian Nilai EkonomiCreation and Distribution of Economic Values
DeskripsiEconomic Value
Jumlah (Rp Juta)Amount (IDR million)
Jumlah (Rp Juta)Amount (IDR million)
2017 2018 2019Kantor PusatHead Office
PGUPGU
OMUOMU Total Kantor Pusat
Head OfficePGUPGU
OMUOMU Total Kantor Pusat
Head OfficePGUPGU
OMUOMU Total
Nilai Ekonomi Langsung yang DihasilkanEconomic Value GeneratedPendapatan UsahaRevenuesPendapatan Tenaga ListrikSales of Electricity 145.907 20.828.273 - 20.974.180 - 23.781.264 - 23.781.264 - 23.970.771 - 23.970.771
Pendapatan dari Konsesi JasaRevenue of Service Concession 980.054 14.612.698 - 15.592.752 534.371 14.757.643 - 15.292.014 232.464 14.628.268 - 14.860.732
Pendapatan JasaService Revenues 100.392 37.450 2.731.643 2.869.486 314.539 49.805 3.600.677 3.965.021 320.162 9.915 3.422.269 3.752.345
Pendapatan Di Luar OperasionalNon-Operational IncomePenghasilan KeuanganFinancial Income 229.055 1 0 229.056 269.195 1 - 269.196 164.426 1 843 165.270
Keuntungan Kurs Mata Uang Asing - BersihGain on Foreign Exchange - Net (2.367) (2.225) 7.673 3.081 (29.594) (32.044) (499) (62.136) (10.037) 19.844 334 10.141
Lain-lainOthers 133.722 - - 133.722 (273.656) - - (273.656) 91.855 336.009 52.759 480.623
Jumlah Nilai Ekonomi Langsung yang DihasilkanTotal Economic Value Generated 1.586.762 35.476.198 2.739.317 39.802.277 814.855 38.556.669 3.600.178 42.971.703 798.869 38.964.809 3.476.205 43.239.883
Nilai Ekonomi yang DidistribusikanEconomic Value DistributedBeban Usaha*Operating Expenses * 1.136.577 29.316.987 2.342.354 32.795.920 707.936 31.840.756 3.051.574 35.600.265 328.948 29.388.945 1.117.913 30.835.805
Biaya KepegawaianPersonnel Expenses 741.107 1.184.504 348.415 2.274.026 693.509 958.240 524.418 2.176.167 846.762 927.431 573.190 2.347.383
Beban KeuanganFinancial Cost 791.520 210.404 - 1.001.924 49.331 13.118 - 62.449 1.156 2.214 - 3.370
Pengeluaran untuk Pemerintah (Pajak, Retribusi, dan lain-lain)Expenses to Government (Taxes, Levies, etc.) 903.472 - - 903.472 1.271.239 - - 1.271.239 1.159.376 - - 1.159.376
Pengeluaran untuk MasyarakatExpenses to Community 7.170 17.502 3.712 28.384 13.713 19.283 4.504 37.499 13.916 23.051 5.433 42.401
Jumlah Nilai Ekonomi yang DidistribusikanTotal Economic Value Distributed 3.579.847 30.729.398 2.694.481 37.003.726 2.735.728 32.831.397 3.580.495 39.147.619 2.350.158 30.341.641 1.696.536 34.388.335
Nilai Ekonomi yang DitahanRetained Economic ValueJumlah Nilai Ekonomi yang Ditahan Total Economic Retained (1.993.084) 4.746.799 44.836 2.798.552 (1.920.872) 5.725.273 19.683 3.824.083 (1.551.289) 8.623.167 1.779.669 8.851.547
Nilai Ekonomi Indonesia Power [GRI 201-1]Indonesia Power’s Economic Value [GRI 201-1]
* Beban Usaha di luar Beban Kepegawaian Operating Expenses excluding Personnel Expenses
107 Sustainability Report 2019
PT Indonesia Power
Econ
omy
DeskripsiEconomic Value
Jumlah (Rp Juta)Amount (IDR million)
Jumlah (Rp Juta)Amount (IDR million)
2017 2018 2019Kantor PusatHead Office
PGUPGU
OMUOMU Total Kantor Pusat
Head OfficePGUPGU
OMUOMU Total Kantor Pusat
Head OfficePGUPGU
OMUOMU Total
Nilai Ekonomi Langsung yang DihasilkanEconomic Value GeneratedPendapatan UsahaRevenuesPendapatan Tenaga ListrikSales of Electricity 145.907 20.828.273 - 20.974.180 - 23.781.264 - 23.781.264 - 23.970.771 - 23.970.771
Pendapatan dari Konsesi JasaRevenue of Service Concession 980.054 14.612.698 - 15.592.752 534.371 14.757.643 - 15.292.014 232.464 14.628.268 - 14.860.732
Pendapatan JasaService Revenues 100.392 37.450 2.731.643 2.869.486 314.539 49.805 3.600.677 3.965.021 320.162 9.915 3.422.269 3.752.345
Pendapatan Di Luar OperasionalNon-Operational IncomePenghasilan KeuanganFinancial Income 229.055 1 0 229.056 269.195 1 - 269.196 164.426 1 843 165.270
Keuntungan Kurs Mata Uang Asing - BersihGain on Foreign Exchange - Net (2.367) (2.225) 7.673 3.081 (29.594) (32.044) (499) (62.136) (10.037) 19.844 334 10.141
Lain-lainOthers 133.722 - - 133.722 (273.656) - - (273.656) 91.855 336.009 52.759 480.623
Jumlah Nilai Ekonomi Langsung yang DihasilkanTotal Economic Value Generated 1.586.762 35.476.198 2.739.317 39.802.277 814.855 38.556.669 3.600.178 42.971.703 798.869 38.964.809 3.476.205 43.239.883
Nilai Ekonomi yang DidistribusikanEconomic Value DistributedBeban Usaha*Operating Expenses * 1.136.577 29.316.987 2.342.354 32.795.920 707.936 31.840.756 3.051.574 35.600.265 328.948 29.388.945 1.117.913 30.835.805
Biaya KepegawaianPersonnel Expenses 741.107 1.184.504 348.415 2.274.026 693.509 958.240 524.418 2.176.167 846.762 927.431 573.190 2.347.383
Beban KeuanganFinancial Cost 791.520 210.404 - 1.001.924 49.331 13.118 - 62.449 1.156 2.214 - 3.370
Pengeluaran untuk Pemerintah (Pajak, Retribusi, dan lain-lain)Expenses to Government (Taxes, Levies, etc.) 903.472 - - 903.472 1.271.239 - - 1.271.239 1.159.376 - - 1.159.376
Pengeluaran untuk MasyarakatExpenses to Community 7.170 17.502 3.712 28.384 13.713 19.283 4.504 37.499 13.916 23.051 5.433 42.401
Jumlah Nilai Ekonomi yang DidistribusikanTotal Economic Value Distributed 3.579.847 30.729.398 2.694.481 37.003.726 2.735.728 32.831.397 3.580.495 39.147.619 2.350.158 30.341.641 1.696.536 34.388.335
Nilai Ekonomi yang DitahanRetained Economic ValueJumlah Nilai Ekonomi yang Ditahan Total Economic Retained (1.993.084) 4.746.799 44.836 2.798.552 (1.920.872) 5.725.273 19.683 3.824.083 (1.551.289) 8.623.167 1.779.669 8.851.547
108 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Sebagai bagian dari kontribusi Indonesia Power bagi negeri untuk pembiayaan negara dan pembangunan nasional, pada tahun 2019 Indonesia Power melakukan pembayaran pajak kepada negara sebesar Rp1.159.376 juta, lebih rendah 8,80% dari tahun 2018 yaitu sebesar Rp1.271.239 juta. Hal dikarenakan adanya penurunan pembelian barang impor di tahun 2019.
Pada tahun 2019, Indonesia Power mendapatkan bantuan finansial dari Pemerintah dalam bentuk subsidi Pemeriksaan Subsidi Listrik TA 2019 BPK Berita Acara Biaya Pokok Penyediaan Tenaga Listrik Per Unsur pada PT Indonesia Power Indeks B.3.c sebesar Rp34.111.274 juta dan mendapatkan fasilitas pembebasan nilai pajak karena Surat Keterangan Bebas (SKB) sebesar Rp700.565 juta. [GRI 201-4]
In 2019, Indonesia Power paid taxes to the state amounted to Rp1,159,376 million, which decreased by 8.80% compared to 2018, which was Rp1,271,239 million, as Indonesia Power’s contribution to the country for state financing and national development. This is due to a decrease in purchases of imported goods in 2019.
In 2019, Indonesia Power received financial assistance from the Government in the form of Electricity Subsidy Audit for the Fiscal Year 2019 from BPK, Minutes of Electricity Generation Cost by Element within PT Indonesia Power Index B.3.c amounted to Rp34,111,274 million, and obtained Notice of Tax Exemption (SKB) of Rp700,565 million. [GRI 201-4]
Kontribusi PajakContribution to Tax
Penciptaan dan Pendistribusian Nilai EkonomiCreation and Distribution of Economic Values
Jenis PajakType of Tax 2017 2018 2019
PPN Pungut Collected VAT 613.801 864.583 845.121
PPN Impor PPN Import 28.081 108.735 60.216
Bea Masuk Import Duty 58.947 107.238 23.661
PPH 21 Income Tax 21 165.501 166.218 191.631
Pajak Badan Corporate Income Tax - - -
PBB, Materai dan Retribusi Land and Building Tax, Stamp Duty and Retribution 37.142 24.464 38.747
Total Pajak Total Tax 903.472 1.271.239 1.159.376
Kontribusi Pajak Indonesia Power kepada Negara (Rp Juta) [GRI 201-1]Indonesia Power’s Tax Contribution to the State (Rp Million) [GRI 201 -1]
109 Sustainability Report 2019
PT Indonesia Power
Econ
omy
110 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Pengelolaan Dampak Ekonomi Tidak LangsungManagement of Indirect Economic Impact
Pendekatan Manajemen Topik Pengelolaan Dampak Ekonomi Tidak Langsung[GRI 103-1, 103-2, 103-3]Management Approach to Managing Indirect Economic Impact[GRI 103-1, 103-2, 103-3]
Kebijakan Perusahaan- Keputusan Direksi Nomor 25.K/010/IP/2015 tentang Pedoman
Tanggung Jawab Sosial dan Lingkungan Perusahaan tanggal 11 Februari 2015
- Keputusan Direksi Nomor 26.K/010/IP/2014 tentang Pedoman Pelaksanaan InPower CARE di Lingkungan PT Indonesia Power tanggal 11 Februari 2014
- Keputusan Direksi Nomor 51.K/010/IP/2014 tentang Pedoman Penilaian Kinerja Unit Bisnis untuk Kriteria Penilaian Pelaksanaan Community Development
- Keputusan Direksi No No 180.K/010/IP/2018 tentang Komitmen Community Development melalui Program Inspirasi Perempuan, tanggal 22 November 2018
- Keputusan Direksi 56.K/010/IP/2019 tentang Pengelolaan Program Unggulan Community Development di Lingkungan PT Indonesia Power, tanggal 28 Mei 2019
- Keputusan Direksi Nomor 218.K/010/IP/2016 tentang Pedoman Pengadaan Barang/Jasa PT Indonesia Power Bab VIII Pendayagunaan Produk dalam Negeri
Ketentuan Umum- Peraturan Pemerintah Nomor 47 Tahun 2012 tentang Tanggung
Jawab Sosial dan Lingkungan Perseroan Terbatas- Peraturan Menteri Tenaga Kerja Dan Transmigrasi Republik Indonesia
Nomor 19 Tahun 2012 Tentang Syarat-Syarat Penyerahan Sebagian Pelaksanaan Pekerjaan Kepada Perusahaan Lain
- Peraturan Menteri Perindustrian Republik Indonesia Nomor 54/M-IND/PER/3/2012 tentang Pedoman Penggunaan Produk Dalam Negeri Untuk Pembangunan Infrastruktur Ketenagalistrikan
Company’s Policies:- Board of Directors’ Decree No. 25.K/010/IP/2015 on Guidelines
on Corporate Social and Environmental Responsibilities dated 11 February 2015
- Board of Directors’ Decree No. 26.K/010/IP/2014 on Guidelines on the Implementation of InPower CARE within PT Indonesia Power dated 11 February 2014
- Board of Directors’ Decree No. 51.K/010/IP/2014 on Guidelines on Business Unit Performance Assessment for Community Development Criteria Assessment
- Board of Directors’ Decree No. 180.K/010/IP/2018 on the Community Development Commitments through the Women’s Inspiration Program, dated 22 November 2018
- Board of Directors’ Decree No. 56.K/010/IP/2019 on Community Development Flagship Program Management within PT Indonesia Power, dated 28 May 2019
- Board of Directors’ Decree No. 218.K/010/IP/2016 on Guidelines for Procurement of Goods/Services of PT Indonesia Power Chapter VIII Domestic Product Utilization
General Provisions- Government Regulation No. 47 of 2012 on the Corporate Social and
Environmental Responsibility of Limited Liability Company- Regulation of the Minister of Manpower and Transmigration of the
Republic of Indonesia No. 19 of 2012 on the Requirements for Assigning Partial Work to Other Companies
- Regulation of the Minister of Industry of the Republic of Indonesia No. 54/M-IND/PER/3/2012 on the Guidelines for Utilizing Domestic Products for Electricity Infrastructure Development
Topik Pengelolaan Dampak Ekonomi Tidak Langsung menjadi topik yang penting bagi Indonesia Power karena Indonesia Power meyakini kehadiran Perusahaan senantiasa menciptakan manfaat bagi pemangku kepentingan karena telah memberikan perubahan perekonomian yang berpengaruh pada kondisi sosial ekonomi masyarakat yakni meningkatnya kesejahteraan masyarakat sekitar wilayah operasi Perusahaan maupun pemangku kepentingan lainnya.
Indirect Economic Impact Management is an important topic for Indonesia Power because Indonesia Power believes that the Company’s presence creates benefits for stakeholders as it has provided economic changes that affect the community’s socio-economic conditions, i.e. by improving the community welfare surrounding the Company’s operational areas and other stakeholders.
KebijakanPolicy
111 Sustainability Report 2019
PT Indonesia Power
Econ
omy
- Melaksanakan target program pembangunan infrastruktur pembangkit tenaga listrik dan pembangunan infrastruktur bagi masyarakat sekitar;
- Meningkatkan efektivitas program pelibatan dan pengembangan komunitas untuk mendukung pencapaian kemandirian masyarakat;
- Meningkatkan pendapatan dan peluang usaha masyarakat; dan
- Mengembangkan pendayagunaan produksi dalam negeri untuk kebutuhan yang masuk kategori leverage dan critical.
- Implementing target program for the construction of electricity power plant and infrastructure development for the surrounding community;
- Increasing the effectiveness of community engagement and development programs to support the realization of community independence;
- Improving community income and business opportunities; and
- Enhancing the use of domestic production for requirement that falls under the leverage and critical categories.
- Pelaksanaan pembangunan infrastruktur yang bersifat komersial sesuai dengan RJPP Perusahaan dan RUPTL PT PLN (Persero) serta pembangunan infrastruktur yang bersifat bantuan di wilayah Ring I yang berpotensi terkena dampak kegiatan operasi Perusahaan;
- Merumuskan kegiatan dan program Community Involvement Development (CID); dan
- Blanket contract dengan manufaktur dari dalam negeri.
- Implementation of commercial infrastructure development in accordance with the Company’s RJPP and RUPTL of PT PLN (Persero), and construction of infrastructure assistance in the Ring I area that could potentially be affected by the Company’s operations;
- Formulating Community Involvement Development (CID) activities and programs; and
- Blanket contract with domestic manufacturers.
- Terselesaikannya pengembangan pembangkit PLTA Rajamandala dan PLTD Senayan hingga pembangkit tersebut beroperasi komersial (Commercial Operation Date – COD) serta terlaksananya pembangunan infrastruktur di wilayah Ring I dan Ring II (beyond compliance);
- Terlaksananya kegiatan dan program Community Involvement Development (CID); dan
- Blanket contract dengan beberapa manufaktur Inlet Air Filter, Chemical dan manufaktur Belt Conveyor produksi dalam negeri.
- Completion of the development of the Rajamandala Hydropower Plant and the Senayan DPP until both plants operate commercially (Commercial Operation Date - COD), as well as the implementation of infrastructure development within Ring I and Ring II (beyond compliance);
- Community Involvement Development (CID) activities and programs implementation; and
- Blanket contract with several Inlet Air Filter, Chemical, and Belt Conveyor domestic manufacturers.
- Pelaksanaan program pembangunan infrastruktur nasional dan daerah yang bersifat komersial maupun bantuan;
- Program Community Involvement Development (CID);- Sourcing atas kemungkinan material, spare part atau
equipment yang dapat disuplai dari dalam negeri;- Sosialiasi bisnis dan potensi market kepada penyedia
barang/jasa dalam negeri; dan- Proses tender dan negosiasi terhadap penyedia
barang/jasa dalam negeri.
- Implementing national and regional infrastructure development programs in the nature of commercial and assistance;
- Community Involvement Development (CID) Program;- Sourcing material, spare parts, or equipment that can
be supplied domestically;- Business socialization and market potential to
domestic goods/service providers; and- Tender and negotiation process for domestic goods/
service providers.
- Kepala Departemen Bidang Komunikasi yang berada di bawah Corporate Secretariat
- Vice President of Budgeting- Vice President of Project Management
and Pre-Construction- Vice President of Primary Energy and
Business Development dan Spare Parts and Services Procurement
- Head of the Department of Communication, who reports directly to the Corporate Secretariat
- Vice President of Budgeting- Vice President of Project Management
and Pre-Construction- Vice President of Primary Energy and
Business Development dan Spare Parts and Services Procurement
- Melaksanakan Study Indeks Kepuasan Masyarakat, Social Return on Investment serta Spend dan Market Analysis sebagai bagian dari evaluasi pengelolaan dampak ekonomi tidak langsung di tahun 2019.
- Conducting a Community Satisfaction Index Study, Social Return on Investment, and Spend and Market Analysis, as part of the evaluation of indirect economic impact management in 2019.
KomitmenCommitment
RealisasiRealization
Sasaran dan TargetGoals and Targets
EvaluasiEvaluation
Program/InisiatifProgram/Initiative
Penanggung JawabPerson in Charge
112 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Dampak ekonomi tidak langsung merupakan perubahan perekonomian yang berpengaruh pada kesejahteraan masyarakat maupun pemangku kepentingan lainnya akibat dari berlangsungnya operasi Perusahaan. Selain memperhatikan aspek/dampak finansial dalam melaksanakan setiap pekerjaan/proyek, Indonesia Power juga senantiasa memastikan bahwa kehadiran Perusahaan dapat menciptakan manfaat yang berdampak positif bagi kondisi sosial ekonomi masyarakat sekitar maupun pemangku kepentingan lainnya. Hal ini diwujudkan antara lain melalui pembangunan infrastruktur yang merata, peningkatan keterampilan dan penciptaan peluang usaha masyarakat sekitar, penyerapan tenaga kerja lokal dan adanya pelibatan penyedia lokal.
Sejalan dengan program prioritas Pemerintah yaitu Proyek Strategis Nasional (PSN) yang salah satunya bertujuan untuk mendorong percepatan dan pemerataan pembangunan infrastruktur serta meningkatkan akses ketenagalistrikan, Indonesia Power turut berkontribusi untuk menyediakan pasokan listrik nasional. Pada tahun 2019, Indonesia Power menyelesaikan pembangunan pembangkit yang merata sehingga dapat meningkatkan rasio elektrifikasi listrik untuk warga di daerah Tertinggal, Terdepan dan Terluar (3T). Selain itu, Indonesia Power juga melakukan pembangunan infrastruktur yang bersifat bantuan untuk menunjang sarana dan prasarana umum bagi masyarakat sekitar.
In line with the Government’s priority program, i.e. the National Strategic Projects (PSN), with one of the objectives to encourage the acceleration and equitable infrastructure development, and improve electricity access, Indonesia Power contributes to providing national electricity supply. In 2019, Indonesia Power completed the construction of equitable power plants to increase the electrification ratio for residents in the Underdeveloped, Frontier, and Outermost Areas (3T). In addition, Indonesia Power develops infrastructure in the form of assistance to support the public facilities and infrastructure for the surrounding community.
Indirect economic impact is the economic changes that affect the community’s welfare and other stakeholders’ welfare due to the Company’s ongoing operation. In addition to taking into account the financial aspects/impacts in carrying out every work/project, Indonesia Power ensures that the Company’s existence shall create positive benefits for the socio-economic conditions of the surrounding community and other stakeholders. This is actualized, among others, through equitable infrastructure development, skills improvement, and creation of business opportunities in the surrounding community, absorption of local labor, and the involvement of local providers.
Pengelolaan Dampak Ekonomi Tidak LangsungManagement of Indirect Economic Impact
Pembangunan Infrastruktur yang Merata [GRI 203-1]Equitable Infrastructure Development [GRI 203-1]
No. ProgramProgram
Wilayah OperasiOperational Area
DampakImpact
Nilai Investasi (Rp Juta)Value of
Investment(Rp million)
SifatType
1 PLTA Rajamandala kapasitas 47 MWRajamandala Hydropower Plant with a capacity of 47 MW
Cianjur, Jawa BaratCianjur, West Java
- Mendorong pembangunan infrastruktur nasional- Memperkuat sistem interkoneksi kelistrikan Jawa
– Bali- Encouraging national infrastructure development - Boosting the Java-Bali electricity interconnection
line
USD 163.119.069
KomersialCommercial
2 PLTD Senayan kapasitas 101 MWSenayan DPP with a capacity of 101 MW
Jakarta Selatan, DKI JakartaSouth Jakarta, Special Capital Region of Jakarta (DKI Jakarta)
- Mendorong pembangunan infrastruktur nasional- Meningkatkan keandalan kelistrikan di DKI
Jakarta, terutama untuk cadangan lapis kedua Moda Raya Terpadu (MRT)
- Encouraging national infrastructure development- Improving the electricity reliability of DKI Jakarta,
especially for Mass Rapid Transit (MRT) second tier’s reserve
1.015.540 KomersialCommercial
Pembangunan Infrastruktur Indonesia Power Tahun 2019 [GRI 203-1]Indonesia Power’s Infrastructure Development in 2019 [GRI 203-1]
113 Sustainability Report 2019
PT Indonesia Power
Econ
omyNo. Program
ProgramWilayah OperasiOperational Area
DampakImpact
Nilai Investasi (Rp Juta)Value of
Investment(Rp million)
SifatType
3 MPP Merauke 2 kapasitas 20 MWMerauke 2 MPP with a capacity of 20 MW
Sorong, Papua BaratSorong, West Papua
- Mendorong pembangunan infrastruktur nasional- Memenuhi kebutuhan listrik di Indonesia Timur- Encouraging national infrastructure development- Fulfilling the electricity needs in Eastern
Indonesia
378.362 KomersialCommercial
4 MPP Sorong kapasitas 50 MWSorong MPP with a capacity of 50 MW
Merauke, PapuaMerauke, Papua
- Mendorong pembangunan infrastruktur nasional- Memenuhi kebutuhan listrik di Indonesia Timur- Encouraging national infrastructure development- Fulfilling the electricity needs in Eastern
Indonesia
882.305 KomersialCommercial
5 MPP Biak 2 kapasitas 10 MWBiak 2 MPP with a capacity of 10 MW
Yendidori, Biak NumforYendidori, Biak Numfor
- Mendorong pembangunan infrastruktur nasional- Meningkatkan rasio elektrifikasi listrik untuk
warga di daerah Tertinggal, Terdepan dan Terluar (3T)
- Encouraging national infrastructure development- Increasing electrification ratio for residents in
Underdeveloped, Frontier, and Outermost areas (3T)
219.777 KomersialCommercial
6 Pengadaan pompa, instalasi listrik dan drainaseProcurement of pumps, electricity and drainage installation
Semarang PGUSemarang PGU
- Antisipasi dampak banjir- Mitigation to the flood effects
14.197 KomersialCommercial
7 Pembangunan dan perbaikan sarana sanitasiConstruction and repair of sanitation facilities
Adiapala OMU, Houtekamp OMU, Mrica PGU Adiapala OMU, Houtekamp OMU, Mrica PGU
- Mendorong pembangunan infrastruktur nasional- Meningkatkan kualitas kesehatan masyarakat - Encouraging national infrastructure development- Improving the community’s health quality
114.548 BantuanAssistance
8 Renovasi rumah menjadi layak huniHouse renovation to be livable decent housing
Saguling POMU, Mrica PGU, Kamojang POMU, Pangkalan Susu OMUSSaguling POMU, Mrica PGU, Kamojang POMU, Pangkalan Susu OMU
- Mendorong pembangunan infrastruktur nasional- Meningkatkan keswadayaan dalam peningkatan
kualitas rumah - Encouraging national infrastructure development- Improving self-sufficiency in improving the
house’s quality
138.740 BantuanAssistance
9 Pembangunan dan renovasi sarana ibadahConstruction and repair of worship facilities
21 Unit PT Indonesia Power21 Units of PT Indonesia Power
- Mendorong pembangunan infrastruktur nasional- Meningkatkan kualitas sarana keagamaan - Encouraging national infrastructure development- Improving the quality of religious facilities
562.769 BantuanAssistance
10 Pembangunan dan renovasi sarana pendidikanConstruction and repair of education facilities
21 Unit PT Indonesia Power21 Units of PT Indonesia Power
- Mendorong pembangunan infrastruktur nasional- Meningkatkan kualitas sarana keagamaan- Encouraging national infrastructure development- Improving the quality of religious facilities
675.230 BantuanAssistance
114 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Dalam rangka mewujudkan salah satu misi CSR Perusahaan yakni meningkatkan kualitas hidup masyarakat, kehadiran Indonesia Power juga memberikan dampak ekonomi tidak langsung melalui program-program pemberdayaan masyarakat yang dapat meningkatkan keterampilan dan menciptakan peluang usaha bagi masyarakat sekitar.
In order to realize one of the Company’s CSR missions to improve the quality of life of the community, Indonesia Power’s existence shall have an indirect economic impact through community empowerment programs that can enhance skills and create business opportunities for the surrounding community.
Pengelolaan Dampak Ekonomi Tidak LangsungManagement of Indirect Economic Impact
Peningkatan Keterampilan dan PenciptaanPeluang Usaha Masyarakat SekitarEnhancing Skills and Creating Business Opportunitiesin the Surrounding Communities
No. ProgramProgram
Hasil dan PerkembanganResult and Development
1 Omah KretegSalah satu Program pemberdayaan perempuan yang memproduksi sambal khas Suralaya di PLTU SuralayaOmah KretegOne of the women’s empowerment Programs that produce unique Suralaya chili sauce at Suralaya SPP
- Kelompok Anggana dapat mengolah bawang dan cabai sebanyak 100 kg/bulan dalam memproduksi sambal kreteg
- Total omzet kelompok penjualan produk sambal kreteg: Rp38juta/tahun
- Anggana Group can process onions and chili of approximately 100 kg/month to produce sambal kreteg (kreteg chili)
- Total turnover of the sambal kreteg sales group: Rp38 million/year
2 Taman Hatinya SunterProgram pengembangan kawasan hijau di wilayah perkotaan di DKI Jakarta Priok POMU berupa pembuatan produk UKM: minuman herbal, roti buaya, snack box, sayuran organic, bank sampah dan pupuk komposSunter’s Heart Park (Taman Hatinya Sunter):The Park is Priok POMU’s green area development program in urban areas at DKI Jakarta in the form of SME product manufacture: herbal drinks, crocodile bread, snack boxes, organic vegetables, waste banks, and compost fertilizer
- Total omzet kelompok selama tahun 2019: Rp40 juta- Total turnover of the group in 2019: Rp40 million
3 Olahan Ikan Situ Bagendit “Laux Leutix”Pemberdayaan masyarakat di sekitar Situ Bagendit, mengolah baby ikan nila menjadi makanan ringan: Nila Anom, Nila Bedah, Rarong dan Ikan ImpunProcessed Situ Bagendit Fish “Laux Leutix”Community empowerment around Situ Bagendit, processing baby tilapia into snacks: Anom Tilapia, Clean Surgery Tilapia, Rarong, and Impun Fish
- Rata-rata jumlah produksi produk: 290 bungkus/bulan atau 3.475 bungkus produk per tahun 2019
- Total omzet kelompok selama tahun 2019: Rp74,64 juta- Average number of productions: 290 packs/month or
3,475 packs as of 2019- Total turnover of the group in 2019: Rp74.64 million
4 Kerajian Bambu BambarayProgram pemberdayaan masyakarat dengan membuat kerajinan dari bambooBambaray Bamboo CraftCommunity empowerment program by making handicrafts from bamboo
- Rata-rata jumlah produksi produk: 1.000 pcs produk/bulan- Total omzet kelompok selama tahun 2019: Rp100 juta- Average number of productions: 1,000 pcs of product/
month- Total turnover of the group in 2019: Rp100 million
Program Peningkatan Keterampilan dan Penciptaan Peluang Usaha Masyarakat Sekitar Tahun 2019 [GRI 203-2]Skill Improvement Program and Business Opportunities Creation Program for the SurroundingCommunities in 2019 [GRI 203-2]
115 Sustainability Report 2019
PT Indonesia Power
Econ
omy
No. ProgramProgram
Hasil dan PerkembanganResult and Development
5 Batik Alam Malon & Zie BatikKelompok batik dengan pewarna alami di Kampung Alam MalonAlam Malon Batik & Zie BatikGroup that produces batik with natural dyes in Alam Malon Village
Kelompok Kampung Alam Malon:- Rata-rata jumlah produksi batik tulis: 30 lembar/bulan- Total omzet kelompok selama tahun 2019: Rp30 jutaKelompok Batik Zie:- Rata-rata jumlah produksi batik dalam sebulan: batik cetak
300 lembar, batik tulis 55 lembar, batik print malam 200 lembar dan Ecoprint 20
- Total omzet kelompok selama tahun 2019: Rp500 jutaAlam Malon Village Group:- The average amount of batik production: 30 sheets/month- Total turnover of the group in 2019: Rp30 millionZie Batik Group:- The average amount of batik production in a month: 300
pieces of printed batik, 55 pieces of written batik, 200 pieces of night printed batik, and 20 Ecoprints
- Total turnover of the group in 2019: Rp500 million6 Rumah Abon Ikan Marlin
Program pemberdayaan berbasis Inspirasi Perempuan di Pelabuhan Ratu OMU, memanfaatkan potensi hasil tangkapan ikan laut dari nelayan sekitar PembangkitMarlin Fish Floss HouseThe Women’s Inspiration-based empowerment program at Pelabuhan Ratu OMU that utilizes the fish caught by the fishermen surrounding the Power Plant
- Rata-rata jumlah produksi abon: 140 pcs/minggu- Total omzet kelompok selama tahun 2019: Rp120 juta- Average floss production: 140 pcs/week- Total turnover of the group in 2019: Rp120 million
7 Program Desa Kopi Konservasi “Tanaman Kopi Anti Erosi”Program peningkatan keterampilan bagi petani kopi arabika dan keterampilan bagi barista di Desa Pegundungan, Mrica PGU.“Anti-Erosion Coffee Plant” Coffee Conservation Village Program Skills improvement program for Arabica coffee farmers and training for baristas in Pegundungan Village, Mrica PGU.
- Jumlah produksi kopi: 10 ton/tahun- Total omzet kelompok selama tahun 2019: Rp739 juta- Rata-rata pendapatan warga selama tahun 2019: Rp1,8
juta- Total coffee production: 10 tons/year- Total turnover of the group in 2019: Rp739 million- Average income for residents in 2019: Rp1.8 million
8 Sale SimaduMemanfaatkan buah lokal/tradisional, khususnya buah pisang menjadi beragam aneka varian makanan, seperti sale goreng, sale mentah dan sale coklat dengan berbagai topping.Sale SimaduUtilizing local/traditional fruits, especially sale bananas into various snacks, such as fried bananas, raw bananas, and chocolate bananas with various toppings.
- Rata-rata jumlah penjualan sale simadu dalam sebulan: 50-80 toples dan 70 pcs kemasan plastik
- Total omzet kelompok selama tahun 2019: Rp5-6 juta- Average sales of Simadu sale bananas in a month: 50-80
jars and 70 pcs packs- Total turnover of the group in 2019: Rp5-6 million
9 Koperasi Motekar Bersama (Kemosa)Suatu kelompok mitra binaan Saguling POMU yang memberdayakan perempuan khususnya ibu rumah tangga. Koperasi ini bergerak di bidang kerajinan seperti membuat kertas dari pelepah pisang, anyaman bambu dan memproduksi makanan kerupuk dari daun singkong/pepaya, bandrek mengkudu, minuman serba obat, tape ketan instan dan lain-lain.Motekar Bersama Cooperative (Kemosa)A partner group established by Saguling POMU that empowers women, especially the housewives. This cooperative is engaged in handicrafts such as making paper from banana fronds and woven bamboo, and producing food crackers from cassava/papaya leaves, bandrek noni, medicinal drinks, instant sticky tape, etc.
- Rata-rata jumlah penjualan sale simadu dalam sebulan: 40 toples tape, 100 bungkus kerupuk daun singkong, 25 pcs bandrek mengkudu dan 10 pcs kerajinan pelepah pohon pisang
- Total omzet kelompok selama tahun 2019: Rp20,55 juta- Average sales of Simadu sale bananas in a month: 40 jars
of tape, 100 packs of cassava leaf crackers, 25 pcs of bandrek noni, and 10 pcs banana tree fronds crafts
- Total turnover of the group in 2019: Rp20.55 million
116 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Indonesia Power melalui Anak Perusahaan yaitu PT Cogindo DayaBersama telah memberikan kontribusi bagi pertumbuhan ekonomi daerah melalui penyerapan tenaga kerja lokal yaitu masyarakat di sekitar unit Perusahaan. Pada tahun 2019, Perusahaan melakukan rekrutmen tenaga kerja lokal sebanyak 1.281 orang untuk mengisi posisi dari mulai operator hingga manajer unit.
Indonesia Power, through its subsidiary, PT Cogindo DayaBersama, contributed to the regional economy growth by absorbing the local workforce, i.e. community around the Company’s units. In 2019, the Company recruited 1,281 local workers to fill various positions. from operators to unit managers.
Pengelolaan Dampak Ekonomi Tidak LangsungManagement of Indirect Economic Impact
Penyerapan Tenaga Kerja Lokal [GRI 202-2, 203-2]Local Labor Absorption [GRI 202-2, 203-2]
Unit
Jumlah Rekrutmen per Level JabatanTotal Recruitment by Position
OperatorOperator
TeknisiTechnician
StafStaff
SupervisorSupervisor
Manajer UnitUnit Manager
JumlahTotal
Suralaya PGU Suralaya PGU 88 25 13 - - 126
Semarang PGU Semarang PGU 34 - - - - 34
Priok POMU Priok POMU 37 5 2 - - 44
Kamojang POMU Kamojang POMU 31 1 3 - - 35
Grati POMU Grati POMU 51 28 8 - - 87PLTDG Pesanggaran 200MWDGPP Pesanggaran 200MW - 19 1 - - 20
PLTU Banten 1 Suralaya OMUSPP Banten 1 Suralaya OMU 61 20 28 - - 109
PLTU Banten 2 Labuan OMUSPP Banten 2 Labuan OMU 96 33 28 1 - 158
PLTU Banten 3 Lontar OMUSPP Banten 3 Lontar OMU 177 68 35 - 1 281
PLTU Jawa Tengah 2 Adipala OMUSPP Central Java 2 Adipala OMU 79 24 34 - - 137
PLTU Jawa Barat 2 Pelabuhan Ratu OMUSPP West Java 2 Pelabuhan Ratu OMU 134 47 38 - - 219
PLTGU Cilegon OMUCCPP Cilegon OMU 8 10 14 - - 32
PLTU Pangkalan Susu OMUSPP Pangkalan Susu OMU 94 31 36 - - 161
PLTU Jeranjang OMUSPP Jeranjang OMU 82 17 16 - - 115
PLTU Barru OMUSPP Barru OMU 80 41 27 - - 148
PLTU Sanggau OMUSPP Sanggau OMU 69 16 6 8 - 99
PLTU Sintang OMUSPP Sintang OMU 70 10 5 - - 85
Jumlah Rekrutmen Tenaga Kerja Lokal Number of Local Manpower Recruitment
117 Sustainability Report 2019
PT Indonesia Power
Econ
omy
Dalam pemberian remunerasi kepada tenaga kerja lokal, Perusahaan memberikan upah di atas ketentuan/standar Upah Minimum Kabupaten/Kota (UMK) daerah setempat. Selain itu, tenaga kerja lokal juga mendapatkan benefit dan fasilitas yang terdiri dari Kompensasi Lembur, Uang Pelepasan, Tunjangan Hari Tua, Jaminan Kesehatan, Tunjangan Kecelakaan Kerja, Pendidikan Formal, Pelatihan, Bantuan Pemakaman dan Dukacita, Bantuan Bencana Alam, Family Gathering, Pakaian Kerja/OR, Kendaraan Operasional, Perjalanan Dinas, Rumah Jabatan, Alat Penunjang, Alat Komunikasi (khusus untuk Supervisor dan Manajer Unit) serta Fasilitas Sewa Rumah dan Kendaraan Dinas (khusus Manajer Unit).
The Company provides wages above the standard of local Regency/City Minimum Wage (UMK) to local employees. In addition, local employees have benefits and facilities consisting of Overtime Compensation, End-of-Contract Money, Pension Benefits, Health Insurance, Work Accident Benefits, Formal Education, Training, Funeral and Grief Support, Natural Disaster Assistance, Family Gathering, Work Clothes/OR, Operational Vehicles, Business Trip, Housing, Supporting Tools, Communication Tools (specifically for Supervisors and Unit Managers), as well as House and Vehicle Rental Facilities (specifically Unit Managers).
Unit
Jumlah Rekrutmen per Level JabatanTotal Recruitment by Position
OperatorOperator
TeknisiTechnician
StafStaff
SupervisorSupervisor
Manajer UnitUnit Manager
JumlahTotal
PLTU Berau OMUSPP Berau OMU 49 11 4 - - 64
Holtekamp POMUHoltekamp POMU 59 15 11 - - 85
PLTU Ulumbu Ulumbu SPP 42 6 9 5 - 62
MPP Manokwari Manokwari MPP 4 1 1 - - 6
MPP Merauke Merauke MPP 10 2 1 1 - 14
MPP Nias Nias MPP 2 1 - - - 3
PLTD Senayan Senayan DPP 5 - - - - 5
MPP Nabire Nabire MPP 4 1 2 - - 7
MPP Biak Biak MPP 4 1 2 - - 7
BOT Bali BOT Bali 6 - - - - 6
Sorong Sorong 19 4 2 1 - 26
Jumlah Total 820 238 208 15 1 1.281
118 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Pengelolaan Dampak Ekonomi Tidak LangsungManagement of Indirect Economic Impact
Berdasarkan Peraturan Menteri Perindustrian Republik Indonesia Nomor 54/M-IND/PER/3/2012 tentang Pedoman Penggunaan Produk Dalam Negeri untuk Pembangunan Infrastruktur Ketenagalistrikan, telah ditetapkan Tingkat Komponen Dalam Negeri (TKDN) barang/jasa yang harus dipatuhi dalam proses pengadaan Indonesia Power. Untuk itu, Indonesia Power berkomitmen untuk senantiasa melibatkan penyedia lokal yaitu penyedia dalam negeri yang didirikan berdasarkan hukum negara Indonesia untuk bekerjasama dengan Perusahaan dalam mendukung pelaksanaan kegiatan pembangunan infrastruktur ketenagalistrikan nasional. Komitmen ini telah tercantum dalam Keputusan Direksi Nomor 218.K/010/IP/2016 tentang Pedoman Pengadaan Barang/Jasa PT Indonesia Power Bab VIII Pendayagunaan Produk dalam Negeri.
Pada tahun 2019, Indonesia Power bekerja sama dengan 1.733 Penyedia Nasional (98,90% dari total Penyedia) dengan nilai pengadaan Penyedia Nasional sebesar Rp19.084.065,85 juta (89,88% dari total nilai pengadaan). Jumlah dan Nilai Pengadaan Penyedia Nasional tahun ini mengalami peningkatan dari tahun 2018 yang semakin menunjukkan aksi nyata Indonesia Power dalam menggerakkan perekonomian perusahaan-perusahaan dalam negeri.
Based on the Regulation of the Minister of Industry of the Republic of Indonesia No. 54/M-IND/PER/3/2012 on the Guidelines for Utilizing Domestic Products for Electricity Infrastructure Development, the Domestic Component Level (DCL) of goods/services shall be complied with during the procurement process of Indonesia Power. Therefore, Indonesia Power is committed to involving local suppliers, the domestic providers established under Indonesian law, to work with the Company to support the implementation of national electricity infrastructure development activities. This commitment is set forth in the Board of Directors’ Decree No. 218.K/010/IP/2016 on Guidelines for Procurement of Goods/Services of PT Indonesia Power Chapter VIII Domestic Product Utilization.
In 2019, Indonesia Power cooperated with 1,733 National Suppliers (98.90% of the total Suppliers), with procurement value of Rp19,084,065.85 million (89.88% of the total procurement value). The Number and Procurement Value of National Suppliers increased compared to 2018, which reflects Indonesia Power’s action in encouraging the economy of national companies.
TahunYear
Jumlah PenyediaNumber of Suppliers
Persentase Penyedia Nasional
Percentage of National Suppliers
Nilai Pengadaan (Rp Juta)Procurement Value (Rp Million)
Persentase Nilai
Pengadaan Penyedia Nasional
Percentage of National Suppliers’
Procurement Value
Penyedia NasionalNational
Suppliers
Penyedia InternasionalInternational
Suppliers
Total
Penyedia NasionalNational
Suppliers
Penyedia InternasionalInternational
Suppliers
Total
2017* 1.657 13 1.670 99,22% 7.706.034,26 2.283.929,60 9.989.963,86 77,14%
2018 1.644 22 1.666 98,68% 17.108.868,38 5.644.192,38 22.753.060,76 75,19%
2019 1.714 19 1.733 98,90% 19.084.065,85 2.149.437,89 21.233.503,74 89,88%
Pengadaan Energi Primer dan Pengembangan Usaha serta Pengadaan Sparepart dan JasaProcurement of Primary Energy and Business Development, and Spare Part and Services
* tidak termasuk pengadaan batubara does not include coal procurement
Pelibatan Penyedia Lokal [GRI 203-2]Involvement of Local Suppliers [GRI 203-2]
119 Sustainability Report 2019
PT Indonesia Power
Econ
omy
Pada tahun 2019, produksi tenaga listrik Indonesia Power yang meliputi produksi listrik Jawa-Bali Grid & Embedded serta pembelian listrik di Area Bali sebesar 39.112,86 GWh lebih rendah 6,75% dibandingkan tahun 2018 yaitu sebesar 41.944,56 GWh. Selanjutnya, penjualan tenaga listrik Indonesia Power yang meliputi penjualan listrik Jawa-Bali Grid & Embedded serta pembelian listrik di Area Bali pada tahun 2019 sebesar 37.535,45 GWh lebih rendah 6,35% dibandingkan tahun 2018 yaitu sebesar 40.082,53 GWh. Penurunan produksi dan penjualan ini dikarenakan adanya penurunan salah satu pasokan gas Semarang (decline dan zero flow mulai triwulan III Tahun 2019), pengoperasian Priok blok 4 dan Grati blok 3 lebih dioptimalkan dengan Blok 1-2 dikarenakan lebih efisien serta adanya variasi musim (pola normal ke kering). Atas penurunan ini, Indonesia Power melakukan action plan untuk meningkatkan produksi dan penjualan tenaga listrik di tahun selanjutnya dengan berkoordinasi aktif dengan PLN P2B untuk mengoptimalkan pola operasi PLTA dengan memanfaatkan sumber daya air yang ada dan seluruh pembangkit menjalankan program perang EFOR untuk meningkatkan keandalan.
In 2019, Indonesia Power’s electricity generation, which includes the Java-Bali Grid & Embedded electricity generation, and power purchases in the Bali Area, amounted to 39,112.86 GWh, 6.75% lower than in 2018, which was 41,944.56 GWh. Further, in 2019, the electricity sales of Indonesia Power, which includes the sales of Java-Bali Grid & Embedded power, and power purchases in the Bali Area, amounted to 37,535.45 GWh, 6.35% lower than in 2018, which was 40,082.53 GWh. The decline in production and sales was due to a decrease in one of Semarang’s gas supplies (decline and zero flow in the third quarter of 2019), the operation of Priok block 4 and Grati block 3 that was optimized with Block 1-2 due to efficiency and seasonal variations (normal to dry). In order to mitigate the reduction, Indonesia Power performed an action plan to increase electricity generation and sales in the following year by actively coordinating with PLN P2B to optimize the hydropower operating pattern by utilizing existing water resources and all power plants to carry out the EFOR war program to improve reliability.
Produksi dan Penjualan Tenaga ListrikElectricity Production and Sales
Jenis PembangkitType of Power Plant 2017 2018 2019
Pembangkit EBT NRE Plant
PLTA Hydro Power Plant (HPP) 4.318,71 3.284,31 3.133,74
PLTP Geothermal Power Plant (GPP) 2.781,27 2.869,27 2.738,94
Total Produksi Pembangkit EBT Total Production of NRE Plant 7.099,98 6.153,58 5.872,68
Pembangkit Energi Fosil Fossil Power Generation
PLTU Batu Bara Coal-Fired SPP 23.894,44 24.776,14 24.506,85
PLTU Gas Gas-Fired SPP - 111,52 2,27
PLTGU Gas Gas-Fired CCPP 9.949,29 9.099,39 7.344,00
PLTGU Bahan Bakar Minyak Oil Fuel-Fired CCPP 3,94 221,78 56,15
PLTG Gas Gas-Fired GTPP 263,97 396,41 256,81
PLTG Bahan Bakar Minyak Oil Fuel-Fired GTPP 4,34 276,37 31,12
PLTD Gas Gas-Fired DPP 899,75 648,50 962,10
PLTD Bahan Bakar Minyak Oil Fuel-Fired DPP 30,57 190,03 29,36Total Produksi Pembangkit Energi FosilTotal Production of Fossil Power Generation 35.046,30 35.720,40 33.188,66
Jawa - Bali Grid & Embedded Java – Bali Grid & Embedded 42.146,28 41.873,74 39.061,34
Pembelian Listrik di Area Bali Electricity Purchase in Bali Area 74,12 70,82 51,52
Total 42.220,40 41.944,56 39.112,86
Total Produksi Energi Listrik Pembangkit Milik Sendiri Berdasarkan Jenis Pembangkit (GWh) [EU2]Total Electricity Generation in the Existing Units by Type of Power Plant (GWh) [EU2]
120 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Produksi dan Penjualan Tenaga ListrikElectricity Production and Sales
Unit PembangkitGenerating Unit 2017 2018 2019
Suralaya PGU Suralaya PGU 23.894,44 24.776,14 24.506,85
Priok POMU Priok POMU 2.982,78 4.168,24 3.690,16
Saguling POMU Saguling POMU 3.154,53 2.393,85 2.356,51
Kamojang POMU Kamojang POMU 2.781,27 2.869,27 2.738,94
Mrica PGU Mrica PGU 1.164,18 890,46 777,22
Semarang PGU Semarang PGU 4.267,08 3.782,77 2.752,08
Grati POMU Grati POMU 2.967,35 1.937,52 1.235,73
Bali PGU Bali PGU 934,65 1.055,48 1.003,84
Jawa - Bali Grid & Embedded Java – Bali Grid & Embedded 42.146,28 41.873,74 39.061,34
Pembelian Listrik di Area Bali Electricity Purchase in Bali Area 74,12 70,82 51,52
Total 42.220,40 41.944,56 39.112,86
Total Produksi Energi Listrik Pembangkit Milik Sendiri Berdasarkan Unit Pembangkit (GWh) [EU2]Total Electricity Generation in the Existing Units by Unit (GWh) [EU2]
Jenis PembangkitType of Power Plant 2017 2018 2019
Pembangkit EBT NRE Plant
PLTA Hydro Power Plant (PLTA) 4.293,84 3.262,62 3.121,33
PLTP Geothermal Power Plant (PLTP) 2.654,48 2.734,99 2.619,64
Total Produksi Pembangkit EBT Total Sales of NRE Plant 6.948,32 5.997,61 5.740,97
Pembangkit Energi Fosil Fossil Power Generation
PLTU Batu Bara Coal-Fired SPP 22.480,60 23.339,32 23.198,17
PLTU Gas Gas-Fired SPP - 99,44 2,10
PLTU Bahan Bakar Minyak Oil Fuel-Fired SPP (7,41) - -
PLTGU Gas Gas-Fired CCPP 9.636,83 8.873,62 7.229,01
PLTGU Bahan Bakar Minyak Oil Fuel-Fired CCPP 3,85 216,92 50,77
PLTG Gas Gas-Fired GTPP 262,87 395,50 256,56
PLTG Bahan Bakar Minyak Oil Fuel-Fired GTPP (2,27) 269,61 31,05
PLTD Gas Gas-Fired DPP 883,17 632,95 946,61
PLTD Bahan Bakar Minyak Oil Fuel-Fired DPP 29,98 188,74 28,71Total Produksi Pembangkit Energi FosilTotal Sales of Fossil Power Generation 33.287,62 34.016,11 31.742,98
Jawa - Bali Grid & Embedded Java – Bali Grid & Embedded 40.235,94 40.013,72 37.483,93
Pembelian Listrik di Area Bali Electricity Purchase in Bali Area 71,46 68,80 51,52
Total 40.307,40 40.082,53 37.535,45
Total Penjualan Energi Listrik Indonesia Power Berdasarkan Jenis Pembangkit (GWh)Total Electricity Sales of Indonesia Power by Type of Power Plant (GWh)
121 Sustainability Report 2019
PT Indonesia Power
Econ
omy
Unit PembangkitGenerating Unit 2017 2018 2019
Suralaya PGU Suralaya PGU 22.480,60 23.339,32 23.198,17
Priok POMU Priok POMU 2.909,22 4.089,52 3.637,31
Saguling POMU Saguling POMU 3.148,00 2.388,09 2.352,93
Kamojang POMU Kamojang POMU 2.654,48 2.734,99 2.619,64
Mrica PGU Mrica PGU 1.145,84 874,54 768,40
Semarang PGU Semarang PGU 4.096,08 3.669,75 2.684,49
Grati POMU Grati POMU 2.890,23 1.884,85 1.235,13
Bali PGU Bali PGU 911,49 1.032,67 987,87
Jawa - Bali Grid & Embedded Java – Bali Grid & Embedded 40.235,94 40.013,72 37.483,93
Pembelian Listrik di Area Bali Electricity Purchase in Bali Area 71,46 68,80 51,52
Total 40.307,40 40.082,53 37.535,45
Total Penjualan Energi Listrik Pembangkit Milik Sendiri Berdasarkan Unit Pembangkit (GWh)Total Electricity Sales in the Existing Units by the Generating Unit (GWh)
122 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Di tahun 2019, Indonesia Power telah menyiapkan berbagai startegi, salah satunya yaitu strategi produktivitas. Strategi produktivitas adalah strategi untuk menjadikan aset yang dimiliki Perusahaan bisa menghasilkan lebih banyak lagi. Parameter yang dijadikan acuan dari strategi produktivitas adalah efisiensi pembangkit semakin baik, gangguan semakin menurun dan Equivalent Availability Factor (EAF) semakin tinggi yang dapat meningkatkan produksi. Hal ini dapat berkontribusi terhadap pembangunan berkelanjutan karena adanya pengurangan biaya dan pengurangan emisi yang dihasilkan akibat adanya pengurangan volume minyak/gas dan bahan bakar lain yang dibutuhkan untuk pembangkit listrik. Selain itu, hal ini juga dapat mempengaruhi keamanan energi nasional.
Untuk mendukung strategi tersebut, Indonesia Power senantiasa mengelola dengan baik faktor ketersediaan dan keandalan unit pembangkit. Indikator kinerja pembangkit tersebut mencakup faktor ketersediaan, gangguan, efisiensi thermal (efisiensi thermal netto) dan tara kalor netto.
In 2019, Indonesia Power has prepared various strategies, one of which is the productivity strategy. Productivity strategy is a strategy to make the assets owned by the Company to be more productive. The productivity strategy is assessed taking into account several parameters, i.e. the efficiency of the plant, the disruption decreases, and the Equivalent Availability Factor (EAF), which can increase production. This contributes to sustainable development because of the reduced costs and reduced emissions from the reduction in the volume of oil/gas and other fuels needed for the electricity generation. In addition, this affects the national energy security.
Indonesia Power manages the availability and reliability of generating units properly to support the strategy. The power plant performance indicators cover availability, disruption, net thermal efficiency, and net heat rate.
Peningkatan Ketersediaan,Keandalan dan Efisiensi PembangkitImprovement of The Availability, Reliability,and Efficiency of Plants
Faktor ketersediaan unit pembangkit diukur berdasarkan indikator Equivalent Availability Factor (EAF) dan Scheduled Outage Factor (SOF).
EAF menunjukkan tingkat kesiapan suatu pembangkit untuk beroperasi menghasilkan tenaga listrik. Dengan demikian, semakin tinggi nilai EAF maka tingkat kesiapan pembangkit lebih baik. Kinerja EAF Perusahaan merupakan kinerja pembangkit milik sendiri, pembangkit jasa O&M Jawa dan pembangkit jasa O&M Luar Jawa. Realisasi EAF tahun 2019 sebesar 88,64% meningkat 0,80% dibandingkan tahun 2018 sebesar 87,99%. Peningkatan ini dikarenakan Suralaya POMU menurunkan Forced Outage & Derated dengan melakukan pemeliharaan berbasis asset wellness & enam pilar aset manajemen; optimalisasi PLTGU melalui Maintenance On Cost, On Time, On Scope, On Quality, On Safety (5ON) dan penurunan Equivalent Force Outage Rate (EFOR); review efektifitas Preventif Maintenance (PM) durasi, frekuensi dan lingkup kerja; serta memastikan overhaul 2019 terlaksana sesuai jadwal yang ditetapkan.
The availability factor of the power plan is measured based on Equivalent Availability Factor (EAF) and Scheduled Outage Factor (SOF) indicators.
EAF shows the readiness level of a power plant to operate and produce electricity. Therefore, the higher the EAF, the better the performance of power plant. The performance of the Company’s EAF is the performance of the existing plants, Java O&M service plants and outside Java O&M service plants. In 2019, EAF value was 88.64%, an increase of 0.80% compared to 2018, which was 87.99%. This increase is because Suralaya POMU reduced the Forced Outage & Derated by asset wellness-based maintenance & six pillars of asset management; optimization of CCPP through Maintenance On Cost, On Time, On Scope, On Quality, On Safety (5ON), and decrease of Equivalent Force Outage Rate (EFOR); review of the effectiveness of Preventive Maintenance (PM) duration, frequency, and scope of work; and ensuring that the 2019 overhaul is carried out on schedule.
Faktor KetersediaanAvailability Factor
Equivalent Availability Factor (EAF)Equivalent Availability Factor (EAF)
123 Sustainability Report 2019
PT Indonesia Power
Econ
omy
EAF pembangkit jasa O&M Jawa pada tahun 2019 sebesar 84,72% meningkat 7,65% dibandingkan pada tahun 2018 sebesar 78,70%. Peningkatan ini menunjukkan tingkat kesiapan pembangkit jasa O&M Jawa lebih baik dari pencapaian EAF pembangkit jasa O&M Jawa tahun 2018.
EAF pembangkit jasa O&M Luar Jawa pada tahun 2019 sebesar 66,42% meningkat 22,89% dibandingkan pada tahun 2018 sebesar 54,05%. Peningkatan ini menunjukkan tingkat kesiapan pembangkit jasa O&M Luar Jawa lebih baik yang dikarenakan telah beroperasinya PLTU Sintang OMU di tahun 2019.
The EAF for O&M Plants in Java in 2019 was 84.72%, increased by 7.65% compared to 2018, which was 78.70%. This increase shows the level of readiness of the Java O&M service plant is better than the EAF achievement of the Java O&M service plant in 2018.
The EAF for O&M Plants outside Java in 2019 was 66.42%, increased by 22.89% compared to 2018, which was 54.05%. This increase shows the level of readiness of O&M Plants outside Java is better because of the operation of the SPP Sintang OMU in 2019.
Jenis PembangkitType of Power Plant 2015 2016 2017 2018 2019
PLTA Hydro Power Plant (HPP) 93,89 92,90 96,69 98,09 95,78
PLTU Batubara Coal-Fired SPP 91,41 89,72 91,26 89,05 92,02
PLTU Gas Gas-Fired SPP - - - 70,32 99,86
PLTU Bahan Bakar Minyak Oil Fuel-Fired SPP 100,00 - - - -
PLTGU Gas Gas-Fired CCPP 90,05 90,75 88,10 81,83 83,09
PLTGU Bahan Bakar Minyak Oil Fuel-Fired CCPP 84,92 84,47 - - -
PLTP Geothermal Power Plant (GPP) 96,61 94,10 92,93 89,55 89,86
PLTG Gas Gas-Fired GTPP 100,00 100,00 97,00 85,23 98,73
PLTG Bahan Bakar Minyak Oil Fuel-Fired GTPP 96,12 96,11 99,55 92,72 99,05
PLTD Gas Gas-Fired DPP - 92,50 94,31 95,62 92,51
PLTD Bahan Bakar Minyak Oil Fuel-Fired DPP 100,00 100,00 - - 100,00
Jumlah Total 90,85 90,81 92,07 87,94 88,64
Unit PembangkitGenerating Unit 2015 2016 2017 2018 2019
Suralaya PGU Suralaya PGU 91,41 89,72 91,26 89,05 92,02
Priok POMU Priok POMU 90,81 90,98 93,61 82,19 78,58
Saguling POMU Saguling POMU 92,26 91,06 96,35 97,73 96,49
Kamojang POMU Kamojang POMU 96,61 94,10 92,93 89,55 89,86
Mrica PGU Mrica PGU 98,09 97,61 97,57 99,10 93,93
Semarang PGU Semarang PGU 84,09 87,09 81,84 82,83 89,06
Grati POMU Grati POMU 93,44 94,54 96,18 78,97 91,29
Bali PGU Bali PGU 90,51 92,76 97,65 93,77 96,68
Jumlah Total 90,85 90,81 92,07 87,94 88,64
Nilai EAF Pembangkit Milik Sendiri Berdasarkan Jenis Pembangkit (%)EAF Value of Existing Generators by Type of Power Plant (%)
Nilai EAF Pembangkit Milik Sendiri Berdasarkan Unit Pembangkit (%)EAF Value of Existing Generators by Generating Unit (%)
124 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
SOF digunakan untuk mengukur tingkat pembangkit keluar sistem karena pemeliharaan terencana, yaitu Planned Outage Hour dan Maintenance Outage Hour yang sudah direncanakan sebelumnya. Dengan demikian, semakin rendah nilai SOF maka ketepatan perencanaan pemeliharaan pembangkit lebih baik. Kinerja SOF Perusahaan merupakan kinerja pembangkit milik sendiri, pembangkit jasa O&M Jawa dan pembangkit jasa O&M Luar Jawa. Realisasi SOF tahun 2019 sebesar 7,27% meningkat 23,64% dibandingkan tahun 2018 sebesar 5,88%. Peningkatan ini dikarenakan adanya penambahan durasi pemeliharaan akibat temuan pada saat overhaul yaitu pada B Inspection GT 1.3 Priok, C Inspection GT 2.2 Priok dan General Inspection Saguling 2. Untuk menurunkan nilai SOF di tahun selanjutnya, Indonesia Power melakukan action plan diantaranya yaitu monitoring terhadap eksekusi manajemen asset serta memonitor Opportunity For Improvement (OFI) dari masing masing aset dan mengimplementasikan maximo excellent.
SOF demonstrates the level of system outage because of planned maintenance, i.e. Planned Outage Hour and Maintenance Outage Hour that have been planned before. Thus, the lower the SOF value, the better the accuracy of plant maintenance planning. The performance of the Company’s SOF is the performance of the existing plants, Java O&M service plants and outside Java O&M service plants. In 2019, SOF value was 7.27%, an increase of 23.64% compared to 2018, which was 5.88%. This increase is due to the addition of the maintenance duration because of findings during overhaul, i.e. GT 1.3 Priok B Inspection, GT 2.2 Priok C Inspection, and Saguling 2 General Inspection. Indonesia Power carried out several action plans, including monitoring the asset management, monitoring the Opportunity for Improvement (OFI) of each asset, and implementing maximo excellent to reduce the SOF value in the following year.
Scheduled Outage Factor (SOF)Scheduled Outage Factor (SOF)
Peningkatan Ketersediaan, Keandalan dan Efisiensi PembangkitImprovement of The Availability, Reliability, and Efficiency of Plants
Jenis PembangkitType of Power Plant 2015 2016 2017 2018 2019
PLTA Hydro Power Plant (HPP) 5,93 6,67 3,13 1,89 4,14
PLTU Batubara Coal-Fired SPP 5,26 7,22 6,78 7,59 6,40
PLTU Gas Gas-Fired SPP - - - 18,16 -
PLTU Bahan Bakar Minyak Oil Fuel-Fired SPP - - - - -
PLTGU Gas Gas-Fired CCPP 8,26 5,74 5,91 4,92 11,69
PLTGU Bahan Bakar Minyak Oil Fuel-Fired CCPP 7,35 - - - -
PLTP Geothermal Power Plant (GPP) 2,76 4,90 2,30 1,23 8,38
PLTG Gas Gas-Fired GTPP - 3,74 2,39 14,25 1,20
PLTG Bahan Bakar Minyak Oil Fuel-Fired GTPP 2,49 - 0,44 1,64 0,77
PLTD Gas Gas-Fired DPP - 3,23 5,14 4,08 7,41
PLTD Bahan Bakar Minyak Oil Fuel-Fired DPP - - - - -
Jumlah Total 5,98 6,09 5,21 5,88 7,27
Nilai SOF Pembangkit Milik Sendiri Berdasarkan Jenis Pembangkit (%)SOF Value of Existing Generators by Type of Power Plant (%)
125 Sustainability Report 2019
PT Indonesia Power
Econ
omy
SOF pembangkit jasa O&M Jawa pada tahun 2019 sebesar 7,51% lebih rendah 51,36% dibandingkan pada tahun 2018 sebesar 15,44%. Hal ini menunjukkan ketepatan perencanaan pemeliharaan pembangkit jasa O&M Jawa di tahun 2019 lebih baik dari pencapaian tahun 2018.
SOF pembangkit jasa O&M Luar Jawa pada tahun 2019 sebesar 40,49% meningkat 75,89% dibandingkan pada tahun 2018 sebesar 23,02%. Hal ini dikarenakan adanya kerusakan pada Chain Grate di PLTU Sanggau OMU. Atas hal tersebut, Indonesia Power melakukan action plan yakni perbaikan untuk Chain Grate Unit #1 dan #2 dengan melakukan penggantian Material Chain Grate.
The SOF for O&M Plants in Java in 2019 was 7.51%, increased by 51.36% compared to 2018, which was 15.44%. This shows that the accuracy of the Java O&M service plant maintenance planning in 2019 is better than the achievement in 2018.
The SOF for O&M Plants outside Java in 2019 was 40.49%, increased by 75.89% compared to 2018, which was 23.02%. This is due to the damage to the Chain Grate at the SPP Sanggau OMU. Therefore, Indonesia Power implemented an action plan by repairing Chain Grate Unit #1 and #2 by replacing the Chain Grate Material.
Nilai SOF Pembangkit Milik Sendiri Berdasarkan Unit Pembangkit (%)SOF Value of Existing Generators by Generating Unit (%)
Unit PembangkitType of Power Plant 2015 2016 2017 2018 2019
Suralaya PGU Suralaya PGU 5,26 7,22 6,78 7,59 6,40
Priok POMU Priok POMU 5,74 4,67 4,01 4,28 14,78
Saguling POMU Saguling POMU 7,50 8,79 3,40 2,18 3,44
Kamojang POMU Kamojang POMU 2,76 4,90 2,30 1,23 8,38
Mrica PGU Mrica PGU 1,88 1,53 2,42 1,08 5,94
Semarang PGU Semarang PGU 8,32 5,58 7,87 8,34 7,80
Grati POMU Grati POMU 5,29 3,97 2,81 7,92 5,91
Bali PGU Bali PGU 9,40 5,49 2,14 2,52 3,19
Jumlah Total 5,98 6,09 5,21 5,88 7,27
126 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Peningkatan Ketersediaan, Keandalan dan Efisiensi PembangkitImprovement of The Availability, Reliability, and Efficiency of Plants
Jenis PembangkitType of Power Plant 2015 2016 2017 2018 2019
PLTA Hydro Power Plant (HPP) 0,35 0,51 0,30 0,35 0,21
PLTU Batubara Coal-Fired SPP 3,01 2,64 1,56 3,47 1,36
PLTU Gas Gas-Fired SPP - - - 26,61 1,48
PLTU Bahan Bakar Minyak Oil Fuel-Fired SPP - - - - -
PLTGU Gas Gas-Fired CCPP 0,24 4,76 5,48 15,79 2,63
PLTGU Bahan Bakar Minyak Oil Fuel-Fired CCPP 8,28 - - - -
PLTP Geothermal Power Plant (GPP) 0,62 1,01 4,79 9,15 1,65
PLTG Gas Gas-Fired GTPP - 2,08 3,98 2,30 0,08
PLTG Bahan Bakar Minyak Oil Fuel-Fired GTPP 10,21 - 2,96 4,30 0,12
PLTD Gas Gas-Fired DPP - 6,51 0,87 0,46 0,13
PLTD Bahan Bakar Minyak Oil Fuel-Fired DPP - - - - -
Jumlah Total 3,16 2,94 2,75 7,35 1,52
Nilai EFOR Pembangkit Milik Sendiri Berdasarkan Jenis Pembangkit (%)EFOR Value of Existing Generators by Type of Power Plant (%)
EFOR digunakan untuk mengukur jam keluar paksa unit pembangkit atau ketidaksiapan unit untuk beroperasi karena gangguan. Dengan demikian, semakin rendah nilai EFOR menunjukkan semakin cepatnya penanganan gangguan (unit pembangkit lebih andal). Kinerja EFOR Perusahaan merupakan kinerja pembangkit milik sendiri, pembangkit jasa O&M Jawa dan pembangkit jasa O&M Luar Jawa. Realisasi EFOR tahun 2019 sebesar 1,52% lebih rendah 79,32% dibandingkan tahun 2018 sebesar 7,35%. Hal ini dikarenakan Suralaya POMU menurunkan Forced Outage & Derated dengan melakukan pemeliharaan berbasis asset wellness & 6 pilar aset manajemen dan optimalisasi PLTU melalui maintenance On Cost, On Time, On Scope, On Quality, On Safety (5ON) dan penurunan EFOR.
EFOR measures the hours of forced outbreak of the engine or the unpreparedness of the unit to operate due to disruption. Therefore, low EFOR rate demonstrates that problems are being handled quickly (more reliable plants). The performance of the Company’s EFOR is the performance of the existing plants, Java O&M service plants and outside Java O&M service plants. In 2019, EFOR value was 1.52%, decreased by 79.32% compared to 2018, which was 7.35%. This increase is because Suralaya POMU reduced the Forced Outage & Derated by conducting asset wellness-based maintenance & six pillars of asset management, and optimizing SPP through Maintenance On Cost, On Time, On Scope, On Quality, On Safety (5ON), as well as reducing EFOR.
Equivalent Forced Outage Rate (EFOR)Equivalent Forced Outage Rate (EFOR)
Faktor gangguan mesin pembangkit diukur berdasarkan dua indikator yaitu Equivalent Forced Outage Rate (EFOR) dan Sudden Outage Frequency (SdOF).
Disruption of the power plant machine is measured based on Equivalent Forced Outage Rate (EFOR) and Sudden Outage Frequency (SdOF) indicators.
Faktor GangguanDisruption Factor
127 Sustainability Report 2019
PT Indonesia Power
Econ
omy
SdOF menunjukkan jumlah gangguan yang terjadi dalam periode tertentu, terutama frekuensi terjadinya gangguan yang berulang. Dengan demikian, semakin rendah nilai SdOF, maka semakin baik manajemen operasional Perusahaan dalam mengurangi gangguan. Kinerja SdOF Perusahaan merupakan kinerja pembangkit milik sendiri, pembangkit jasa O&M Jawa dan pembangkit jasa O&M Luar Jawa. Realisasi SdOF tahun 2019 sebesar 2,30 kali lebih rendah 22,30% dibandingkan tahun 2018 sebesar 2,96 kali. Hal ini dikarenakan berkurangnya gangguan yang terjadi dibandingkan tahun sebelumnya yaitu perubahan signifikan pada Semarang PGU yang sebelumnya mengalami sebanyak 135 gangguan menjadi 75 gangguan.
EFOR pembangkit jasa O&M Jawa pada tahun 2019 sebesar 6,81% lebih rendah 10,63% dibandingkan pada tahun 2018 sebesar 7,62%. Hal ini menunjukkan unit pembangkit jasa O&M Jawa di tahun 2019 lebih andal dari pencapaian tahun 2018.
EFOR pembangkit jasa O&M Luar Jawa pada tahun 2019 sebesar 5,78% lebih rendah 64,97% dibandingkan pada tahun 2018 sebesar 16,50%. Hal ini menunjukkan unit pembangkit jasa O&M Luar Jawa lebih andal yang dikarenakan adanya kecepatan penanganan gangguan pada Unit #1 PLTU Pangkalan Susu OMU.
SdOF shows the number of disruptions that happens during certain period, especially the frequency of repeated disruption. Thus, lower SdOF value reflects better Company’s operational management in reducing disruptions. The performance of the Company’s SdOF is the performance of the existing plants, Java O&M service plants and outside Java O&M service plants. In 2019, SdOF was 2.30 times, decreased by 22.30% compared to 2018, which was 2.96 times. This is due to the reduction in disruption that occurred compared to the previous year, i.e. a significant change in Semarang PGU which previously experienced 135 disruptions, decreased to 75 disruptions.
The EFOR for O&M Plants in Java in 2019 was 6.81%, decreased by 10.63% compared to 2018, which was 7.62%. This shows that the Java O&M service plants in 2019 is more reliable than the achievement in 2018.
The EFOR for O&M Plants outside Java in 2019 was 5.78%, decreased by 64.97% compared to 2018, which was 16.50%. This shows that O&M Plants outside Java are more reliable due to the speed of handling disturbances at Unit #1 SPP Pangkalan Susu OMU.
Sudden Outage Frequency (SdOF)Sudden Outage Frequency (SdOF)
Unit PembangkitType of Power Plant 2015 2016 2017 2018 2019
Suralaya PGU Suralaya PGU 3,01 2,64 1,56 3,47 1,36
Priok POMU Priok POMU 3,97 3,81 1,00 14,83 2,71
Saguling POMU Saguling POMU 0,45 0,20 0,42 0,34 0,16
Kamojang POMU Kamojang POMU 0,62 1,01 4,79 9,15 1,65
Mrica PGU Mrica PGU 0,09 1,47 0,01 0,36 0,34
Semarang PGU Semarang PGU 6,32 6,65 12,99 10,41 3,45
Grati POMU Grati POMU 0,36 0,24 0,61 27,84 0,57
Bali PGU Bali PGU 13,22 6,77 0,90 3,38 0,50
Jumlah Total 3,16 2,94 2,75 7,35 1,52
Nilai EFOR Pembangkit Milik Sendiri Berdasarkan Unit Pembangkit (%)EFOR Value of Existing Generators by Generating Unit (%)
128 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Peningkatan Ketersediaan, Keandalan dan Efisiensi PembangkitImprovement of The Availability, Reliability, and Efficiency of Plants
SdOF pembangkit jasa O&M Jawa pada tahun 2019 sebesar 1,50 kali lebih rendah 44,24% dibandingkan pada tahun 2018 sebesar 2,69 kali. Hal ini menunjukkan semakin baik manajemen operasional Perusahaan dalam mengurangi gangguan di tahun 2019 dibandingkan tahun 2018.
SdOF pembangkit jasa O&M Luar Jawa pada tahun 2019 sebesar 3,91 kali lebih rendah 24,83% dibandingkan pada tahun 2018 sebesar 6,00 kali. Hal ini semakin baik manajemen operasional Perusahaan dalam mengurangi gangguan yang dikarenakan penggunaan peralatan yang lebih andal.
The SdOF of O&M Plants in Java in 2019 was 1.50 times, decreased by 44.24% compared to 2018, which was 2.69 times. This reflects better Company’s operational management in reducing disruptions in 2019 than 2018.
The SdOF of O&M Plants outside Java in 2019 was 3.91 times, decreased by 24.83% compared to 2018, which was 6.00 times. This reflects better Company’s operational management in reducing disruptions by utilizing more reliable equipment.
Jenis PembangkitType of Power Plant 2015 2016 2017 2018 2019
PLTA Hydro Power Plant (HPP) 0,37 0,46 0,54 0,42 0,22
PLTU Batubara Coal-Fired SPP 2,14 2,86 0,86 1,00 1,00
PLTU Gas Gas-Fired SPP - - - 10,00 2,00
PLTU Bahan Bakar Minyak Oil Fuel-Fired SPP - - - - -
PLTGU Gas Gas-Fired CCPP 2,75 8,26 8,61 9,70 7,17
PLTGU Bahan Bakar Minyak Oil Fuel-Fired CCPP 18,50 - - - -
PLTP Geothermal Power Plant (GPP) 2,00 3,50 1,33 2,57 2,29
PLTG Gas Gas-Fired GTPP - 1,70 0,67 0,67 0,33
PLTG Bahan Bakar Minyak Oil Fuel-Fired GTPP 2,20 - - - 1,24
PLTD Gas Gas-Fired DPP - 5,00 3,00 3,83 1,25
PLTD Bahan Bakar Minyak Oil Fuel-Fired DPP - - - - -
Jumlah Total 2,00 2,78 2,40 2,96 2,30
Nilai SdOF Pembangkit Milik Sendiri Berdasarkan Jenis Pembangkit (%)SdOF Value of Existing Generators by Type of Power Plant (times)
Unit PembangkitType of Power Plant 2015 2016 2017 2018 2019
Suralaya PGU Suralaya PGU 2,14 2,86 0,86 1,00 1,00
Priok POMU Priok POMU 1,36 1,71 5,29 5,75 4,71
Saguling POMU Saguling POMU 0,45 0,45 0,69 0,45 0,28
Kamojang POMU Kamojang POMU 2,00 3,50 1,33 2,57 2,29
Mrica PGU Mrica PGU 0,29 0,46 0,17 0,37 0,07
Semarang PGU Semarang PGU 13,80 15,90 14,00 15,00 8,00
Grati POMU Grati POMU 2,57 1,43 1,29 3,57 1,14
Bali PGU Bali PGU 0,89 3,89 1,89 3,32 1,16
Jumlah Total 2,00 2,78 2,40 2,96 2,30
Nilai SdOF Pembangkit Milik Sendiri Berdasarkan Unit Pembangkit (%)SdOF Value of Existing Generators by Generating Unit (times)
129 Sustainability Report 2019
PT Indonesia Power
Econ
omy
Efisiensi Thermal (Efisiensi Thermal Netto)Net Thermal Efficiency
Efisiensi Thermal adalah perbandingan energi yang dibangkitkan dengan energi bahan bakar primer dalam periode tertentu. Dengan demikian, semakin tinggi nilai Efisiensi Thermal, maka semakin efisien pembangkit. Realisasi Efisiensi Thermal tahun 2019 sebesar 34,07% meningkat 2,78% dibandingkan tahun 2018 sebesar 33,15%. Hal ini menunjukkan pembangkit Perusahaan semakin efisien, yang dikontribusikan dengan adanya peningkatan efisiensi thermal di hampir seluruh unit dengan upaya peningkatan keandalan, mengurangi gangguan/derating (perang EFOR), penurunan Pemakaian Sendiri (PS) serta optimalisasi pola operasi.
Thermal efficiency is the ratio of the generated energy to the primary fuel energy for a certain period. Therefore, the higher the Thermal Efficiency Rate, the better the efficiency of a power plant. In 2019, Thermal Efficiency was 34.07%, an increase of 2.78% compared to 2018, which was 33.15%. This shows that the Company’s power plants are more efficient, contributed by the increase in thermal efficiency in almost all units with efforts to increase reliability, reduce interference/derating (EFOR war), decrease Self-Consumption (PS), and optimize operating patterns.
Jenis PembangkitType of Power Plant 2015 2016 2017 2018 2019
PLTU Batubara Coal-Fired SPP 33,05 32,84 32,05 32,35 33,31
PLTU Gas Gas-Fired SPP - - - 24,59 24,56
PLTU Bahan Bakar Minyak Oil Fuel-Fired SPP - - - - -
PLTGU Gas Gas-Fired CCPP 36,93 36,36 35,35 36,22 37,03
PLTGU Bahan Bakar Minyak Oil Fuel-Fired CCPP 32,35 42,59 38,38 33,99 31,72
PLTG Gas Gas-Fired GTPP 21,97 21,31 23,01 23,93 22,75
PLTG Bahan Bakar Minyak Oil Fuel-Fired GTPP 24,28 19,86 - 25,17 24,85
PLTD Gas Gas-Fired DPP - 38,51 37,66 37,38 37,65
PLTD Bahan Bakar Minyak Oil Fuel-Fired DPP 39,20 36,00 31,04 38,39 36,30
Jumlah Total 33,76 33,90 32,95 33,15 34,07
Nilai Efisiensi Thermal Pembangkit Milik Sendiri Berdasarkan Jenis Pembangkit (%) Thermal Efficiency of Existing Generators by Type of Power Plant (%)
Unit PembangkitType of Power Plant 2015 2016 2017 2018 2019
Suralaya PGU Suralaya PGU 33,05 32,84 32,05 32,35 33,31
Priok POMU Priok POMU 38,82 37,53 36,67 36,96 38,17
Semarang PGU Semarang PGU 35,68 34,92 32,77 34,44 34,79
Grati POMU Grati POMU 34,03 35,86 36,20 33,01 34,25
Bali PGU Bali PGU 29,88 37,30 37,05 34,23 36,82
Jumlah Total 33,76 33,90 32,95 33,15 34,07
Nilai Efisiensi Thermal Pembangkit Milik Sendiri Berdasarkan Unit Pembangkit (%)Thermal Efficiency of Existing Generators by Generating Unit (%)
130 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Tara Kalor NettoNet Heat Rate
Tara Kalor Netto adalah perbandingan pasokan energi yang diperlukan untuk menghasilkan listrik sebesar 1 kWh. Dengan demikian, semakin rendah nilai Tara Kalor Netto, maka semakin efisien pembangkit. Realisasi Tara Kalor Netto tahun 2019 sebesar 2.524,56 kCal/kWh menurun 2,68% dibandingkan tahun 2018 sebesar 2.594,05 kCal/kWh. Hal ini menunjukkan pembangkit Perusahaan semakin efisien, yang dikontribusikan dengan adanya peningkatan keandalan, mengurangi gangguan/derating (perang EFOR), penurunan PS serta optimalisasi pola operasi.
Net Heat Rate is the ratio of energy supply needed to generate 1 kWh of electricity. Therefore, the lower the Net Heat Rate, the more efficient a power plant is. In 2019, Net Heat Rate amounted to 2,524.56 kCal/kWh, which decreased by 2.68% compared to 2018, which was 2,594.05 kCal/kWh. This shows that the Company’s power plants are more efficient, contributed by the increase in reliability, by reducing interference/derating (EFOR war), decreasing Self-Consumption (PS), and optimizing operating patterns.
Jenis PembangkitType of Power Plant 2015 2016 2017 2018 2019
PLTU Batubara Coal-Fired SPP 2.602,18 2.618,58 2.683,22 2.658,80 2.581,97
PLTU Gas Gas-Fired SPP - - - 3.497,28 3.501,65
PLTU Bahan Bakar Minyak Oil Fuel-Fired SPP - - - - -
PLTGU Gas Gas-Fired CCPP 2.328,94 2.365,07 2.433,04 2.374,11 2.322,29
PLTGU Bahan Bakar Minyak Oil Fuel-Fired CCPP 2.685,02 2.019,26 2.240,81 2.530,03 2.711,65
PLTG Gas Gas-Fired GTPP 3.913,55 4.035,83 3.737,35 3.593,16 3.779,40
PLTG Bahan Bakar Minyak Oil Fuel-Fired GTPP 3.541,34 4.329,61 - 3.417,04 3.460,56
PLTD Gas Gas-Fired DPP - 2.233,19 2.283,51 2.300,60 2.284,11
PLTD Bahan Bakar Minyak Oil Fuel-Fired DPP 2.193,73 2.388,57 2.770,26 2.240,26 2.369,29
Jumlah Total 2.547,10 2.537,06 2.609,80 2.594,05 2.524,56
Nilai Tara Kalor Netto Pembangkit Milik Sendiri Berdasarkan Jenis Pembangkit (kCal/kWh)Net Heat Rate Value of Existing Plants by Type of Power Plant (kCal/kWh)
Unit PembangkitType of Power Plant 2015 2016 2017 2018 2019
Suralaya PGU Suralaya PGU 2.602,18 2.618,58 2.683,22 2.658,80 2.581,97
Priok POMU Priok POMU 2.215,46 2.291,73 2.345,07 2.327,00 2.253,10
Semarang PGU Semarang PGU 2.409,99 2.462,49 2.624,41 2.497,14 2.471,98
Grati POMU Grati POMU 2.527,54 2.398,03 2.375,42 2.604,93 2.510,87
Bali PGU Bali PGU 2.878,66 2.305,41 2.321,39 2.512,48 2.335,73
Jumlah Total 2.547,10 2.537,06 2.609,80 2.594,05 2.524,55
Nilai Tara Kalor Netto Pembangkit Milik Sendiri Berdasarkan Unit Pembangkit (kCal/kWh)Net Heat Rate Value of Existing Plants by Generating Unit (kCal/kWh)
Peningkatan Ketersediaan, Keandalan dan Efisiensi PembangkitImprovement of The Availability, Reliability, and Efficiency of Plants
131 Sustainability Report 2019
PT Indonesia Power
Econ
omy
132 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Pengembangan Inovasi Berkelanjutan Bagi Peningkatan PerformanceContinuous Innovation Developmentfor Performance Improvement
Pendekatan Manajemen Topik Research and Development[GRI 103-1, 103-2, 103-3]Management Approach toResearch and Development[GRI 103-1, 103-2, 103-3]
Kebijakan Perusahaan- Surat Keputusan Nomor 193.K/010/IP/2017
Organisasi PT Indonesia Power- Surat Keputusan Nomor 260.K/010/IP/2017
Kebijakan Pengembangan Renewable Energy Di Lingkungan PT Indonesia Power
Ketentuan Umum- Peraturan Presiden Nomor 22/2017 tentang
Rencana Umum Energi Nasional (RUEN)- Peraturan Menteri ESDM Nomor 50 Tahun 2017
tentang Pemanfaatan Sumber Energi Terbarukan untuk Penyediaan Tenaga Listrik
Company’s Policies:- Decree No. 193.K/010/IP/2017 Organization of PT
Indonesia Power- Decree No. 260.K/010/IP/2017 Renewable Energy
Development Policy within PT Indonesia Power
General Provisions- Presidential Regulation No. 22/2017 on the National
Energy Masterplan (RUEN)- Minister of EMR Regulation No. 50 of 2017 on
the Utilization of Renewable Energy Sources for Electricity Supply
- Head of Research, Innovation and Knowledge Management
- Head of Research, Innovation and Knowledge Management
Topik Research and Development (R&D) menjadi topik yang penting bagi Indonesia Power karena untuk menyediakan energi listrik yang andal dan berkelanjutan guna meningkatkan performance unit bisnis dan penguatan lini energi terbarukan sebagai portofolio bisnis baru bagi Perusahaan (second curve of business) yang mendukung pencapaian tujuan pembangunan berkelanjutan, dibutuhkan langkah untuk menemukan cara baru yang lebih inovatif dan berkelanjutan melalui kegiatan R&D yang dilakukan secara efektif dan berkesinambungan.
Research and Development (R&D) is an important topic for Indonesia Power because new innovative and sustainable ways are necessary through effective and sustainable R&D activities to provide reliable and sustainable electricity to improve business unit performance and strengthen the renewable energy line as the Company’s second curve of business that supports the achievement of sustainable development goals.
KebijakanPolicy
Penanggung JawabPerson in Charge
133 Sustainability Report 2019
PT Indonesia Power
Econ
omy
- Mengembangkan kinerja dan portofolio Perusahaan dalam kerangka second curve bussiness dengan pemanfaatan teknologi terapan serta energi baru terbarukan dalam menghadapi peluang dan tantangan bisnis energi.
- Developing the Company’s performance and portfolio within the second curve business framework by utilizing the applied technology and renewable energy in facing the energy field opportunities and business challenges.
- Riset untuk meningkatkan kinerja pembangkit
- Riset pengembangan energi terbarukan
- Riset pengembangan portofolio bisnis energi
- Research to improve power plants’ performance
- Renewable energy development research
- Research to develop energy business portfolio
- Riset optimalisasi pemakaian sendiri dan efisiensi pembangkit
- Pre Feasibility Study dan kajian teknologi energi baru dan terbarukan
- Pre Feasibility Study teknologi pengolahan limbah
- Riset terkait bahan bakar alternatif
- Research to optimize self- consumption and plants’ efficiency
- Pre-Feasibility Study and study of new and renewable energy technologies
- Pre-Feasibility Study of waste treatment technology
- Research on alternative fuels
- Pre Feasibility Study dan Desain System Recovery Energy Pembangkit
- Pre Feasibility Study dan Desain Energy Terbarukan- Pre Feasibility Study dan Desain Teknologi Pengolahan
Fly Ash dan Bottom Ash- Riset Cofiring Bahan Bakar Biomassa
- Pre-Feasibility Study and Design of Power Plant Energy Recovery System
- Pre-Feasibility Study and Design of Renewable Energy- Pre-Feasibility Study and Design of Fly Ash and Bottom
Ash Processing Technology- Cofiring Research on Biomass Fuels
Melaksanakan evaluasi untuk semakin memperkuat kegiatan R&D di tahun berikutnya dengan:- Proses riset perlu dilanjutkan untuk dibuatkan pilot
project agar memperoleh data empiris operasional dan kinerja; dan
- Diperlukan proses bisnis untuk evaluasi produk riset menjadi Minimum Viable Product (MVP).
Conducting evaluation to further strengthen the R&D activities in the following year by:- Continuing research process to create a pilot project in
order to obtain operational and performance empirical data; and
- Compiling a business process to evaluate a research product to be a Minimum Viable Product (MVP).
KomitmenCommitment
RealisasiRealization
Sasaran dan TargetGoals and Targets
EvaluasiEvaluation
Program/InisiatifProgram/Initiative
134 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Pengembangan Inovasi Berkelanjutan Bagi Peningkatan PerformanceContinuous Innovation Development for Performance Improvement
Indonesia Power senantiasa mengedepankan aspek continuous improvement dan inovasi dalam segala hal, terutama dalam pelaksanaan Research and Development (R&D) bagi pengembangan teknologi pembangkitan untuk menyediakan energi listrik yang andal dan berkelanjutan sehingga menciptakan peningkatan performance unit bisnis dan sebagai bentuk upaya maksimal Perusahaan menangkap peluang dalam mengatasi risiko perubahan iklim untuk mendukung tujuan pembangunan berkelanjutan. [GRI 102-15]
Pada tahun 2019, program-program R&D yang dilakukan Indonesia Power yaitu Program Pengembangan Teknologi yang Menghasilkan Efisiensi Energi, Program Pengembangan Teknologi Energi Terbarukan dan Program Pengembangan Teknologi Lainnya.
Indonesia Power prioritizes continuous improvement and innovation in all matters, especially in the Research and Development (R&D) for the development of power generation technology to provide reliable and sustainable electrical energy in order to create business unit performance improvement, and as a form of maximum effort of the Company in seizing opportunities in overcoming climate change risks to support sustainable development goals. [GRI 102-15]
In 2019, Indonesia Power carried out several R&D programs: Technology Development Program for Energy Efficiency, Renewable Energy Technology Development Program, and Other Technology Development Programs.
Desain PLTB Contra Rotating GeneratorDesign of Contra Rotating Generator Wind Power Plant
Pre FS 1 MW Ground Mounting PVPre-FS 1 MW of Ground Mounting PV
No. Nama Program R&DR&D Program
LokasiLocation
Deskripsi dan Tujuan Program R&DR&D Program Description and
Objectives
OutputProgram R&D
R&D Program Output
Biaya R&D(Rp Juta)
R&D Costs(Rp million)
Program Pengembangan Teknologi yang Menghasilkan Efisiensi EnergiTechnology Development Program for Energy Efficiency
1 Desain PLTB Contra Rotating GeneratorDesign of Contra Rotating Generator Wind Power Plant
Bali PGUBali PGU
Recovery energi dari cooling radiator van PLTDGEnergy recovery from DGPP cooling radiators van
Dokumen Desain PLTB Contra Rotating GeneratorDesign Documents of Contra Rotating Generator Wind Power Plant
141
2 Pre FS Organic Rankine Cycle (ORC) PLTDGPre-FS of DGPP Organic Rankine Cycle (ORC)
Bali PGUBali PGU
Recovery energi dari cexhaust PLTDGEnergy recovery from DGPP exhaust
Dokumen Pre Feasibility StudyPre-Feasibility Study documents
50
Program Research and Development (R&D) Tahun 2019 [GRI 201-2, EU8]Research and Development (R&D) Program in 2019 [GRI 201-2, EU8]
135 Sustainability Report 2019
PT Indonesia Power
Econ
omy
No. Nama Program R&DR&D Program
LokasiLocation
Deskripsi dan Tujuan Program R&DR&D Program Description and
Objectives
OutputProgram R&D
R&D Program Output
Biaya R&D(Rp Juta)
R&D Costs(Rp million)
Program Pengembangan Teknologi Energi Terbarukan Renewable Energy Technology Development Program1 Pre Feasibility Study
(FS) 1 MW Ground Mounting PVPre-Feasibility Study 1 MW of Ground Mounting PV
River bank SagulingSaguling’s riverbank
Pemanfaatan daerah perbatasan lahan waduk Saguling untuk solar Photo Vortex (PV) sekaligus sebagai pengaman lahanUtilization of the Saguling reservoir boundary area for solar Photo Vortex (PV) and land security
Dokumen Pre Feasibility StudyPre-Feasibility Study documents
50
2 Desain PLTA Vortex 20 kVaDesign of 20 kVa Vortex Hydropower Plant
PLTA Dago SagulingDago Saguling Hydropower Plant
Recovery energi dari tail race PLTA, untuk melihat potensi pengembangan produk dan teknologi vortexEnergy recovery from the HPP tailrace, to see the potential development of vortex products and technology
Dokumen PLTA Vortex 20 kVaDocuments of 20 kVa Vortex Hydropower Plant
175
Program Pengembangan Teknologi Lainnya Other Technology Development Programs1 Uji Cofiring PLTU
Circulating Fluidized Bed (CFB)Cofiring Test of SPP Circulating Fluidized Bed (CFB)
PLTU Jeranjang SPP Jeranjang
Pemanfaatan pellet Solid Recovered Fuel (SRF) sebagai bahan bakar alternatif di PLTUUse of Solid Recovered Fuel (SRF) pellets as alternative fuels at SPP
Hasil pengujian sampai uji heat rate sebagai dasar evaluasi kelayakan operasi dan finansialTest results of the heat rate test as a basis for evaluating the operational and financial feasibility
400
2 Desain gasifier 100 kWeDesign of 100 kWe gasifier
Bali Pemanfaatan pellet SRF sebagai bahan bakar pengganti PLTDUtilization of SRF pellets as fuel for DPP replacement
Desain Gasifier 100 kWeDesign of 100 kWe gasifier
195
3 Desain instalasi pengolah Fly Ash and Bottom Ash (FABA)Design of Fly Ash and Bottom Ash (FABA) processor installation
Suralaya Pemanfaatan FABA sebagai alternatif bahan konstruksi dengan konten 90%Use of FABA as an alternative construction material with 90% content
Pre Feasibility Study dan Desain instalasi pengolah FABA 50.000 ton per tahunPre-Feasibility Study and Design of FABA processing plant of 50,000 tons per year
366
136 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
Pengembangan Inovasi Berkelanjutan Bagi Peningkatan PerformanceContinuous Innovation Development for Performance Improvement
Inovasi Unggulan Tahun 2019Penurunan BPP Komponen-C dengan Energy and Operation Management System (NEMESYS)Flagship Innovations in 2019Reducing C-Component Electricity Generation Cost with the Energy and Operation Management System (NEMESYS)
Pada tahun 2019, Indonesia Power membuat karya inovasi yang berjudul Penurunan BPP Komponen-C dengan Energy and Operation Management System (NEMESYS). Tujuan pembuatan karya inovasi ini adalah:- Menentukan komposisi coal blending yang efektif, sesuai
dengan stok dan kebutuhan operasi pembangkitan;- Memberikan referensi pengoperasian udara
pembakaran berdasarkan unsur-unsur batu bara; dan- Mempermudah dalam melakukan perencanaan pasokan
batu bara untuk manajer operasi dan energi primer.
Penerapan karya inovasi ini menghasilkan dampak positif bagi Indonesia Power sebagai berikut:- NEMESYS dapat menentukan komposisi blending yang
efektif sesuai dengan stok dan kebutuhan operasi pembangkit;
- NEMESYS memberikan referensi udara pembakaran dari properties batu bara yang telah ditentukan oleh aplikasi;
- NEMESYS dapat menentukan perencanaan pasokan batu bara berdasarkan histori pengoperasian; dan
- NEMESYS dapat menghemat biaya komponen C sebesar Rp21.217,45 juta/tahun dengan setara penurunan BPP sebesar Rp1,16/kWh.
In 2019, Indonesia Power innovated under the title Reducing C-Component Electricity Generation Cost with the Energy and Operation Management System (NEMESYS). The innovation has the objective to:- Determine effective coal blending composition, in
accordance with the stock and the needs of the generation operation;
- Provide a reference for air combustion based on coal elements; and
- Simplify the planning of coal supply for operations and primary energy managers.
The implementation of this innovative work had a positive impact on Indonesia Power as follows:- NEMESYS is able to determine the effective blending
composition in accordance with the stock and the needs of the generation operation;
- NEMESYS provides a reference of air combustion from the coal properties specified by the application;
- NEMESYS determines the coal supply planning based on operating history; and
- NEMESYS can save C-component costs by Rp21,217.45 million/year, with an equivalent reduction in Electricity Generation Cost of Rp1.16/kWh.
137 Sustainability Report 2019
PT Indonesia Power
Econ
omy
Peningkatan Kepercayaan dan Kepuasan PelangganEnhancement of Customer Trust and Satisfaction
Dalam pelaksanaannya, energi listrik Indonesia Power tidak disalurkan secara langsung kepada pelanggan, melainkan melalui jaringan transmisi kepada PT PLN (Persero) yang merupakan pembeli tunggal daya listrik yang diproduksi oleh Indonesia Power. Namun data prospek industri kelistrikan nasional dari sisi proyeksi jumlah pelangan nasional berdasarkan tipe akun pelanggan adalah sebagai berikut:
Dalam rangka mengetahui tingkat kepuasan, ketidakpuasan dan keterikatan pelanggan, pada tanggal 8 - 26 Oktober 2019, Indonesia Power melaksanakan survei kepuasan pelanggan kepada seluruh Pelanggan Perusahaan yang dilakukan oleh pihak Independen. Aspek yang dinilai dalam survei ini disesuaikan dengan dimensi requirement pelanggan yang dibagi berdasarkan unitnya. Dari hasil survei, diperoleh skor kepuasan pelanggan sebesar 86,17 dengan kategori “sangat memuaskan”. Skor ini mengalami penurunan dari tahun 2018 dikarenakan jumlah keluhan terkait kinerja keandalan pembangkit belum optimal dan stabil, terlebih pada tanggal 4 Agustus 2019 terjadi gangguan black out di sistem kelistrikan dimana pembangkit IP dirasa oleh pelanggan tidak mampu memberikan kesiapan dan kinerja pembangkit yang optimal dan andal. Walaupun secara umum jumlah gangguan/derating sudah lebih baik jumlahnya bila dibandingkan dengan tahun 2018.
In its implementation, Indonesia Power’s electricity is not channeled directly to customers, but through a transmission line to PT PLN (Persero) as the sole buyer of power generated by Indonesia Power. However, the prospects of the national electricity industry from the projection of the number of national customers based on the type of customer account are as follows:
On 8-26 October 2019, Indonesia Power carried out customer satisfaction survey for all Company’s customers, conducted by an Independent party, to understand customer satisfaction, dissatisfaction, and attachment. The survey assessed several aspects, adjusted to the customer requirements based on the unit. The survey resulted in customer satisfaction scores of 86.17 with the category “very satisfying”. This score decreased from 2018 due to the number of complaints related to the reliability performance of the plant that is yet to be optimum and stable. Specifically, on 4 August 2019, there was a blackout of the electricity system, and the customer considered IP generator to be unable to provide optimum and reliable generator readiness and performance. However, in general, the number of disruptions/deratings is lower compared to 2018.
Proyeksi Jumlah PelangganCustomer Projection
Survei Kepuasan PelangganCustomer Satisfaction Survey
Tipe Akun PelangganCustomer Account Type 2020 2021 2022
Rumah Tangga Households 71.588 72.494 73.357
Bisnis Business 4.201 4.448 4.702
Publik Public 2.250 2.391 2.542
Industri Industry 96 100 105
Jumlah Pelanggan Customer 78.135 79.433 80.706
Proyeksi Jumlah Pelanggan Nasional Berdasarkan Tipe Akun Pelanggan [EU3]Projected Number of National Customers by Customer Account [EU3]
Sumber: Rencana Usaha Penyediaan Tenaga Listrik (RUPTL) PLNSource: Electricity Supply Business Plan (RUPTL) of PLN
138 Laporan Keberlanjutan 2019PT Indonesia Power
Ekon
omi
2020 2021 2022
88,88 88,75 86,17
Hasil Survei Kepuasan PelangganResult of Customer Satisfaction Survey
Peningkatan Kepercayaan dan Kepuasan PelangganEnhancement of Customer Trust and Satisfaction
Sebagai tindak lanjut atas hasil survei, Indonesia Power membuat workshop evaluasi hasil survei dan menyusunan action plan Opportunity for Improvement (OFI) kepuasan pelanggan bersama dengan unit pembangkit, perwakilan pelanggan dan divisi terkait. Kemudian pelaksanaan action plan akan di monitoring setiap triwulan.
As a follow-up to the survey results, Indonesia Power conducted an evaluation workshop on the survey results and formulated a customer satisfaction Opportunity for Improvement (OFI) action plan, in collaboration with the generating units, customer representatives, and related divisions. The implementation of the action plans will be monitored quarterly
Indonesia Power melakukan tindak lanjut atas setiap keluhan pelanggan yang dikelola oleh Division of Commerce and Customer Relation I (DIVCST I) untuk pelanggan eksisting dan Division of Primary Energy and Settlement II (DIVPST II) untuk pelanggan jasa O&M, dan dimonitor secara otomatis dalam Aplikasi Harian Deklarasi Ketidaksiapan Pembangkit (HDKP). Selanjutnya, hasilnya dikompilasi dan dievaluasi oleh Vice President CST I, Vice President PST II dan Unit/Divisi terkait, untuk mendapatkan solusi dari masalah yang dihadapi dan kemudian ditindaklanjuti sesuai dengan yang tercantum dalam IPM.06.07. Mekanisme dalam menangani pengaduan dan keluhan pelanggan adalah sebagai berikut:
Pelanggan dapat menyampaikan pengaduan melalui media komunikasi Indonesia Power yaitu email, telepon, website, faksimili, surat dan rapat yang tersedia selama 24 jam sehari dan 7 hari seminggu.
Indonesia Power follows-up on every customer complaint, managed by the Division of Commerce and Customer Relations I (DIVCST I) for existing customers and the Division of Primary Energy and Settlement II (DIVPST II) for O&M service customers. The customer complaint is monitored automatically in the Daily Statement of Plant Unpreparedness (HDKP). Further, the results are compiled and evaluated by the Vice President CST I, Vice President PST II, and related Units/Divisions, to find solutions to the problems encountered and then follow-up on the problems as stated in IPM.06.07. The mechanism in handling customer complaints is as follows:
Customers can submit complaints through Indonesia Power’s communication media: email, telephone, website, facsimile, letters, and meetings, available 24 hours a day and 7 days a week.
Penanganan Pengaduan PelangganCustomer Complaints Handling
Perusahaan menerima
komplain dari pelanggan
The Company receives complaint
from customers
Mengelompokkan jenis komplain dari
pelangganCategorizing
customer complaint type
Identifikasi akar masalah
penyebab komplain
Identifying the root cause of the
complaint
Melakukan evaluasi
penyelesaian kompalin
Evaluating the settlement of
complaint
Membuat laporan dan rekomendasi
Compiling reports and
recommendations
Review terhadap komplain dan
tindak lanjutnyaReviewing
complaints and the follow-up
Menindaklanjuti komplain jika terkait aspek komersial dan meneruskan
komplain ke pihak terkait jika diluar aspek komersial
Following-up on the complaint if it is related to commercial aspects, and
forwarding complaint to related parties if it is unrelated to the commercial aspects
Apabila komplain telah terselesaikan, Perusahaan akan memberikan informasi kepada
pelangganIf the complaint is resolved, the
Company will provide information to the customer
Mekanisme Penanganan Pengaduan PelangganCustomer Complaints Handling Mechanism
139 Sustainability Report 2019
PT Indonesia Power
Econ
omy
Adapun selama tahun 2019, Indonesia Power tidak menerima pengaduan dari pelanggan terkait aspek kesehatan dan keselamatan pelanggan dalam pendistribusian listrik kepada pelanggan dan juga terkait aspek ketidakpatuhan atas penyediaan informasi produk dan komunikasi pemasaran, sehingga Indonesia Power tidak mendapat sanksi moneter maupun moneter.
During 2019, Indonesia Power did not receive complaints from customers in terms of customer health and safety in the electricity transmission to the customers, or in terms of non-compliance in relation to provisions of product information and marketing communications. Thus, Indonesia Power was not sanctioned monetary or otherwise.
Media Komunikasi
UtamaMain
Communication Media
PLN melalui PLN UI P2B (energi listrik 500kV dan 150 kV)
PLN through PLN UI P2B(500kV and 150 kV electricity)
PLN melalui PLN Distribusi (energi listrik ≤20kV)
PLN through PLN Distribusi (electricity ≤20kV)
PLN pelanggan jasa O&M
PLN as the customer of O&M
services
TeleponPhone
Telepon021-526 7666- Ext.2222/3333: Operasional real time (ETMC)- Ext.2222/3333: Realisasi kinerja pembangkitHDKP- WA Group-ROM P2B-IP: komunikasi ROM- Handphone ETMC 0811 937 740: Kondisi pembangkit dan
operasional- Hotline Unit Pembangkit: Naik turun beban, Start-stop
pembangkit, kondisi pembangkitPhone021-526 7666- Ext.2222/3333: Real-time operations (ETMC)- Ext.2222/3333: Realization of generator performanceHDKP- WA Group-ROM P2B-IP: ROM communication- Handphone ETMC 0811 937 740: Plant conditions and
operations- Power Plant Hotline: load fluctuation, power plant start-
stop, plant conditions
- 021-526 7666- Handphone ETMC: 0811
937 740- Telepon direct ETMC: 021-
522 9813- 021-526 7666- ETMC Mobile: 0811 937
740- Direct Call to ETMC: 021-
522 9813
- 021-526 7666: koordinasi, progres, kajian
- Telepon personal: koordinasi, progres, kajian
- 021-526 7666: coordination, progress, review
- Personal phone: coordination, progress, review
Website
- Aplikasi HDKS: naik turun beban dan start-stop pembangkit- Aplikasi HDKP IKP: ketidaksiapan pembangkit- Aplikasi GAIS: kinerja pembangkit- Aplikasi JBOS Plan: perencanaan pembangkit- Aplikasi Rapsodi: kondisi sistem- Aplikasi Neraca Energi: kWh energi- HDKS application: load fluctuation and power plant start-
stop- HDKP IKP: power plant unreadiness- GAIS: power plant performance- JBOS Plan: power plant planning- Rapsodi: system condition- Neraca Energi app: kWh of the energy
- -
[email protected] operasi, operasional real timeoperation planning, real-time operations
E-mail ke DIV CST I/personal e-mail: Settlement/kontrakE-mail to DIV CST I/personal e-mail: Settlement/contract
E-mail ke DIV EPS II/ personal e-mailE-mail to DIV EPS II/personal e-mail
Surat Letter
PT Indonesia PowerCentennial Tower, Jl. Jend. Gatot Subroto Kav 24-25, Jakarta Selatan, 12950: Settlement/Kontrak Settlement/contract
PT Indonesia PowerCentennial Tower, Jl. Jend. Gatot Subroto Kav 24-25, Jakarta Selatan, 12950: Settlement/KontrakSettlement/contract
-
Rapat Meeting
Rapat Alokasi Energi (RAE) dan Rapat pembahasanKontrak dan SettlementEnergy Allocation Meeting (RAE) and Contract and Settlement Discussion Meeting
Rapat pembahasan kontrak dan settlementMeeting on contract and settlement discussions
Rapat Jasa O&MO&M Services Meeting
Media Komunikasi Pengaduan PelangganCommunication Media for Customer Complaints
140 Laporan Keberlanjutan 2019PT Indonesia Power
Mengelola Dampak Lingkungan, Menjaga
Kelestarian BumiManaging Environmental Impacts,Maintaining Earth’s Sustainability
LINGKUNGAN ENVIRONMENTAL
141 Sustainability Report 2019PT Indonesia Power
Komitmen Indonesia Power untuk senantiasa melaksanakan pengelolaan lingkungan secara efektif, menyeluruh dan
berkesinambungan berhasil menghantarkan Perusahaan meraih 19 PROPER di penghujung tahun 2019. Indonesia Power
juga terus menunjukkan kinerja unggul dalam mendukung upaya Pemerintah mewujudkan kemandirian energi melalui
eksekusi langkah strategis Perusahaan dalam mengakselerasi pengembangan dan pemanfaatan Energi Baru Terbarukan (EBT).
Hal ini menunjukkan peran strategis Indonesia Power untuk senantiasa menyelenggarakan bisnis pembangkitan tenaga listrik
yang Aman, Bersih, Hijau, Andal dan Efisien yang sejalan dengan target Tujuan Pembangunan Berkelanjutan.
Indonesia Power’s commitment to carrying out environmental management effectively, thoroughly, and continuously, succeeded in delivering the
Company to achieve 19 PROPERs at the end of 2019. Indonesia Power shows excellent performance in supporting the Government’s efforts to realize
energy independence, through the Company’s strategic steps in accelerating the development and utilization of New Renewable Energy (NRE). This reflects
Indonesia Power’s strategic role to engage in a power generation business that is Safe, Clean, Green, Reliable, and Efficient, in line with the target of the
Sustainable Development Goals.
142 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Ikhtisar Pencapaian Kinerja LingkunganEnvironmental Performance Highlight
Pada tahun 2019, Indonesia Power melakukan berbagai program inovasi dalam mengelola dampak lingkungan dan melaksanakan program pelestarian lingkungan yang semakin menguatkan keunggulan Perusahaan dalam menyelenggarakan bisnis pembangkitan tenaga listrik dengan Aman, Bersih, Hijau, Andal dan Efisien. Indonesia Power berhasil melakukan efisiensi energi sebesar 41.779.993,04 Gigajoule, melakukan pengurangan emisi sebesar 2.286.006,72 ton CO2, melakukan konservasi air sebesar 1.641.661,69 m3, melakukan pemanfaatan limbah B3 sebanyak 822,49 ton, melakukan konservasi flora dan fauna dan melakukan pengembangan dan Pembangkit Energi Baru Terbarukan (EBT).
Dengan berbagai upaya pengelolaan kinerja lingkungan tersebut, pada tahun 2019 Indonesia Power meraih 19 PROPER dari Kementerian Lingkungan Hidup dan Kehutanan (KLHK) yang terdiri dari 2 PROPER Emas, 11 PROPER Biru dan 6 PROPER Biru. Raihan 2 Proper Emas di tahun ini ditorehkan oleh 2 unit pembangkit Indonesia Power, yaitu PLTDG Pesanggaran dan PLTP Kamojang-Darajat. Pencapaian ini merupakan bukti upaya pengelolaan lingkungan Indonesia Power dilakukan secara efektif, menyeluruh dan berkesinambungan.
In 2019, Indonesia Power carried out various innovation programs in managing environmental impacts and carrying out environmental preservation programs that further strengthened the Company’s excellence in conducting the power generation business that is Safe, Clean, Green, Reliable, and Efficient. Indonesia Power succeeded in carrying out energy efficiency by 41,779,993.04 Gigajoule, reducing emissions by 2,286,006.72 tons of CO2, saving water by 1,641,661.69 m3, utilizing 822.49 tons of B3 waste, conserving flora and fauna, and developing and constructing New Renewable Energy (NRE) Power Plant.
In 2019, with various efforts to manage environmental performance, Indonesia Power obtained 19 PROPERs from the Ministry of Environment and Forestry (KLHK), consisting of 2 Gold PROPERs, 11 Blue PROPERs, and 6 Blue PROPERs. The 2 Gold PROPERs this year were achieved by two of Indonesia Power’s Generating Unit, i.e. Pesanggaran DGPP and Kamojang-Darajat GPP. This achievement is evidence that Indonesia Power’s environmental management efforts are carried out effectively, comprehensively, and in a sustainable manner.
143 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Pencapaian Kinerja LingkunganEnvironmental Performance Achievement
Konservasi AirWater Savings
1.641.661,69m3
Pemanfaatan Limbah B3Utilization of B3 Waste
822,49ton
Efisiensi EnergiEnergy Efficiency
41.779.993,04Gigajoule
KonservasiConservation
Elang Jawa, Jalak Bali, Penyu Lekang, Sapi Putih Taro, Tukik, Rusa Timor, Badak Jawa, Mangrove, Terumbu Karang, Pohon Endemik dan Tanaman LangkaJavan Hawk-Eagle, Bali Myna, Olive Ridley Sea Turtle, White Taro Ox, Tukik, Javan Rusa, Javan Rhinoceros, Mangrove, Coral Reef, Endemic Tree, and Rare Plant
PengembanganPembangkit EBTNRE Plant Development
PLTA, PLTP, PLTM, Pembangkit Listrik HybridHPP, GPP, MHPP, Hybrid Power Plants
Pengurangan EmisiEmission Reduction
2.286.006,72ton CO2 tons of CO2
Indonesia Green Company Achievement
Indonesia Green Company Achievement
Subroto AwardSubroto Award
Winner ASEAN Coal Awards
Winner ASEAN Coal Awards
Raihan PROPER19 PROPERs
19
144 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Hasil Penilaian PROPER Indonesia Power [GRI 102-12, 103-3]Indonesia Power PROPER’s Assessment Results [GRI 102-12, 103-3]
Ikhtisar Pencapaian Kinerja LingkunganEnvironmental Performance Highlight
Unit
Sertifikasi Sistem Manajemen Lingkungan (Masa Berlaku)Environment Management
System Certification (Validity)
Peringkat Peringkat
2012 2013 2014 2015 2016 2017 2018 2019
Suralaya PGUSuralaya PGU
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
Priok POMUPriok POMU
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
Semarang TambakLorok PGUSemarang TambakLorok PGU
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
PLTG SunyaragiSunyaragi GTPP
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
Grati POMUGrati POMU
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
PLTDG PesanggaranPesanggaran GTPP
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
PLTG GilimanukGilimanuk GTPP
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
PLTG PemaronPemaron GTPP
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
Kamojang-Darajat POMUKamojang-Darajat POMU
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
PLTP Gunung SalakGunung Salak GPP
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
Labuan OMU (BLB)*Labuan OMU (BLB)*
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
Lontar OMU (BLT)*Lontar OMU (BLT)*
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
Suralaya 8 OMU (BSR)*Suralaya 8 OMU (BSR)*
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
Pelabuhan Ratu OMU (JPR)*Pelabuhan Ratu OMU (JPR)*
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
Cilegon OMU (CLG)*Cilegon OMU (CLG)*
ISO 14001:2004 (Desember 2016)ISO 14001:2004 (December 2016)
PLTA Saguling POMU (SGL)HPP Saguling POMU (SGL)
-
PLTU Jawa Tengah 2 Adipala OMU (ADP)SPP Central Java 2 Adipala OMU (ADP)
-
PLTA Mrica PGU (MRC)HPP Mrica PGU (MRC)
-
PLTA Mrica PGU - Sub Unit Wonogriri (WNG)HPP Mrica PGU - Wonogriri Sub-Unit (WNG)
-
PLTU Jeranjang OMU (JRJ)SPP Jeranjang OMU (JRJ)
-
* Pengelolaan OMU di atas sebagai asset manager dimulai pada tahun 2016 sebelumnya dilakukan oleh Unit Pembangkitan Jawa Bali (UPJB) PT PLN (Persero)
OMU management as an asset manager mentioned above began in 2016, previously carried out by the Unit Pembangkitan Jawa Bali (UPJB) of PT PLN (Persero)
Emas Gold
Hijau Green
Biru Blue
Belum Not yet
Sudah tidak terdaftar No longer registered
145 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Konsep Green Power PlantGreen Power Plant Concept
Tantangan dan StrategiPengelolaan Lingkungan [GRI 102-15]Challenges and Strategiesin Environmental Management [GRI 102-15]
Hingga kini, perubahan iklim tetap terus menjadi tantangan lingkungan dan kesehatan yang akan dihadapi di masa depan. Para ilmuwan percaya bahwa alasan utama peningkatan konsentrasi CO2 yang merupakan gas utama rumah kaca berasal dari pembakaran bahan bakar fosil dan aktifitas manusia lainnya. Oleh karena itu, untuk membatasi kenaikan hingga 1,5 derajat Celsius sesuai Kesepakatan Paris (COP21 Paris) yang membatasi kenaikan suhu global di bawah 2 derajat Celsius, Pemerintah Indonesia berkomitmen untuk menurunkan emisi sebesar 29% pada tahun 2030 dan 41% dengan bantuan internasional. Pada bidang ketenagalistrikan, komitmen ini diterjemahkan dengan penurunan faktor emisi dari 0,808 ton CO2/MWh pada tahun 2017 menjadi 0,665 ton CO2/MWh pada 2026.
Guna menjawab tantangan tersebut, Indonesia Power telah merumuskan stategis pengelolaan lingkungan yang berorientasi pada perwujudan Green Power Plant yaitu pembangkit tenaga listrik yang beroperasi secara andal, aman dan ramah lingkungan. Komitmen ini tercantum dalam Keputusan Direksi Nomor 249.K/010/IP/2015 tentang Pedoman Penerapan Green Power Plant di Lingkungan PT Indonesia Power yang wajib diterapkan di seluruh unit pembangkit Perusahaan.
To date, climate change continues to be an environmental and health challenge that will be faced in the future. Scientists conclude that the main reason for the increase in the CO2 concentration, which is the main greenhouse gas, comes from the burning of fossil fuels and other human activities. Therefore, to limit the increase of 1.5 degrees Celsius, in accordance with the Paris Agreement (COP21 Paris), that stipulates the limit of global temperature increase of below 2 degrees Celsius, the Government of Indonesia is committed to reducing emissions by 29% in 2030, and 41% with international assistance. In the electricity sector, this commitment translates into a reduction in emission factors from 0.808 tons of CO2/MWh in 2017 to 0.665 tons of CO2/MWh in 2026.
Indonesia Power has formulated strategic environmental management, with the objective to realize Green Power Plant, i.e. power plant that operates reliably, safely, and environmentally friendly, to answer these challenges. This commitment is stated in the Board of Directors’ Decree No. 249.K/010/IP/2015 on Guidelines on Green Power Plant Implementation within PT Indonesia Power, which shall be applied in all of the Company’s generating units.
Melakukan efisiensi penggunaan sumber daya proses operasi bisnis di lndonesia Power.Efficient use of resources utilization during business process in Indonesia Power.
Meningkatkan konsep bangunan sehat dan hemat untuk setiap properti yang berada di lndonesia Power.Improving healthy and economical building concept for every property of Indonesia Power.
Langkah untuk menggunakan inputan yang ramah lingkungan melalui seleksi supplier bahan baku.Steps to use environmentally-friendly inputs through selection of raw material suppliers.
Penerapan aktivitas ramah lingkungan dengan kebijakan terkait proses akuntansi keuangan yang berjalan dalam perusahaan dan bagian SDM dengan pertimbangan Sustainability.Environmentally-friendly activities with policies related to financial accounting processes within the Company and the HR department with due regards to Sustainability.
Pengembangan Sistem Informasi dengan Teknologi canggih untuk mengelola data dan informasi.Information Systems Development of sophisticated technology to manage data and information.
Green Operation
Green Building
GreenSupply Chain
Green Finance, Accounting & Human
Resources
Green Information Technology
146 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Program Green Power Plant yang dilakukan selama tahun 2019 meliputi:1. Pemantauan, pemeriksaan, evaluasi dan pembinaan
pengelolaan lingkungan untuk seluruh PGU, OMU dan Kantor Pusat;
2. Pendampingan, pemeriksaan dan koordinasi dalam penyusunan Dokumen Comply Regulation dan Beyond Compliance;
3. Melakukan upaya peningkatan kompetensi personil lingkungan dengan pelatihan dan sertifikasi manajer pengendalian udara dan manajer pengendalian air;
4. Melakukan penghijauan di lingkungan Unit Pembangkit dengan menanam berbagai jenis pohon endemik yang berdampak untuk mereduksi emisi dan meningkatkan indeks keanekaragaman hayati;
5. Memberikan penghargaan prestasi pengelolaan lingkungan pada Unit yang telah berhasil dalam pencapaian Kinerja Pengelolaan Lingkungan; dan
6. Melakukan kunjungan dan koordinasi kepada pihak eksternal terkait bidang lingkungan melalui acara Workshop Lingkungan.
Strategi lain yang dijalankan Indonesia Power untuk menjawab tantangan lingkungan adalah secara berkesinambungan melakukan pemanfaatan dan pengembangan pembangkit yang bersumber dari panas bumi, air dan sumber EBT lainnya. Hal ini juga bertujuan untuk mendukung pencapaian target porsi bauran energi pembangkitan listrik pada tahun 2025 yang terdiri dari 23% EBT, 54,6% batubara, 22% gas dan 0,4% BBM sebagaimana tertuang dalam Rencana Usaha Penyediaan Tenaga Listrik PT PLN (Persero) 2019-2028.
Green Power Plant program carried out during 2019 includes:
1. Monitoring, checking, evaluating, and guiding environmental management for all PGU, OMU, and Head Office;
2. Assistance, inspection, and coordination in the formulation of Comply Regulation and Beyond Compliance Documents;
3. Striving to improve the competence of environmental personnel with training and certifying air control managers and water control managers;
4. Greening in the environment of the Generating Unit by planting various endemic tree species that have an impact to reduce emissions and increase the biodiversity index;
5. Granting awards for environmental management achievements to the Unit that has succeeded in achieving Environmental Management Performance; and
6. Conducting visits and coordination with external parties related to the environmental sector through the Environmental Workshop.
Indonesia Power conducted another strategy to respond to environmental challenges, i.e. continuously utilizing and developing plants sourced from geothermal, water, and other NRE sources. This supports the achievement of the target of the electricity generation energy mix in 2025, consisting of 23% of NRE, 54.6% of coal, 22% of gas, and 0.4% of Oil Fuel, as stated in the 2019-2028 Electricity Supply Business Plan of PT PLN (Persero).
Tantangan dan Strategi Pengelolaan LingkunganChallenges and Strategies in Environmental Management
147 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Sistem Manajemen Lingkungan [GRI 102-12]Environment Management System [GRI 102-12]
Untuk meningkatkan standar pengelolaan lingkungan sesuai standar internasional, Indonesia Power menerapkan Sistem Manajemen Lingkungan yang mengacu kepada ISO 14001:2015 yang telah terintegrasi dengan Indonesia Power Integrated Management System (IP IMS) yang telah diterima sejak tanggal 14 Februari 2017. Penerapan Sistem Manajemen Lingkungan Indonesia Power selama tahun 2019 adalah sebagai berikut:1. Memenuhi peraturan perundang-undangan mengenai
lingkungan dan persyaratan pelanggan serta standar nasional dan internasional yang berlaku serta berkaitan dengan proses bisnis Perusahaan;
2. Menerapkan dan melaksanakan secara konsisten Sistem Manajemen Lingkungan;
3. Melakukan monitoring, evaluasi dan audit internal Sistem Manajemen Lingkungan secara periodik;
4. Menjadikan kebijakan lingkungan sebagai dasar dalam menetapkan tujuan dan sasaran dalam melakukan pengelolaan lingkungan;
5. Mencegah pencemaran terhadap air, tanah dan udara, mendorong adanya sistem pengelolaan lingkungan yang efektif dengan mengutamakan konsep Reduce, Reuse, Recycle (3R) limbah padat non B3 (sampah) serta pengurangan dan pemanfaatan limbah B3 mengurangi pemakaian freon untuk mengurangi pencemaran udara dan melaksanakan program penghijauan guna menurunkan emisi dan gas rumah kaca, mendorong penggunaan transportasi yang efisien pada semua kegiatan serta melakukan uji emisi kendaraan secara berkala, mengembangkan konservasi sumber daya alam melalui efisiensi energi secara efektif dalam konsumsi energi listrik, melakukan upaya konservasi air dengan menerapkan proses Reduce, Reuse, Recycle dan Recovery (4R), mengoptimalkan penggunaan air laut untuk sirkulasi air pendingin, mendorong program kepedulian dan pengembangan masyarakat sekitar (Community Development/CSR) dan program perlindungan keanekaragaman hayati;
6. Memberikan pemahaman/kepedulian dan pelatihan mengenai lingkungan secara terus menerus kepada seluruh pegawai baik organic maupun mitra kerja;
7. Meningkatkan peran aktif dan menanamkan kepedulian pegawai terhadap lingkungan;
8. Memelihara dan mendokumentasikan dokumen-dokumen terkait Sistem Manajemen Lingkungan;
9. Mengkomunikasikan kebijakan lingkungan kepada seluruh kontraktor/supplier atau mitra kerja untuk dapat mengikuti kebijakan serta mengkomunikasikan kepada masyarakat setempat; dan
10. Melakukan perbaikan berkelanjutan, penyempurnaan dan peningkatan secara terus menerus terhadap sasaran organisasi pada setiap proses bisnis masing-masing bidang.
Indonesia Power applies an Environmental Management System that refers to ISO 14001:2015, granted since 14 February 2017, which has been integrated with the Indonesia Power Integrated Management System (IP IMS) to improve environmental management standards according to the international standards. The application of Indonesia Power’s Environment Management System in 2019 is as follows:
1. Meeting the laws and regulations regarding the environment and customer requirements as well as applicable national and international standards that are related to the Company’s business processes;
2. Consistently implementing and carrying out Environmental Management System;
3. Conducting regular monitoring, evaluation, and internal audit of the Environmental Management System;
4. Cultivating environmental policies as the basis for setting environmental management’s goals and objectives;
5. Preventing pollution of water, soil, and air, encouraging an effective environmental management system by prioritizing the concept of Reduce, Reuse, Recycle (3R) of non-B3 solid waste, and reducing and utilizing B3 waste to reduce freon to reduce air pollution, and implementing greening programs to reduce emissions and greenhouse gases, encouraging the efficient use of transportation in all activities, and conducting vehicle emissions testing regularly, developing natural resource conservation through effective energy efficiency in electricity consumption, conducting water savings efforts by implementing the Reduce, Reuse, Recycle, and Recovery (4R) process, optimizing the seawater used for cooling water circulation, encouraging community awareness and community development programs (Community Development/CSR), and implementing biodiversity protection programs;
6. Providing continuous understanding/awareness and training regarding the environment to all organic employees and work partners;
7. Increasing the active role and cultivating employee awareness of the environment;
8. Maintaining and documenting documents related to the Environmental Management System;
9. Communicating environmental policies to all contractors/suppliers or partners to be able to follow the policies, and communicating it to the local community; and
10. Improving, refining, and enhancing continuously for the organizational goals in every business process in every field.
148 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pengelolaan Dampak LingkunganEnvironmental Impact Management
Indonesia Power secara rutin dan konsisten melakukan identifikasi potensi dampak signifikan terhadap lingkungan yang diakibatkan oleh kegiatan operasi Perusahaan beserta tindakan penanggulangannya. Indikator yang dijadikan analisis yaitu energi, emisi, sumber daya air, limbah dan keanekaragaman hayati.
Indonesia Power routinely and consistently identifies potentially significant impacts on the environment caused by the Company’s operations, and identifies the mitigation actions. Indicators used as analysis are energy, emissions, water resources, waste, and biodiversity.
No.Kegiatan Operasi
PerusahaanCompany’s Operations
Potensi Dampak Teridentifikasi
Potential Impacts Identified
Tindakan PenanggulanganMitigation
1 Proses Pendinginan di Kondensor dan Gas Buang Sisa Pembakaran di BoilerCooling Process in Condensers and Exhaust Gas of Boiler Combustion
Perubahan Iklim:- Pencemaran Udara - Peningkatan Suhu Air
Laut- Peningkatan
Temperature Air Pendingin
Climate Change:- Air Pollution - Increased Seawater
Temperature- Increased Cooling Water
Temperature
- Pengendalian pola operasi dan pemantauan secara intensif untuk tetap menjaga efisiensi proses pendingin kondensor dan menjaga pemenuhan baku mutu temperature buangan air pendingin
- Pengendalian kualitas bahan baku/bahan bakar batubara yang masuk ke dalam pembakaran boiler melalui proses pencampuran/mixing/blending batubara
- Pemantauan emisi gas buang secara continue melalui Continuous Emission Monitoring System (CEMS) dan periodik melalui pemantauan laboratorium
- Kajian perencanaan investasi dan pemasangan alat pengendali emisi terhadap unit yang memiliki potensi ketidaktaatan dalam pemenuhan baku mutu emisi
- Peningkatan peluang inovasi pengembangan pembangkit Energi Baru Terbarukan (EBT) dan pengembangan teknologi yang menghasilkan efisiensi energi secara continue di seluruh Unit
- Intensive control of operating patterns and monitoring to maintain the efficiency of the condenser cooling process and maintain compliance with the cooling water discharge temperature quality standards
- Control the quality of raw materials/coal fuel that enters the combustion of the boiler through the process of mixing/blending coal
- Monitoring exhaust emissions continuously through the Continuous Emission Monitoring System (CEMS) and periodically through laboratory monitoring
- Study of investment planning and installation of emission control devices for units that have the potential for non-compliance in meeting emission quality standards
- Increasing the innovation opportunities in developing New Renewable Energy (NRE) and developing technologies that continuously produce energy efficiency in all Units
2 Limbar Cair dari Siklus Uap Air PembangkitWastewater from the Steam Generating Water Cycle
Pencemaran AirWater Pollution
- Pengendalian operasi dan pengelolaan limbah cair- Pemantauan secara rutin baku mutu limbah cair- Control of operations and management of liquid waste- Routine monitoring of wastewater quality standards
3 Sisa/Kontaminasi Penggunaan B3Residual/Contamination of B3 Utilization
Pencemaran Limbah B3B3 Waste Pollution
- Pengelolaan limbah B3 sesuai dengan syarat dan ketentuan di dalam izin maupun sesuai dengan peraturan yang berlaku
- Upaya 3R limbah B3 dengan mengajukan izin pemanfaatan limbah B3- B3 waste management is in accordance with the terms and conditions
in the permit, and in accordance with applicable regulations- 3R Effort for B3 waste by applying for a permit to use B3 waste
4 Pembuangan Air Pendingin Kondensor ke LautDischarge of Condenser Cooling Water into the Sea
Pencemaran habitat sekitar:Kerusakan Ekosistem Laut dan Habitat Terumbu KarangPollution of the surrounding habitat:Damage to Marine Ecosystems and Coral Reef Habitat
- Pengendalian temperatur operasional- Pemantauan dan pengukuran secara rutin sesuai pemenuhan baku
mutu- Konservasi mangrove dan terumbu karang- Operational temperature control- Regular monitoring and measurement in accordance with compliance
with quality standards- Conservation of mangrove and coral reefs
Upaya Penanggulangan Dampak Lingkungan Hidup [GRI 102-15, 201-2,, 304-2]Efforts to Reducing Environmental Impact [GRI 102-15, 201-2,, 304-2]
149 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
150 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pendekatan Manajemen Topik Pengelolaan Energi[GRI 103-1, 103-2, 103-3]Management Approach toEnergy Management[GRI 103-1, 103-2, 103-3]
Topik Pengelolaan Energi menjadi topik yang penting bagi Indonesia Power karena sebagai perusahaan energi terbaik yang tumbuh berkelanjutan, Indonesia Power perlu melakukan berbagai hal untuk meningkatkan Kinerja Energi yang melibatkan seluruh pegawai, mengurangi biaya produksi dan pengurangan emisi sehingga dapat melampaui harapan pelanggan.
Energy Management is an important topic for Indonesia Power because as the best energy company that grows in a sustainable manner, Indonesia Power needs to conduct various matters to improve Energy Performance involving all employees, reduce production costs, and reduce emissions, to exceed customer expectations.
Pengelolaan EnergiEnergy Management
Pengelolaan Dampak LingkunganEnvironmental Impact Management
Kebijakan Perusahaan- Keputusan Direksi Nomor 41.K/010/IP/2012 tentang
Kebijakan Keselamatan dan Kesehatan Kerja serta Lingkungan di PT Indonesia Power
- Keputusan Direksi Nomor 249.K/010/lP/2015 tentang Pedoman Penerapan Green Power Plant Di Lingkungan PT Indonesia Power
- Keputusan Direksi Nomor 57.K/010/IP/2010 tentang Manajemen pembangkit yang di dalamnya terdapat pengelolaan energi yaitu Manajemen efisiensi
- Edaran Dieksi Nomor 27.E/012/IP/2014 tentang Pedoman Manajemen Efisiensi Listrik Pembangkit Thermal di Lingkungan PT Indonesia Power
Ketentuan Umum- Undang - Undang Nomor 30 tahun 2007 tentang Energi- Peraturan Pemerintah Nomor 79 tahun 2014 tentang
Kebijakan Energi Nasional- Peraturan Menteri ESDM Nomor 14 tahun 2012 tentang
Manajemen Energi- Peraturan Pemerintah Nomor 70 tahun 2009 tentang
Konservasi Energi dan Manager/Auditor Energi
Company’s Policies:- Board of Directors’ Decree No. 41.K/010/IP/2012 on
Occupational Health and Safety Policy within PT Indonesia Power
- Board of Directors’ Decree Number 249.K/010/IP/2015 on Guidelines on Green Power Plant Implementation within the environment of PT Indonesia Power.
- Board of Directors’ Decree No. 57.K/010 IP/2010 on the Plant Management, which includes energy management, i.e. efficiency management
- Board of Directors’ Circular No. 27.E/012/IP/2014 on the Guidelines for the Electricity Efficiency Management in Thermal Power Plant within PT Indonesia Power
General Provisions- Law No. 30 of 2007 on Energy - Government Regulation No. 79 of 2014 on National Energy
Policy;- Minister of EMR Regulation No. 14 of 2012 on Energy
Management- Government Regulation No. 70 of 2009 on Energy
Conservation and Energy Managers/Auditors
KebijakanPolicy
151 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
- Perbaikan keandalan dan efisiensi pembangkit melalui program Life Cycle Management (LCM), program peningkatan efisiensi dan konservasi energi sebagai Strategic Initiatives yang tercantum dalam Rencana Jangka Panjang 2019 – 2023
- Menetapkan langkah – langkah peningkatan efisiensi yang diformalkan dalam Sistem Manajemen Terintegrasi dalam pilar Manajemen Efisiensi dan diatur dalam Pedoman Pelaksanaan Manajemen Efisiensi Thermal melalui Surat Edaran Nomor 27.E/012/IP/2014
- Improving the reliability and efficiency of the plant through the Life Cycle Management (LCM) program, programs to increase energy efficiency and conservation as a Strategic Initiatives listed in the 2019-2023 Long-Term Plan
- Establishing efficiency improvement measures formalized in the Integrated Management System in the Efficiency Management pillar and regulated in the Guidelines for Implementing Thermal Efficiency Management through Circular Letter No. 27.E/012/IP/2014
- Meningkatkan efisiensi pembangkit
- Hasil efisiensi energi masuk 25% terbaik dalam penilaian PROPER
- Bolstering generator efficiency- The best energy efficiency
resulted in the best 25% of PROPER assessment
- Implementasi Efisiensi Energi Melalui Program Peningkatan dan Pembudayaan Manajemen Efisiensi Energi (PPE) dengan Efisiensi energi sebesar 41.779.993,04 Gigajoule
- Energy Efficiency Implementation through the Energy Efficiency Management (PPE) Improvement and Cultivation Program with efficiency of 41,779,993.04 Gigajoules
- Peningkatan dan Pembudayaan Efisiensi Energi Ekselen melalui Program Enhancing and Embedding Energy Efficiency Excellence (5E)
- Program Audit Energi dan Inovasi Penurunan Emisi
- Penerapan Energy Management System sesuai ISO 50001:2018
- Program Sertifikasi ISO 50001:2018
- Enhancing and Cultivating Energy Efficiency Excellence through the Enhancing and Embedding Energy Efficiency Excellence (5E) Program
- Energy Audit and Emission Reduction Innovation Program
- Energy Management System implementation in line with ISO 50001:2018
- Certification Program of ISO 50001:2018
Kantor Pusat:- Bidang Lingkungan yang berada di
bawah Vice President Health, Safety and Environment
- Head of Research, Innovation and Knowledge Management
- Head of Power Generation Engineering- Vice President of Primary Energy I- Vice President of Primary Energy And
Settlement IUnit Kerja: Manajer Operasi
Head Office:- Environmental sector, which is the
responsibility of the Vice President Health, Safety, and Environment
- Head of Research, Innovation and Knowledge Management
- Head of Power Generation Engineering- Vice President of Primary Energy I- Vice President of Primary Energy And
Settlement IWork Unit: Operations Manager
- Melaksanakan pemantauan dan evaluasi program-program Efisiensi Energi dan Efficiency Improvement Performance Pembangkit di tahun 2019 dan melakukan Sertifikasi ISO 50001:2018
- Conducting monitoring and evaluation of Energy Efficiency and Efficiency Improvement Performance of the Generating Unit programs in 2019, and carrying out ISO 50001:2018 Certification
KomitmenCommitment
RealisasiRealization
Sasaran dan TargetGoals and Targets
EvaluasiEvaluation
Program/InisiatifProgram/Initiative
Penanggung JawabPerson in Charge
152 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pengelolaan Dampak LingkunganEnvironmental Impact Management
Sebagai bahan baku dalam proses produksi listrik, Indonesia Power menggunakan energi primer yang berasal dari energi fosil dan Energi Baru Terbarukan (EBT). Perhitungan/pengukuran penggunaan energi dilakukan dengan cara menghitung jumlah konsumsi energi fosil dan EBT dalam satuan masing-masing yang kemudian dikonversi ke dalam satuan gigajoule (GJ). Sumber faktor konversi menggunakan General Converter for Energy dari International Energy Agency (IEA).
Selama tahun 2019, total penggunaan energi pembangkit Eksisting Perusahaan sebesar 464.711.748 GJ, menurun 7,90% dibandingkan tahun 2018 yaitu sebesar 504.585.640 GJ. Hal ini menunjukkan keberhasilan Perusahaan dalam menekan penggunaan energi di tahun 2019.
In the process of electricity generation, Indonesia Power uses primary energy as raw material, which is derived from fossil energy and New and Renewable Energy (NRE). Energy usage is calculated/measured by calculating total fossil energy consumption and NRE in their respective units, which are then converted into gigajoules (GJ). The conversion factor uses General Converter for Energy from International Energy Agency (IEA).
During 2019, the Company’s total Existing energy consumption was 464,711,748 GJ, which increased by 7.90% compared to 2018, which was 504,585,640 GJ. This shows the Company’s success in suppressing energy usage in 2019.
Penggunaan Energi PrimerPrimary Energy Use
Jenis EnergiEnergy Type
Volume Gigajoule
SatuanUnit 2017 2018 2019 2017 2018 2019
Energi Fosil Fossil Energy
Batubara Coal Ton 12.363.517 12.695.811 12.235.690 362.345.011 372.083.750 358.598.708
High Speed Diesel (HSD) Kliter 24.671 201.965 36.604 991.716 8.118.514 1.471.394
Marine Fuel Oil (MFO) Kliter 8.351 28.050 13.980 335.690 1.127.543 561.963
Gas Alam Natural Gas BBTU 104.943 96.396 79.074 110.721.162 101.703.384 83.427.814
Jumlah Konsumsi Energi Fosil Total Fossil Energy Consumption 474.393.578 483.033.192 444.059.879
Energi Terbarukan Renewable Energy
Panas Bumi Geothermal MWh 2.654.480 2.734.994 2.619.638 9.556.128 9.845.978 9.430.697
Air Water MWh 4.293.840 3.250.178 3.108.095 15.457.824 11.700.641 11.189.142
BioFame Kliter - 145 797 - 5.829 32.030
Jumlah Konsumsi Terbarukan Total Renewable Energy Consumption 25.013.952 21.552.448 20.651.869
Total 499.407.530 504.585.640 464.711.748
Penggunaan Energi Berdasarkan Jenis Energi [GRI 302-1]Energy Consumption by Energy Type [GRI 302-1]
Faktor Konversi:1 Ton Ekuivalen Batubara = 29,3076 Gigajoule1 Kliter = 40,1976279848 Gigajoule1 MMBTU = 1,05506 Gigajoule1 BBTU = 1.055,06 Gigajoule1 MWh = 3,6 Gigajoule
Conversion Factor:1 Ton of Equivalent Coal = 29.3076 Gigajoules1 Kliter = 40.1976279848 Gigajoules1 MMBTU = 1.05506 Gigajoules,1 BBTU = 1,055.06 Gigajoule1 MWh = 3.6 Gigajoules
153 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Untuk melihat total pemakaian energi per setiap produksi tenaga listrik guna mengetahui tingkat efisiensi penggunaan energi, Indonesia Power melakukan perhitungan rasio intensitas energi dengan menggunakan denominator total produksi listrik. Jenis energi yang termasuk dalam perhitungan rasio intensitas energi terdiri dari batubara, HSD, MFO, gas alam, panas bumi, air dan BioFame yang merupakan energi yang dikonsumsi dalam Perusahaan (bahan baku dalam proses produksi listrik).
Pada tahun 2019, rasio intensitas energi Perusahaan sebesar 11.881,30 GJ/GWh, menurun 1,23% dibandingkan tahun 2018 yaitu sebesar 12.029,82 GJ/GWh. Hal ini menunjukkan keberhasilan Perusahaan dalam menekan penggunaan energi di tahun 2019.
Pada tahun 2019, Indonesia Power mulai menghitung penggunaan energi di luar Perusahaan yang bersumber dari transportasi bahan bakar yang dibeli yakni Marine Fuel Oil (MFO). Asumsi data fuel consumption per day mengacu pada calculator freight cost konsultan dikalikan dengan banyak trip per tahun yang mengacu pada realisasi volume pasokan batubara di tahun tersebut. Perhitungan/pengukuran penggunaan energi dilakukan dengan cara menghitung jumlah konsumsi energi dalam satuan Kliter yang kemudian dikonversi ke dalam satuan gigajoule (GJ). Selama tahun 2019, total penggunaan energi di luar Perusahaan sebesar 98.788 Kliter atau 3.971.043,27 GJ. [GRI 302-2]
Indonesia Power calculates the ratio of energy intensity using the total electricity generation as denominator to understand the total energy consumption per electricity generation, in order to determine the level of energy consumption efficiency. The types of energy included in the calculation of the energy intensity ratio consist of coal, HSD, MFO, natural gas, geothermal, water, and BioFame, which are energy consumed in the Company (raw materials in the electricity generation process).
In 2019, the Company’s energy intensity ratio was 11,881.30 GJ/GWh, which increased by 1.23% compared to 2018, which was 12,029.82 GJ/GWh. This shows the success of the Company in suppressing energy consumption in 2019.
In 2019, Indonesia Power began to calculate the Company’s external energy consumption from the transportation of fuel purchased, i.e. Marine Fuel Oil (MFO). The data assumption for fuel consumption per day refers to the consultant of freight cost calculator, multiplied by number of trips per year, which refers to the realization of coal supply volume in that year. Energy usage is calculated/measured by calculating total energy consumption in Kliter, which is then converted into gigajoules (GJ). During 2019, the total Company’s external energy consumption was 98,788 Kliter or 3,971,043.27 GJ. [GRI 302-2]
Intensitas EnergiEnergy Intensity
Intensitas Energi Indonesia Power [GRI 302-3]Indonesia Power Energy Intensity [GRI 302-3]
Catatan : Pengukuran dilakukan dengan cara membagi total penggunaan energi dengan total produksi.Remark : Calculations are made by dividing total energy consumption by total production.
2017 2018 2019
Total Penggunaan Energi (GJ) Total Energy Consumption (GJ) 498.694.907 504.585.640 464.711.748
Total Produksi (GWh) Production (GWh) 42.220,40 41.944,56 39.112,86
Intensitas Energi (GJ/GWh) Energy Intensity (GJ/GWh) 11.811,70 12.029,82 11.881,30
154 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pengelolaan Dampak LingkunganEnvironmental Impact Management
Indonesia Power senantiasa melakukan langkah strategis dalam mengurangi jumlah energi yang digunakan dalam memproduksi tenaga listrik melalui Program Peningkatan dan Pembudayaan Efisiensi Energi Ekselen (5E)/Program Enhancing and Embedding Energy Efficiency Excellence (Program 5E) yang telah diaplikasikan ke pembangkit-pembangkit Perusahaan. Program ini merupakan program untuk meningkatkan, menerapkan dan membudayakan Energy Efficiency Excellence dan mengintegrasikannya dalam IP Transformation Strategy di seluruh Unit Pembangkit Perusahaan. Selain itu, program ini juga sebagai langkah proaktif dalam menghadapi Program Performance Based Regulatory (PBR) oleh Pemerintah.
Program 5E telah memiliki metodologi yang terstruktur dan telah diintegrasikan dengan Aplikasi Maximo (ProEMA) sebagai upaya digitalisasi dokumentasi dan monitoring Program 5E. Tahun dasar perhitungan efisiensi energi Indonesia Power adalah pada saat implementasi berdasarkan data yang ada dalam maximo yakni tahun 2016, karena pada tahun 2016 Program 5E mulai diimplementasikan di seluruh unit Perusahaan dan bertambah seiring dengan bertambahnya pembangkit yang dikelola Indonesia Power, sehingga data tahun 2016 menjadi database perhitungan efisiensi energi. Jenis energi yang termasuk dalam perhitungan efisiensi energi adalah seluruh bahan bakar atau bahan baku yang digunakan dalam proses produksi listrik, yaitu batubara, HSD, MFO, gas alam, panas bumi dan air. Standar atau metodologi yang digunakan dalam perhitungan/pengukuran efisiensi energi pada Program 5E yaitu dengan mengacu pada standar EPRI (TR-109546 Heatrate Reference Improvement Manual) dan best practice perhitungan statistik penghematan dari improvement parameter operasi atau heatrate (PLTU) sebagai dampak dari program efisiensi yang telah dilaksanakan.
Indonesia Power strives to plan strategic steps in reducing the amount of energy consumed during electricity generation through the Enhancing and Embedding Energy Efficiency Excellence (5E Program) that has been applied to the Company’s plants. This program has the objective to improve, implement, and cultivate Energy Efficiency Excellence, and integrate it into the IP Transformation Strategy in all Company’s Generating Units. In addition, this program is also a proactive step in facing the Performance-Based Regulatory Program (PBR) by the Government.
The 5E Program has a structured methodology and has been integrated with the Maximo Application (ProEMA) as an effort to digitize the documentation and monitoring of the 5E Program. The base year for calculating the energy efficiency of Indonesia Power is at the time of implementation based on the data available in Maximo, in 2016. In 2016, the 5E Program began to be implemented in all Company’s units. The energy efficiency increased in line with the increase in power plants managed by Indonesia Power. Thus, the 2016 data became a database for energy efficiency calculation. The types of energy included in the calculation of energy efficiency are all fuels or raw materials used in the electricity generation process: coal, HSD, MFO, natural gas, geothermal, and water. The standard or methodology in the calculation/measurement of energy efficiency in 5E Program refers to the EPRI standard (TR-109546 Heatrate Reference Improvement Manual), and best practice of statistical calculation of savings from improved operating parameters or heatrate (SPP) as a result of the efficiency program implemented.
Program Efisiensi EnergiEnergy Efficiency Program
Komitmen Top Level Manajemen Indonesia Power Tentang Manajemen Efisiensi EnergiIndonesia Power’s Top-Level Management Commitment to Energy Efficiency Management
SK 57 Generating Asset Management System (including Efficiency
Management)
SE 27 Management Guidelines for Efficiency
of Thermal Power Plants
SK 16 Task Force for Enhancing Culture
of Energy Efficiency Management (PPMEE)
ISO 50001 Energy Management System
Certification
PPMEE Technical Guidelines
SK 57 Sistem Manajemen Aset
Pembangkit (include Manajemen Efisiensi)
SE 27 Pedoman Manajemen Efisiensi Pembangkit Listrik
Thermal
SK 16 Tim Peningkatan Pembudayaan
Manajemen Efisiensi Energi (PPMEE)
ISO 50001 Sertifikasi Energy
Management SystemPanduan Teknis
PPMEE
2010 2014 2016 20162016
155 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Melalui implementasi program 5E ini, selama tahun 2019 Indonesia Power berhasil melakukan efisiensi energi sebesar 41.779.993,04 GJ, dengan total saving heatrate sebesar 2.656,78 kCal/kWh dan berhasil menghemat biaya sebesar Rp628.992,92 juta/tahun. Jumlah efisiensi energi ini meningkat 10,72% dibandingkan tahun 2018 yaitu sebesar 37.735.384,41 GJ. Kontribusi efisiensi energi terbesar dihasilkan dari PLTU Pelabuhan Ratu OMU. Atas inovasi-inovasi yang dilakukan dalam Program 5E, pada tahun 2019 Indonesia Power kembali meraih penghargaan dalam ajang penghargaan tertinggi yang digelar Kementerian Energi dan Sumber Daya Mineral, yaitu Subroto Award 2019. Melalui dua unitnya, Lontar OMU dan Jawa Barat 2 Pelabuhan Ratu OMU, Indonesia Power membawa pulang dua penghargaan sekaligus untuk kategori Efisiensi Energi Nasional.
Because of 5E Program, during 2019, Indonesia Power managed to achieve energy efficiency of 41,779,993.04 GJ, with a total heatrate saving of 2,656.78 kCal/kWh, and managed to save costs by Rp628,992.92 million/year. This amount of energy efficiency increased by 10.72% compared to 2018, which was 37,735,384.41 GJ. The biggest contribution to energy efficiency comes from SPP Pelabuhan Ratu OMU. In 2019, Indonesia Power won another award at the highest award event held by the Ministry of Energy and Mineral Resources, i.e. the 2019 Subroto Award, for the innovations carried out in the 5E Program. Indonesia Power obtained two awards simultaneously in the National Energy Efficiency category because of the contributions of its two units, Lontar OMU and West Java 2 Pelabuhan Ratu OMU.
No. Unit KerjaWork Unit
Jenis EnergiEnergy Type
Program Efisiensi EnergiEnergy Efficiency Program
Hasil Absolut Efisiensi Energi (Gigajoule)Absolute Energy Efficiency (Gigajoule)
2017 2018 20191 Suralaya PGU
Suralaya PGUBatubaraCoal
- Replacement HPH 6 Unit 7- Retubing HP Heater 5 dan 7 Unit 3- Program inovasi lainnya- Replacement of HPH 6 Unit 7- Retubing HP Heater 5 dan 7 Unit 3- Other innovation programs
658.709,48 652.291,85 691.744,64
2 Priok POMUPriok POMU
GasGas
- Pemanfaatan listrik tenaga surya untuk gedung K3L
- Pekerjaan Abradable Sealing Steam Turbin 1.4 PLTGU Blok I & II
- Program inovasi lainnya- Utilizing solar electricity for K3L building - Abradable Sealing Steam Turbin 1.4 work at
CCPP Block I & II- Other innovation programs
62.888,65 76.323,56 62.208,95
3 Kamojang POMUKamojang POMU
Panas BumiGeothermal
- Pengoperasian FCT Unit PLTP KMJ mengikuti pola pembebanan ROH dari P2B
- Penggantian motor eksisting FCT DRJ-1 menggunakan motor efisiensi tinggi sebanyak 1 buah
- Program inovasi lainnya- The FCT operation of KMJ SPP Unit follows
the ROH loading pattern of P2B- The replacement of 1 existing FCT DRJ-1
motor using a high-efficiency motor - Other innovation programs
75,18 3.914,00 8.280,00
4 Semarang PGUSemarang PGU
HSD dan GasHSD and Gas
- Perbaikan Kebocoran HRSG - Pengaturan Temperature Exhaust Stack HRSG- Program inovasi lainnya- Repair of HRSG Leaks - HRSG Temperature Exhaust Stack
Management - Other innovation programs
1.932.709,36 2.485.561,95 6.583.028,15
Jumlah Efisiensi Energi Indonesia Power [GRI 302-4, GRI 302-5]Total Indonesia Power Energy Efficiency [GRI 302-4, GRI 302-5]
156 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
No. Unit KerjaWork Unit
Jenis EnergiEnergy Type
Program Efisiensi EnergiEnergy Efficiency Program
Hasil Absolut Efisiensi Energi (Gigajoule)Absolute Energy Efficiency (Gigajoule)
2017 2018 20195 Grati POMU
Grati POMUGasGas
- GT Offline Washing (Blok I - II)- Online washing compressor berdasarkan
pengamatan parameter operasi (GT Blok I)- Program inovasi lainnya- GT Offline Washing (Block I - II)- Online washing compressor based on
observation of operating parameters (GT Block I)
- Other innovation programs
215.161,83 276.813,72 317.364,89
6 Bali PGU PesanggaranBali PGU Pesanggaran
HSD, MFO, GasHSD, MFO, Gas
- Mempertahankan kinerja turbo charge (TC)- Mempertahankan kualitas exhaust gas- Program inovasi lainnya- Maintaining turbocharge (TC) performance- Maintaining exhaust gas quality- Other innovation programs
11.751,22 16.383,76 10.182,59
7 PLTGU Cilegon OMUCCPP Cilegon OMU
GasGas
- Optimasi pola operasi menjadi 1 on 1 setelah suplai gas PHE masuk
- Modifikasi interstage seal housing row 3- Program inovasi lainnya- Optimizing operating patterns to 1-on-1 after
PHE gas supply enters- Modification of interstage seal housing row 3- Other innovation programs
1.866.290,00 2.805.713,65 4.319.574,27
8 PLTU Pangkalan Susu OMUSPP Pangkalan Susu OMU
BatubaraCoal
- Review pola operasi dan set point main steam temperature
- Review pola operasi dan set point Hot Reheat steam temperature
- Program inovasi lainnya- Review the operating patterns and set point
for the main steam temperature - Review the operating patterns and set point
for Hot Reheat steam temperature - Other innovation programs
- - 1.119.736,17
9 Banten 1 Suralaya OMUBanten 1 Suralaya OMU
BatubaraCoal
- Optimalisasi pengoperasian soot blower dari Time Based menjadi Condition Based
- Minimalisasi Unburn Carbon dengan penyesuaian Orifice Outlet Mill
- Program inovasi lainnya- Optimizing the operation of soot blowers
from Time Based to Condition Based- Minimizing Unburnt Carbon with Orifice
Outlet Mill adjustments- Other innovation programs
302.704,94 1.753.449,98 1.941.858,17
10 Banten 3 Lontar OMUBanten 3 Lontar OMU
BatubaraCoal
- Taproge Ball Kondensor- Pelepasan steam coil FD Fan unit 1,2,3- Program inovasi lainnya- Taproge Ball Condenser- Release of the FD fan steam coil unit 1,2,3- Other innovation programs
536.178,0011 571.766,98 123.616,21
Pengelolaan Dampak LingkunganEnvironmental Impact Management
157 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
No. Unit KerjaWork Unit
Jenis EnergiEnergy Type
Program Efisiensi EnergiEnergy Efficiency Program
Hasil Absolut Efisiensi Energi (Gigajoule)Absolute Energy Efficiency (Gigajoule)
2017 2018 201911 Banten 2
Labuan OMUBanten 2 Labuan OMU
BatubaraCoal
- Cleaning di area eco hopper- Rasio pembukaan SA Damper secara Auto- Program inovasi lainnya - Cleaning the eco hopper area- Auto Damper SA opening ratio- Other innovation programs
214.656,54 234.200,23 258.184,47
12 PLTU Pelabuhan Ratu OMUSPP Pelabuhan Ratu OMU
BatubaraCoal
- Inspeksi dan Perbaikan Blade HP Turbin dari Erosi dan Deposit
- Modifikasi dan Kalibrasi Burner Tilting pada Boiler
- Program inovasi lainnya- Inspection and Repair of HP Turbine Blades
from Erosion and Deposits- Modification and Calibration of Burner Tilting
in Boilers- Other innovation programs
22.573.128,22 28.858.964,67 25.037.324,39
13 PLTU Adipala OMUSPP Adipala OMU
BatubaraCoal
- Upgrade packing material valve HPH 8- Penggantian radial seal, axial seal dan
bypass seal- Program inovasi lainnya- Upgrade of packing material valve HPH 8- Replacement of radial seals, axial seals, and
bypass seals- Other innovation programs
- - 1.306.889,09
14 Saguling POMUSaguling POMU
AirWater
- Modifikasi Pompa dan Motor Main Water Supply Pump (Motorless) PLTA Saguling
- Memindahkan pemakaian PS Kantor dari Unit ke Distribusi PLN PLTA Saguling
- Program inovasi lainnya- Modification of Pumps and Main Water
Supply Pump Motor (Motorless) for Saguling Hydroelectric Power Plant
- Transfer the use of Office PS from the Unit to the Saguling Hydroelectric Power Plant Distribusi PLN
- Other innovation programs
0,41 0,06 0,49
15 Mrica PGUMrica PGU
AirWater
- Perubahan Tapping kWH meter Brutto PLTA PBS Unit 1 dan 2
- Modifikasi CWS PLTA Garung dengan memanfaatkan air dari Pipa Pesat
- Program inovasi lainnya- Changes in Brutto Tapping kWH meter at HPP
PBS Units 1 and 2- Modification of CWS at Garung HPP by
utilizing water from the Rapid Pipes- Other innovation programs
- - 0,08
Jumlah Efisiensi Energi Total Energy Efficiency 28.374.253,83 37.735.384,41 41.779.993,04
158 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pendekatan ManajemenTopik Pengelolaan Emisi[GRI 103-1, 103-2, 103-3]Management Approachto Emission Management [GRI 103-1, 103-2, 103-3]
Topik Pengelolaan Emisi menjadi topik yang penting bagi Indonesia Power karena menerapkan regulasi dalam pemenuhan baku mutu emisi gas buang yang semakin ketat menjadikan tantangan tersendiri dalam komitmen pemenuhan pengelolaan dan pengendalian emisi.
Emission Management is an important topic for Indonesia Power because implementing regulations to meet the increasingly strict standards for exhaust gas emission is a challenge the Company’s commitment to fulfilling emission management and control.
Pengelolaan EmisiEmission Management
Pengelolaan Dampak LingkunganEnvironmental Impact Management
Kebijakan Perusahaan- Keputusan Direksi Nomor 41.K/010/IP/2012 tentang Kebijakan
Keselamatan dan Kesehatan Kerja serta Lingkungan di PT Indonesia Power
- Keputusan Direksi Nomor 249.K/010/lP/2015 tentang Pedoman Penerapan Green Power Plant Di Lingkungan PT Indonesia Power
Ketentuan Umum- Peraturan Presiden Nomor 61 tanggal 20 September 2011
tentang Rencana Aksi Nasional Penurunan Emisi Gas Rumah Kaca
- Peraturan Menteri Lingkungan Hidup Nomor P.15/MENLHK/SETJEN/KUM.1/4/2019 tentang Baku Mutu Emisi Pembangkit Tenaga Listrik Thermal
Company’s Policies:- Board of Directors’ Decree No. 41.K/010/IP/2012 on
Occupational Health and Safety Policy within PT Indonesia Power- Board of Directors’ Decree Number 249.K/010/IP/2015 on
Guidelines on Green Power Plant Implementation within the environment of PT Indonesia Power.
General Provisions- Presidential Regulation No. 61 dated 20 September 2011 on the
National Action Plan for Green House Gas Emission Reduction- Minister of Environment Regulation No. P.15/MENLHK/SETJEN/
KUM.1/4/2019 on Quality Standards of Emissions for Thermal Power Plants
Kantor Pusat:- Bidang Lingkungan yang berada di bawah Vice President
Health, Safety and Environment- Vice President of Project Management and Pre-ConstructionUnit Kerja:Manajer Operasi dan Manajer Administrasi
Head Office:- Environmental sector, which is the responsibility of the Vice
President Health, Safety, and Environment- Vice President of Project Management and Pre-ConstructionWork Unit: Operations Manager and Administration Manager
KebijakanPolicy
Penanggung JawabPerson in Charge
159 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
- Program audit energi, upaya penurunan emisi serta program pemenuhan kepatuhan dan peningkatan pengendalian emisi sebagai Strategic Initiatives yang tercantum dalam Rencana Jangka Panjang 2019 – 2023.
- Energy audit programs, efforts to reduce emissions, as well as programs to fulfill compliance and increase emission control, are included in the Strategic Initiatives listed in the 2019-2023 Long-Term Plan.
- Pemenuhan ketaatan baku mutu seluruh Unit Pembangkit
- Penurunan beban emisi di tahun 2019
- Fulfillment of compliance with quality standards in all Generating Units
- Reduction in emissions from 2019
- Seluruh pembangkit TAAT dan seluruh parameter Emisi memenuhi baku mutu
- Pengurangan emisi sebesar 2.286.006,72 ton CO2
- All TAAT generators and all Emission parameters meet quality standards
- Reducing emissions by 2,286,006.72 tons of CO2
- Program Pemasangan Continuous Emission Monitoring System (CEMS)
- Clean Development Mechanism (CDM)- Program Verifikasi, Sertifikasi Perhitungan dan
Inventarisasi Emisi Gas Rumah Kaca (GRK)- Pengembangan Pembangkit Energi Baru
Terbarukan (EBT)- Program Konversi dan Blending Bahan Bakar
- Continuous Emission Monitoring System (CEMS) Installation Program
- Clean Development Mechanism (CDM)- Program for Verification, Certification of
Calculation, and Inventory of Greenhouse Gas (GHG) Emissions
- Renewable Energy (NRE) Power Plant Development
- Fuel Conversion and Blending Program
- Melaksanakan perencanaan pemasangan alat pengendali emisi dan melaksanakan rencana investasi pemasangan kewajiban CEMS di seluruh sumber emisi gas buang sebagai bagian dari evaluasi pengelolaan emisi di tahun 2019.
- Carrying out plans for the installation of emissions control devices, and investment plans for the obligation to install CEMS in all sources of exhaust emissions as part of the evaluation of emissions management in 2019.
KomitmenCommitment
RealisasiRealization
Sasaran dan TargetGoals and Targets
EvaluasiEvaluation
Program/InisiatifProgram/Initiative
160 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pengelolaan Dampak LingkunganEnvironmental Impact Management
Penggunaan energi primer yang bersumber dari energi fosil untuk dikonversi menjadi listrik memiliki dampak sebagai penyumbang emisi Gas Rumah Kaca (GRK). Untuk itu, Indonesia Power melakukan berbagai langkah strategis pengelolaan emisi melalui Program Pemasangan Continuous Emission Monitoring System (CEMS); Clean Development Mechanism (CDM); Program Verifikasi, Sertifikasi Perhitungan dan Inventarisasi Emisi Gas Rumah Kaca (GRK); Pengembangan Pembangkit Energi Baru Terbarukan (EBT); dan secara rutin melakukan program pemantauan, pengukuran serta pengendalian proses agar seluruh emisi gas buang yang dikeluarkan oleh seluruh Unit Pembangkitan Perusahaan memenuhi baku mutu lingkungan.
The primary energy use of fossil energy to be converted into electricity contributes to Greenhouse Gas (GHG) emissions. Thus, Indonesia Power has taken various strategic steps to manage emissions through the Continuous Emission Monitoring System (CEMS) Installation Program; Clean Development Mechanism (CDM); Program for Verification, Certification of Calculation, and Inventory of Greenhouse Gas (GHG) Emissions; Renewable Energy (NRE) Power Plant Development; and regular program to conduct monitoring, measurement, and process control so that all exhaust emissions generated by all Company’s Generating Units meet the environmental quality standards.
Indonesia Power secara rutin melakukan perhitungan inventarisasi Emisi Gas Rumah Kaca (GRK) Scope 1 yang bersumber dari konsumsi bahan bakar yang digunakan untuk pengoperasian Unit pembangkit dan kendaraan operasional, dan juga melakukan perhitungan inventarisasi Gas Rumah Kaca (GRK) Scope 2 yang bersumber dari konsumsi listrik oleh semua bangunan dan kantor yang dimiliki dan dioperasikan oleh Perusahaan yang berasal dari luar pembangkit. Gas yang termasuk ke dalam perhitungan adalah CO2, CH4 dan N2O. Hingga tahun 2019, Indonesia Power belum melakukan perhitungan inventarisasi Emisi GRK Scope 3 yang bersumber dari emisi tidak langsung lainnya antara lain dari transportasi bahan bakar yang dibeli, transportasi pegawai dan perjalanan dinas. Hal ini dikarenakan inventarisasi Emisi GRK Scope 3 tidak termasuk dalam kewajiban inventarisasi, kompleksitas dan sumber data yang tidak berada di bawah kendali Perusahaan serta saat ini Perusahaan belum memiliki sumber daya yang cukup untuk melakukan inventarisasi data dan perhitungan ini. Saat ini, proses inventarisasi Emisi GRK Scope 3 masih dalam persiapan formatting, mekanisme inventarisasi data serta sumber-sumber emisi terkait. Diharapkan dalam lima tahun ke depan inventarisasi Emisi GRK Scope 3 dapat dilakukan dan dilengkapi.
Indonesia Power regularly performs Scope 1 Greenhouse Gas (GHG) Emissions inventory originating from fuel consumption used for the operation of generating Units and operational vehicles, and calculates Scope 2 GHG inventory originating from electricity consumption by all buildings and offices owned and operated by the Company from outside the plant. The calculation measures CO2, CH4, and N2O. Until 2019, Indonesia Power has yet to calculate Scope 3 GHG Emission inventory, originating from other indirect emissions, including transportation of fuel purchased, employee transportation, and business trip. This is because the Scope 3 GHG emission inventory is not included in the inventory obligations, and the data complexity and sources are not directly under the Company’s control, and currently, the Company does not yet have sufficient resources to carry out this data inventory and calculation. To date, the Scope 3 GHG emission inventory process is still in preparation for the formatting and inventory mechanism of data and related emission sources. Within the next five years, the Scope 3 GHG Emission inventory shall be carried out and completed.
Inventarisasi Gas Rumah Kaca [GRI 305-1, 305-2, 305-3]Greenhouse Gas Inventory [GRI 305-1, 305-2, 305-3]
161 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Tahun dasar perhitungan emisi GRK Perusahaan adalah tahun 2012, karena pada tahun 2012 baru mulai dilakukan inventarisasi serta verifikasi oleh pihak eksternal. Hasil inventarisasi dan perhitungan diverifikasi hingga memperoleh sertifikasi untuk memvalidasi dan menjadikan data tahun 2012 menjadi database perhitungan emisi GRK. Perhitungan inventarisasi Emisi GRK Perusahaan didasarkan pada data aktivitas dikalikan dengan faktor emisi GRK. Untuk faktor emisi jaringan menggunakan ketetapan Direktorat Jenderal Ketenagalistrikan - Kementerian ESDM pada system interkoneksi Jawa-Madura-Bali (JAMALI) ex-post, sedangkan untuk faktor emisi dan NCV pemakaian bahan bakar menggunakan prosedur standar dan metode dari CO2 Emission Factor by Fuel IPCC 2006 Guidelines for National Greenhouse Gas Inventories.
Metode pengumpulan data perhitungan inventarisasi Emisi GRK ini dibedakan menjadi tiga, yaitu:- Metode pengumpulan data pemakaian bahan bakar pada
pengoperasian Unit Pembangkit dan Diesel Emergency, diambil dari Coal Feeder untuk Batubara dan Flow Meter untuk HSD/Solar dan Gas;
- Metode pengumpulan data konsumsi diesel dan bensin pada kendaraan yang dimiliki dan dioperasikan unit dan kantor, diambil dari rekap faktur pembelian bahan bakar yang secara langsung menunjukkan volume yang dibeli; dan
- Metode pengumpulan data penggunaan Refrigerant untuk kebutuhan AC dan peralatan pendingin lainnya, dihitung berdasarkan jumlah botol/tabung yang dipakai lalu dikalikan dengan spesifikasi berat/isi yang tercantum dalam tabung refrigerant.
Untuk menghimpun atau mengkonsolidasi data emisi GRK seluruh unit dan kantor Perusahaan, Indonesia Power telah mendelegasikan kepada personil khusus bagian Niaga yang melakukan pencatatan data pemakaian bahan bakar dari sumber data tersebut dan keseluruhan data dimasukkan ke dalam sistem Aplikasi PRONIA. Kebutuhan data inventarisasi dan input perhitungan diambil dari sistem tersebut yang merupakan aplikasi resmi dan telah tervalidasi. Namun, hingga tahun 2019 Indonesia Power belum melakukan perhitungan Global Warming Potential (GWP).
Berdasarkan hasil perhitungan, emisi GRK yang dihasilkan Perusahaan selama tahun 2019 sebesar 65.938.756,68 ton CO2e, meningkat 10,66% dibandingkan tahun 2018 sebesar 59.585.581,58 ton CO2e. Hal ini dikarenakan terdapat peningkatan penggunaan bahan bakar batubara pada Unit PLTU.
The base year for calculating the Company’s GHG emissions is 2012, because, in 2012, the inventory and verification of external parties had begun. The results of the inventory and calculation are verified to be certified, to validate and turn the 2012 data into a database of GHG emission calculations. The calculation of the Company’s GHG Emission inventory is based on activity data multiplied by GHG emission factors. Network emission factors are calculated by using the provisions of the Directorate General of Electricity - Ministry of EMR on the ex-post of the Java-Madura-Bali (JAMALI) interconnection system. Emission and NCV fuel consumption factors are calculated by referring to standard procedures and methods from CO2 Emission Factor by Fuel IPCC 2006 Guidelines for National Greenhouse Gas Inventories.
The data collection method for calculating GHG emission inventories is categorized into three:- Data collection for fuel usage in the operation of the
Generating Unit and Diesel Emergency, are taken from the Coal Feeder for Coal and Flow Meters for HSD/Solar and Gas;
- Data collection for diesel and gasoline consumption data on vehicles owned and operated by units and offices, are taken from the recap of fuel purchase invoices, which directly show the volume purchased; and
- Refrigerant consumption data for the needs of air conditioners and other cooling equipment are calculated based on the number of bottles/tubes spent, multiplied by the weight/contents specifications listed in the refrigerant tube.
Indonesia Power has delegated the collection or consolidation of GHG emission data from all Company’s units and offices to special Commerce personnel who record fuel usage data from these data sources. The data is then inputted into the PRONIA Application system. Inventory data needs and calculation input are from the system, which is an official application and has been validated. However, until 2019, Indonesia Power has yet to calculate the Global Warming Potential (GWP).
Based on the calculation, GHG emissions generated by the Company during 2019 amounted to 65,938,756.68 tons of CO2e, increased by 10.66% compared to 2018, which was 59,585,581.58 tons of CO2e. This is because there is an increase in the use of coal fuel in the SPP Units.
162 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pengelolaan Dampak LingkunganEnvironmental Impact Management
Scope
Sumber Emisi Gas Rumah Kaca
Source of Greenhouse Gas Emissions
Emisi Gas Rumah Kaca (ton CO2e)Greenhouse Gas Emissions (tons of CO2e)
2012 2013 2014 2015 2016 2017 2018 2019
Scope 1
Konsumsi Bahan bakar yang digunakan untuk pengoperasian Unit Pembangkit dan Kendaraan Operasional.Fuel consumption to operate Generating Unit and Operational Vehicles
CO2 30.162.794,95 37.018.847,40 40.371.130,53 41.865.601,55 51.555.251,81 49.598.518,85 59.274.824,41 65.590.409,22
CH4 2.152,92 10.046,55 10.435,56 10.399,30 11.673,96 51.062,67 13.593,34 15.733,65
N2O 617,95 150.169,90 167.850,06 171.719,91 199.461,21 220.669,68 232.198,05 279.303,43
Total ton CO2e Scope 1Total Scope 1 tons of CO2e
30.165.565,82 37.179.063,85 40.549.416,15 42.047.720,76 51.766.386,97 49.870.251,202 59.520.615,79 65.885.446,30
Scope 2
Konsumsi Listrik oleh semua bangunan dan kantor yang dimiliki dan dioperasikan oleh Perusahaan yang berasal dari luar pembangkit.Electricity consumption by all buildings and offices owned and operated by the Company, which are located outside of the power plant.
CO2 58.551,90 215.318,74 252.596,69 282.679,47 1.410.910,11 1.751.714,964 64.965,79 53.310,38
Total ton CO2e Scope 2Total Scope 2 tons of CO2e
58.551,90 215.318,74 252.596,69 282.679,47 1.410.910,11 1.751.714,964 64.965,79 53.310,38
Total ton CO2e Total tons of CO2e 30.224.117,72 37.394.382,59 40.802.012,84 42.330.400,23 53.177.297,09 51.621.966,167 59.585.581,58 65.938.756,68
Inventaris Emisi Gas Rumah Kaca (Ton CO2e) [GRI 305-1, 305-2]Inventory of Greenhouse Gas Emissions (Tons of CO2e) [GRI 305-1, 305-2]
Untuk melihat total beban emisi GRK per setiap produksi tenaga listrik guna mengetahui tingkat penurunan emisi GRK, Indonesia Power melakukan perhitungan rasio intensitas emisi GRK dengan menggunakan denominator total produksi bruto pembangkit thermal sebagai faktor yang paling relevan. Jenis emisi yang termasuk dalam perhitungan terdiri dari scope 1 dan scope 2 yang meliputi CO2, CH4 dan N2O.
Pada tahun 2019, rasio intensitas emisi GRK Perusahaan sebesar 0,95 kg CO2e/kWh, meningkat 17,46% dibandingkan tahun 2018 sebesar 0,81 kg CO2e/kWh. Hal ini dikarenakan terdapat peningkatan penggunaan bahan bakar batubara pada Unit PLTU.
Indonesia Power calculates the GHG emission intensity ratio using the total gross production of thermal power plants as the most relevant factor to understand the total GHG emission load per each electricity generation to determine the level of GHG emission reduction. The types of emissions included in the calculation consist of scope 1 and scope 2, which include CO2, CH4, and N2O.
In 2019, the Company’s GHG emission intensity ratio was 0.95 kg CO2e/kWh, increased by 17.46% compared to 2018, which was 0.81 kg CO2e/kWh. This is because there is an increase in the use of coal fuel in the SPP Units.
Intensitas Emisi Gas Rumah KacaGreenhouse Gas Emission Intensity
163 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Komponen PerhitunganComponent of
Calculation2012 2013 2014 2015 2016 2017 2018 2019
Total Emisi Gas Rumah Kaca (ton CO2e)Total Greenhouse Gas Emissions (tons of CO2e)
30.224.117,72 37.394.382,59 40.802.012,84 42.330.400,23 53.177.297,09 51.621.966,16 59.585.581,58 65.938.756,68
Total Produksi Bruto Pembangkit Thermal (kWh)Total Thermal Power Plant Gross Production (kWh)
46.555.927.269,44 49.741.518.492,34 50.560.972.707,47 53.420.032.394,28 65.545.582.357,19 71.920.404.772,21 73.821.284.793,79 69.548.170.387,80
Intensitas Emisi(kg CO2e /kWh)Emission Intensity(kg CO2e/kWh)
0,65 0,75 0,81 0,79 0,81 0,72 0,81 0,95
ParameterParameter
Beban Emisi (kg/tahun)Emission Expense (kg/year)
2017 2018 2019
CO 49.521.496,49 19.401.413,27 24.948.796,05
SO2 43.581.379,95 55.528.195,67 105.173.902,66
NO 5.123.090,628 2.426.472,64 6.080.840,22
NOx 25.087.003,99 53.485.179,97 61.547.179,05
NO2 31.685.653,21 2.684.675,32 4.017.563,93
Jumlah Total 154.998.624,27 133.525.936,87 201.768.281,91
Intensitas Emisi Indonesia Power [GRI 305-4]Indonesia Power Energy Intensity [GRI 305-4]
Emisi Gas Buang [GRI 305-7]Exhaust Gas Emission [GRI 305-7]
Indonesia Power juga secara rutin melakukan perhitungan beban emisi gas buang yang bersumber dari cerobong pembangkit, sejalan dengan Peraturan Menteri Lingkungan Hidup Nomor 21 tahun 2008 tentang Baku Mutu Emisi Tidak Bergerak Bagi Usaha dan atau Kegiatan Pembangkit Tenaga Listrik Thermal. Gas yang termasuk ke dalam perhitungan adalah CO, SO2, NO, NOx dan NO2.
Berdasarkan hasil perhitungan, emisi gas buang yang dihasilkan Perusahaan selama tahun 2019 sebesar 201.768.281,91 kg/tahun, meningkat 51,11% dibandingkan tahun 2018 sebesar 133.525.936,87 kg/tahun. Hal ini dikarenakan adanya penambahan pembangkit PLTU baru yang masuk dalam perhitungan.
Indonesia Power regularly calculates exhaust gas emission loads originating from the chimney of the power plant, in line with Minister of the Environment Regulation No. 21 of 2008 on Emission Quality Standards for Immovable Sources for Thermal Power Generation Businesses and/or Activities. The calculation measures CO, SO2, NO, NOx, and NO2.
Based on the results, during 2019, the Company produced exhaust emissions amounted to 201,768,281.91 kg/year, increased by 51.11% compared to 2018, which was 133,525,936.87 kg/year. This is due to the addition of the new Steam Power Plant (SPP) in the calculation.
Inventarisasi Gas BuangExhaust Gas Inventory
Catatan:Pengukuran dilakukan dengan cara membagi total emisi GRK yang dihasilkan dengan total produksi bruto pembangkit thermal
Note:Calculations are made by dividing total GHG emissions generated by the total gross production of thermal power plants
164 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Untuk melihat total beban emisi gas buang per setiap produksi tenaga listrik guna mengetahui tingkat penurunan emisi gas buang, Indonesia Power melakukan perhitungan rasio intensitas emisi gas buang dengan menggunakan denominator total produksi bruto pembangkit thermal sebagai faktor yang paling relevan. Jenis emisi yang termasuk dalam perhitungan terdiri dari CO, SO2, NO, NOX dan NO2.
Pada tahun 2019, rasio intensitas beban emisi gas buang Perusahaan sebesar 0,0029 kg/kWh, meningkat 60,39% dibandingkan tahun 2018 sebesar 0,0018 kg/kWh. Hal ini dikarenakan adanya penambahan pembangkit PLTU baru yang masuk dalam perhitungan.
Indonesia Power senantiasa melakukan langkah strategis dalam mengurangi beban emisi yang dihasilkan dari kegiatan bisnis Perusahaan yang bertujuan untuk mendukung pelaksanaan penurunan emisi sesuai dengan target pembangunan nasional yang tercantum dalam Peraturan Presiden Nomor 61 tanggal 20 September 2011 tentang Rencana Aksi Nasional Penurunan Emisi Gas Rumah Kaca. Indonesia Power melaksanakan perhitungan pengurangan emisi dengan menggunakan metode atau sistem Measurement, Reporting and Verification (MRV). Tahun dasar perhitungan pengurangan emisi adalah tahun 2012, karena pada tahun 2012 baru mulai dilakukan inventarisasi serta verifikasi oleh pihak eksternal sehingga data tahun 2012 menjadi database perhitungan pengurangan emisi. Gas yang termasuk dalam perhitungan adalah CO2, CH4 dan N2O.
Indonesia Power calculates the exhaust gas emission intensity ratio using the total gross production of thermal power plants as the most relevant factor to understand the total exhaust gas emission load per each electricity generation to determine the level of exhaust gas emission reduction. The emission is assessed by calculating CO, SO2, NO, NOX, and NO2.
In 2019, the Company’s exhaust gas emission load intensity was 0.0029 kg/kWh, increased by 60.39% compared to 2018, which was 0.0018 kg/kWh. This is due to the addition of the new Steam Power Plant (SPP) in the calculation.
Indonesia Power strives to take strategic steps to reduce the emission load resulting from the Company’s business activities, with the objective to support the emission reductions target in accordance with the national development targets stipulated in the Presidential Regulation No. 61 dated 20 September 2011 on the National Action Plan for Green House Gas Emission Reduction. Indonesia Power calculates the emission reductions using the Measurement, Reporting, and Verification (MRV) system. The base year for calculating emission reductions is 2012, because in 2012, an external party carried out new inventories and verification. Thus, the 2012 data acts as a database for calculating emission reductions. The calculation measures CO2, CH4, and N2O.
Intensitas Beban Emisi Gas BuangExhaust Gas Emission Load Intensity
Program Pengurangan EmisiEmission Reduction Program
Pengelolaan Dampak LingkunganEnvironmental Impact Management
2017 2018 2019
Total Emisi Gas Buang (Kg/Tahun)Total Exhaust Gas Emission (Kg/year) 154.998.624,27 133.525.936,87 201.768.281,91
Total Produksi Bruto Pembangkit Thermal (kWh)Total Thermal Power Plant Gross Production (kWh) 71.920.404.772,21 73.821.284.793,79 69.548.170.387,80
Intensitas Beban Emisi Gas Buang (kg/kWh)Exhaust Gas Emission Load Intensity (kg/kWh) 0,0022 0,0018 0,0029
Intensitas Beban Emisi Gas Buang Indonesia Power [GRI 305-4]Indonesia Power Exhaust Gas Emission Load Intensity [GRI 305-4]
165 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Selama tahun 2019 Indonesia Power berhasil melakukan pengurangan emisi dari gas CO2 sebesar 2.286.006,72 ton CO2, meningkat 17,00% dibandingkan tahun 2018 yaitu sebesar 1.953.899,42 ton CO2. Hal ini disebabkan karena berbagai program inovasi yang dilakukan Perusahaan, diantaranya yaitu:- Rehabilitasi peralatan (boiler, turbin atau peralatan
penunjang), seperti Program Rehabilitasi Boiler dan Uprating Turbin Unit 1 dan 2;
- Konversi bahan bakar (gasifikasi dan pemakaian Biomass);- Eco Office, seperti penggunaan lampu hemat energi (LED),
penggunaan Office Aplication sebagai pengganti surat dinas, penggantian monitor komputer dari CRT menjadi LED, pemasangan Solar Cell dan penggunaan motor listrik;
- Inovasi dan perbaikan peralatan, seperti inovasi peralatan pembangkitan pengaturan sudut kemiringan blade;
- Perubahan pola operasi dan optimalisasi operasional peralatan, seperti perubahan metode operasi pengolahan air limbah cleaning untuk meningkatkan efisiensi Waste Water Treatment Plant dan optimalisasi injeksi bahan kimia dalam sistem HRSG di PLTGU Grati; dan
- Program inovasi penurunan emisi lainnya.
During 2019, Indonesia Power managed to reduce emissions from CO2 gas by 2,286,006.72 tons of CO2, increased by 17.00% compared to 2018, which was 1,953,899.42 tons of CO2. This is due to various innovation programs carried out by the Company, including:- Equipment rehabilitation (boilers, turbines, or supporting
equipment), such as the Boiler Rehabilitation Program and Uprating Turbines Units 1 and 2;
- Fuel conversion (gasification and biomass consumption);- Eco-Office, such as the use of energy-saving lamps (LEDs),
Office Applications as a substitute for official letters, replacement of computer monitors from CRT to LEDs, installation of Solar Cells, and the use of electric motors;
- Equipment innovation and improvement, such as managing blade inclination angle in the generation equipment;
- Changes in operating patterns and optimization of equipment operations, such as changes in the cleaning method of wastewater treatment operations to improve the efficiency of the Waste Water Treatment Plant, and the optimization of chemical injections in the HRSG system at the Grati CCPP; and
- Other innovation programs to reduce emissions.
Jumlah Penurunan Emisi Indonesia Power [GRI 305-5]Indonesia Power Emission Reduction [GRI 305-5]
1.96
0.73
8,84
1.95
3.89
9,42
2.28
6.00
6,72
2017
2018
2019
166 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Indonesia Power melakukan Mekanisme Pembangunan Bersih (MPB) atau Clean Development Mechanism (CDM) pada Unit PLTP Gunung Salak. CDM merupakan suatu proyek yang memiliki fungsi dapat mereduksi emisi GRK untuk mendukung pembangunan berkelanjutan.
Pada tahun 1994, dua unit pembangkit listrik mulai beroperasi dengan kapasitas 2x55 MW. Tiga tahun kemudian satu unit tambahan lagi dapat dioperasikan dengan kapasitas yang sama. Pada tahun 2004, kapasitas pembangkit dinaikkan menjadi 3x60 MW melalui program Capacity Upgrade, sehingga produk yang dihasilkan berupa energi listrik dapat disalurkan ke sistem ketenagalistrikan Jawa Bali Madura dengan total kapasitas 180 MW.
Proyek capacity upgrade Unit PLTP Gunung salak ini diikutsertakan dalam proyek CDM melalui metode VCS (Voluntary Carbon Standard). Verifikasi dan validasi proyek ini selesai pada tahun 2009 dan hingga sekarang Unit PLTP Gunung Salak telah menghasilkan reduksi emisi karbon sebesar 1,167,946.00 ton VCUs.
Indonesia Power conducts a Clean Development Mechanism at the Gunung Salak GPP Unit. CDM is a project functions to reduce GHG emissions to support sustainable development.
In 1994, two units of the power plant started to operate with a capacity of 2x55 MW. Three years later, an additional unit could be operated with the same capacity. In 2004, the capacity of generators was upgraded to 3x60 MW through Capacity Upgrade Program, hence the product generated is in the form of electricity that is channeled into the electrification system in Java Bali Madura with a total capacity of 180 MW.
Capacity upgrade project for Gunung Salak GPP Unit was included in CDM project through VCS (Voluntary Carbon Standard) method. The verification and validation of this project were completed in 2009, and to date, Gunung Salak GPP Unit has produced carbon emission reduction in the amount of 1,167,946.00 ton VCUs.
Mekanisme Pembangunan Bersih [EU5]Clean Development Mechanism [EU5]
TahunYear
Verified Emission Reduction (VER) (Ton VCUs)
Verified Sold Remain
2009 281,802.00 100,000.00 279,302.00
2010 - - 258,727.28
2011 261,713.00 181,640.00 361,461.35
2012 203,735.00 111,065.00 453,827.35
2013 - - 359,591.35
2014 118,763.00 447,303.07 478,256.58
2015 - - 478,256.58
2016 301,933,00 50,000.00 478,256.58
2017 - 80,053.00 478,256.58
2018 - 80,594.00 478,256.58
2019 - - 478,256.58
Total 1,167,946.00 1,050,655.07 4,582,449.81
Emisi GRK yang Dijual/Dilelang/Diberikan Melalui Skema CDM di Unit Gunung SalakGHG Emissions Sold/Auctioned/Given Away Through the CDM Scheme at Gunung Salak Unit
Pengelolaan Dampak LingkunganEnvironmental Impact Management
167 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Penipisan lapisan ozon merupakan salah satu dampak negatif dari kerusakan lingkungan yang diakibatkan dari penggunaan bahan-bahan kimia berbahaya yaitu penggunaan Bahan Perusak Ozon (BPO) atau Ozone-Depleting Substances (ODS). Adapun bahan-bahan perusak ozon dan penggunaannya antara lain Klorofluorokarbon (CFC) atau freon.
Sebagai perusahaan yang berkomitmen bersahabat dengan Lingkungan, Indonesia Power sudah tidak menggunakan bahan refrigerant dan AC yang mengandung bahan-bahan perusak ozon dengan menggunakan bahan Non CFC dalam penggunaan refrigerant dan AC. [GRI 305-6]
The depletion of the ozone layer is one of the negative effects of environmental damage resulting from the use of hazardous chemicals or Ozone-Depleting Substances (ODS). Chlorofluorocarbons (CFCs) or Freons and its consumption is considered the ozone-depleting substances.
As a company that is committed to being environmentally-friendly, Indonesia Power no longer uses refrigerant material and AC that contain ozone-depleting substances, instead, the Company uses Non-CFC materials for refrigerants and air conditioners. [GRI 305-6]
Emisi Bahan Perusak OzonOzone Depleting Emissions
168 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pendekatan ManajemenTopik PengelolaanSumber Daya Air[GRI 103-1, 103-2, 103-3]Management Approach to Water Resources Management [GRI 103-1, 103-2, 103-3]
Topik Pengelolaan Sumber Daya Air menjadi topik yang penting bagi Indonesia Power karena Indonesia Power adalah perusahaan pembangkit yang menggunakan sumber daya air sebagai salah satu bahan baku proses pembangkit listrik, terutama Pembangkit Listrik Tenaga Thermal dan PLTA. Pengelolaan sumber daya air dilakukan untuk menjaga keberlanjutan dan ketersediaan air yang mendukung proses di dalam Pembangkit.
Water Resources Management is an important topic for Indonesia Power because the Company is a power generation company that uses water resources as one of the raw materials for power generation processes, especially in the Thermal Power Plants and Hydroelectric Power Plants. Water resources management is carried out to maintain the water sustainability and availability that supports the process in the Power Plant.
Pengelolaan Sumber Daya AirWater Resources Management
Pengelolaan Dampak LingkunganEnvironmental Impact Management
Kebijakan Perusahaan- Keputusan Direksi Nomor 41.K/010/IP/2012 tentang
Kebijakan Keselamatan dan Kesehatan Kerja serta Lingkungan di PT Indonesia Power
- Keputusan Direksi Nomor 249.K/010/lP/2015 tentang Pedoman Penerapan Green Power Plant Di Lingkungan PT Indonesia Power
Ketentuan Umum- Undang-undang Nomor 17 Tahun 2019 tentang
Sumber Daya Air- Peraturan Pemerintah Nomor 121 Tahun 2015 tentang
Pengusahaan Sumber Daya Air
Company’s Policies:- Board of Directors’ Decree No. 41.K/010/IP/2012
on Occupational Health and Safety Policy within PT Indonesia Power
- Board of Directors’ Decree Number 249.K/010/IP/2015 on Guidelines on Green Power Plant Implementation within the environment of PT Indonesia Power.
General Provisions- Law No. 17 of 2019 on Water Resources- Government Regulation No. 121 of 2015 on
Exploitation of Water Resources
Kantor Pusat:- Bidang Lingkungan yang berada di bawah Vice President
Health, Safety and Environment- Vice President of Project Management and Pre-ConstructionUnit Kerja:Manajer Operasi dan Manajer Administrasi
Head Office:- Environmental sector, which is the responsibility of the Vice
President Health, Safety, and Environment- Vice President of Project Management and Pre-ConstructionWork Unit: Operations Manager and Administration Manager
KebijakanPolicy
Penanggung JawabPerson in Charge
169 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
- Pemenuhan kepatuhan pengelolaan dan penggunaan air dalam proses pembangkit listrik.
- Fulfill compliance with water management and consumption in the power generation process.
- Setiap unit melakukan upaya konservasi air dengan mendaur ulang air yang telah dipakai untuk keperluan lain serta mendaur ulang air limbah dengan instalasi pengolah air agar hasilnya dapat dipakai kembali ke dalam proses.
- Every unit carried out a water conservation method by recycling used water for other purposes, and recycling wastewater through installation of water treatment plant so that the water can be reutilized into the process.
- Total konservasi air melalui kegiatan Reduce, Reuse and Recycle (3R) sebanyak 1.641.661,69 m3, dengan rincian untuk proses produksi sebanyak 1.018.623,68 m3 dan untuk proses domestik sebanyak 623.038,01 m3.
- Total water conservation through Reduce, Reuse, and Recycle (3R) is 1,641,661.69 m3, consisting of production process consumption of 1,018,623.68 m3 and domestic process consumption of 623,038.01 m3.
- Pemanfaatan limbah cair dengan sistem RO (Reverse Osmosis)
- Reusing limbah cair PLTU batubara untuk penyiraman stock pile
- Utilization of liquid waste with RO (Reverse Osmosis) system
- Reusing coal-fired power plant wastewater for stocking pile
- Melaksanakan peningkatan pemanfaatan limbah cair dan upaya pengurangan penggunaan air sebagai bagian dari evaluasi pengelolaan air di tahun 2019.
- Improving the utilization of liquid waste and efforts to reduce water consumption as part of the evaluation of water management in 2019.
KomitmenCommitment
RealisasiRealization
Sasaran dan TargetGoals and Targets
EvaluasiEvaluation
Program/InisiatifProgram/Initiative
170 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pengelolaan Dampak LingkunganEnvironmental Impact Management
Dalam mendukung keperluan proses pendinginan, proses operasi pembangkit dan kegiatan pendukung seperti penggunaan untuk keperluan domestik/kantor serta pembersihan dan pemeliharaan pembangkit, Indonesia Power menggunakan air yang bersumber dari air tanah, air permukaan dan air PAM/PDAM. Selain itu, Indonesia Power juga memanfaatkan air daur ulang untuk dipakai kembali ke dalam proses operasi dan kegiatan pendukung. Pada tahun 2019, Indonesia Power terus menekan agar setiap tahunnya terjadi penurunan penggunaan air Perusahaan yang bersumber dari air tanah untuk mengurangi dampak negatif bagi lingkungan akibat pengambilan air tanah. [GRI 303-1, 303-2]
Selama tahun 2019, Indonesia Power telah melakukan pengelolaan air yang berkelanjutan yakni dalam proses pengambilan penggunaan air, Indonesia Power tidak memiliki dampak negatif pada ekosistem perairan badan air. Hal ini dibuktikan bahwa Indonesia Power tidak menggunakan air yang bersumber dari badan air yang berada di kawasan lindung secara nasional maupun internasional. Selain itu, Indonesia Power juga tidak menggunakan air yang bersumber dari badan air yang berada di lokasi-lokasi daerah water-stressed area, yaitu daerah-daerah dimana permintaan air melebihi jumlah yang tersedia. Semua ini dibuktikan dengan adanya pemenuhan kepatuhan Biru PROPER terhadap seluruh unit pembangkit dan bentuk kepatuhan Perusahaan terhadap Undang-undang Nomor 17 Tahun 2019 tentang Sumber Daya Air dan Peraturan Pemerintah Nomor 121 Tahun 2015 tentang Pengusahaan Sumber Daya Air. Indonesia Power juga terus berupaya dalam melakukan program efisiensi/pengurangan penggunaan sumber daya air dan menjaga ekosistem perairan/laut untuk menjaga keberlanjutan sumber daya air. [GRI 303-2]
Selama tahun 2019, total penggunaan air Perusahaan sebanyak 14.730.087,71 m3, meningkat 10,53% dibandingkan tahun 2018 yaitu sebanyak 13.326.671,79 m3. Hal ini dikarenakan terjadinya kendala operasional di PLTU Batubara. Metode pengukuran yang digunakan Indonesia Power dalam perhitungan penggunaan air dilakukan dengan memantau langsung flow meter pemakaian air setiap bulannya dan dimasukkan dalam laporan bulanan ke Kantor Pusat.
In supporting the cooling process, the plant operation process and supporting activities such as consumption for domestic/office use, and cleaning and maintenance of the plant, Indonesia Power uses water sourced from groundwater, surface water, and local water from PAM/PDAM. In addition, Indonesia Power also utilizes recycled water to be reused in operational processes and supporting activities. In 2019, Indonesia Power will continue to target an annual decrease in the water consumption of the Company’s water sources to reduce the negative impact on the environment due to groundwater extraction. [GRI 303-1, 303-2]
During 2019, Indonesia Power has carried out sustainable water management, i.e. in the process of taking the water, Indonesia Power has no negative impact on the aquatic ecosystems of water bodies. This is a form of Indonesia Power’s commitment to not utilizing water from the body of water located in national and international protected areas. In addition, Indonesia Power also does not use water sourced from the body of water that is located at water-stressed areas, i.e. areas where the water demand exceeds the available amount. All of this is evidenced by the fulfillment of compliance with Blue PROPER at all generating units. These are also form of Company’s compliance with Law No. 17 of 2019 on Water Resources, and Government Regulation No. 121 of 2015 on Exploitation of Water Resources. Indonesia Power also strives to carry out efficiency/reduction programs in the use of water resources and maintain the aquatic/marine ecosystem to maintain the sustainability of water resources. [GRI 303-2]
During 2019, the Company’s total water consumption was 14,730,087.71 m3, which increased by 10.53% compared to 2018, which was 13,326,671.79 m3. This is due to operational issues at the Coal-Fired SPP. Indonesia Power calculates the water consumption by directly monitoring the flow meter of water consumption every month, and included in a monthly report to the Head Office.
Penggunaan AirWater Consumption
171 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Untuk melihat total penggunaan air per setiap produksi tenaga listrik guna mengetahui tingkat penurunan penggunaan air, Indonesia Power melakukan perhitungan rasio intensitas air dengan menggunakan denominator total produksi bruto pembangkit thermal sebagai faktor yang paling relevan.
Pada tahun 2019, rasio intensitas air Perusahaan sebesar 0,000212 m3/kWh, meningkat 17,32% dibandingkan tahun 2018 yaitu sebesar 0,000181 m3/kWh. Hal ini dikarenakan terjadinya kendala operasional di PLTU Batubara.
Indonesia Power calculates the water intensity ratio using the total gross production of thermal power plants as the most relevant factor to understand the total water consumption per each electricity generated to determine the level of water consumption reduction.
In 2019, the Company’s water intensity ratio was 0.000212 m3/kWh, which increased by 17.32% compared to 2018, which was 0.000181 m3/kWh. This is due to operational issues at the Coal-Fired SPP.
Intensitas AirWater Intensity
Sumber AirWater Sources
Volume (m3)
2017 2018 2019
Air Tanah Groundwater 161.962,00 69.421,25 42.438,50Air Permukaan (termasuk lahan basah/rawa, sungai, danau dan laut)Surface Water (including wetlands/swamps, rivers, lakes, and sea) 13.712.674,50 11.143.471,70 13.476.207,81
Air PAM/PDAM PAM/PDAM 1.031.954,00 2.113.778,84 1.211.441,40
Total 14.906.590,50 13.326.671,79 14.730.087,71
Penggunaan Air Indonesia Power Berdasarkan Sumber [GRI 303-1]Indonesia Power Water Consumption by Sources [GRI 303-1]
2017 2018 2019
Total Pemakaian Air (m3) Total Water Consumption (m3) 14.906.590,50 13.326.671,79 14.730.087,71Total Produksi Bruto Pembangkit Thermal (kWh)Total Thermal Power Plant Gross Production (kWh) 71.920.404.772,21 73.821.284.793,79 69.548.170.387,80
Intensitas Air (m3/kWh) Water Intensity (m3/kWh) 0,000207 0,000181 0,000212
Intensitas Air Indonesia Power Total Water Consumption
172 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pengelolaan Dampak LingkunganEnvironmental Impact Management
Sebagai upaya menekan penggunaan air tanah untuk digunakan dalam proses operasi Perusahaan, Indonesia Power melakukan konservasi air melalui program daur ulang air yang telah dipakai untuk keperluan lain serta daur ulang air limbah dengan instalasi pengolah air. Selain itu, Indonesia Power juga melakukan pemanfaatan limbah cair dengan sistem Reverse Osmosis (RO) dan melakukan reusing limbah cair PLTU batubara untuk penyiraman stock pile.
Selama tahun 2019, Indonesia Power telah melakukan konservasi air sebanyak 1.018.623,68 m3 untuk proses produksi dan 623.038,01 m3 untuk kebutuhan domestik. Jumlah ini meningkat dari tahun sebelumnya dikarenakan adanya penurunan pemakaian air tetapi kebutuhan dan pemanfaatan 3R air tetap dilakukan secara maksimal.
Indonesia Power conserves water by water recycling program to reutilize the water for other purposes, as well as recycling wastewater with a water treatment plant to reduce the use of groundwater in the Company’s operations. In addition, Indonesia Power utilizes liquid waste by using a Reverse Osmosis (RO) system and reuses liquid waste from coal-fired steam power plants for stocking pile.
During 2019, Indonesia Power has conserved 1,018,623.68 m3 of water for the production process and 623,038.01 m3 for domestic needs. This number increased from the previous year due to a decrease in water consumption, supported by the need and optimal utilization of the 3R water program.
Program Konservasi AirWater Conservation Programs
KegiatanActivity
Proses ProduksiProduction Process
Kebutuhan DomestikDomestic Use
2017 2018 2019 2017 2018 2019
Pemakaian AirWater Consumption
10.561.806,00 10.554.247,91 12.727.815,64 4.344.784,50 2.772.423,88 2.002.272,07
Kegiatan Reduce, Reuse, Recycle (3R) Reduce, Reuse, Recycle (3R) ActivitiesReuse dan recycle sisa proses produksiReuse and recycle the water residue from the production process
603.606,15 1.015.438,34 756.465,04 119.483,00 374.854,85 612.839,37
Pemanfaatan sisa limbah cair domestik (grey water)Utilization of residual domestic liquid waste (gray water)
- 9.648,82 87.061,29 3.861,85 4.541,76 6.180,84
Penyiraman Stock File & Penyiraman AbuStock File and Ash Watering
99.477,92 101.633,93 136.221,99 4.175,28 3.962,63 4.017,80
Jumlah Kegiatan 3RTotal 3R Activities 710.066,07 1.147.379,38 1.018.623,68 127.520,133 383.359,24 623.038,01
Persentase Percentage (%) 6,72% 10,87% 8,00% 2,94% 13,83% 31,12%
Volume Air Indonesia Power yang Didaur Ulang (m3) [GRI 303-3]Indonesia Power Recycled Water Volume (m3) [GRI 303-3]
173 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
174 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pendekatan ManajemenTopik Pengelolaan Limbah[GRI 103-1, 103-2, 103-3]Management Approachto Waste Management[GRI 103-1, 103-2, 103-3]
Topik Pengelolaan Limbah menjadi topik yang penting bagi Indonesia Power karena limbah merupakan sisa dari proses produksi. Limbah dari proses pembangkit terdiri dari limbah cair produksi dan domestik serta Limbah B3 dan Limbah Non B3. Pengendalian dan pengelolaan limbah merupakan salah satu dari Penaatan Regulasi dan salah satu upaya dalam pencegahan terhadap pencemaran lingkungan.
The Waste Management is an important topic for Indonesia Power because the waste is the residual of the production process. Waste from the generating process consists of production and domestic liquid waste, as well as B3 and Non-B3 Waste. Waste management and control is one of the Compliance with Regulations, and an effort to prevent environmental pollution.
Pengelolaan LimbahWaste Management
Pengelolaan Dampak LingkunganEnvironmental Impact Management
Kebijakan Perusahaan- Keputusan Direksi Nomor 41.K/010/IP/2012 tentang Kebijakan
Keselamatan dan Kesehatan Kerja serta Lingkungan di PT Indonesia Power
- Keputusan Direksi Nomor 152.K/010/IP/2014 tentang Pengelolaan Limbah di Lingkungan Perusahaan
- Keputusan Direksi Nomor 73.K/010/IP/2016 tentang Pengelolaan Limbah Unit Jasa Pembangkitan PLTU Batubara FTP-1 Jawa
- Keputusan Direksi Nomor 249.K/010/lP/2015 tentang Pedoman Penerapan Green Power Plant Di Lingkungan PT Indonesia Power
- Surat Keputusan Direksi Nomor 191.K/010/IP/2019 tentang Pengelolaan Limbah di Lingkungan PT Indonesia Power
- Surat Keputusan Direksi Nomor 55.K/020/IP/2019 tentang Tim Percepatan perolehan Ijin Pemanfaatan Limbah Fly Ash dan Bottom Ash (FABA) di PT Indonesia Power
Ketentuan Umum- Peraturan Pemerintah Nomor 101 Tahun 2014 tentang Pengelolaan
Limbah Bahan Berbahaya dan Beracun- Peraturan Pemerintah Nomor 82 tahun 2001 tentang Pengelolaan
Kualitas Air dan Pengendalian Pencemaran Air- Peraturan Menteri Lingkungan Hidup Nomor 8 Tahun 2009 tentang
Baku Mutu Air Limbah bagi Usaha dan/atau Kegiatan Pembangkit Listrik Tenaga Thermal
- Peraturan Menteri Lingkungan Hidup dan Kehutanan Nomor 68 Tahun 2016 tentang Baku Mutu Air Limbah Domestik
- Peraturan Pemerintah Nomor 81 Tahun 2012 tentang Pengelolaan Sampah Rumah Tangga dan Sampah Sejenis Sampah Rumah Tangga
Company’s Policies- Board of Directors’ Decree No. 41.K/010/IP/2012 on Occupational
Health and Safety Policy within PT Indonesia Power- Board of Directors’ Decree No. 152.K/010/IP/2014 on the Waste
Management within the Company’s Environment- Directors’ Decree No. 73.K/010/IP/2016 on Waste Management in
Generating Service Unit of PLTU Batubara FTP-1 Java- Board of Directors’ Decree No. 249.K/010/IP/2015 on Guidelines
on Green Power Plant Implementation within the environment of PT Indonesia Power.
- Board of Directors’ Decree No. 191.K/010/IP/2019 on the Waste Management within PT Indonesia Power
- Board of Directors’ Decree No. 55.K/020/IP/2019 on the Licensing Task Force for Acquisition of Fly Ash and Bottom Ash (FABA) Waste Utilization at PT Indonesia Power.
General Provisions- Government Regulation No. 101 of 2014 on Hazardous Material
Waste Management - Government Regulation No. 82 of 2001 on the Water Quality
Management and Water Pollution Control- Minister of Environment Regulation No. 8 of 2009 on Wastewater
Quality Standards for Thermal Power Plant Businesses and/or Activities;
- Minister of Environment and Forestry Regulation No. 68 of 2016 on the Domestic Wastewater Quality Standards
- Government Regulation No. 81 of 2012 on Household Waste and Similar Household Waste Management
KebijakanPolicy
175 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
- Pemenuhan kepatuhan tata kelola lingkungan sebagai Strategic Initiatives yang tercantum dalam Rencana Jangka Panjang 2019 – 2023.
- Fulfillment of compliance with environmental management as Strategic Initiatives listed in the 2019-2023 Long-Term Plan.
- Penaatan terhadap seluruh pengelolaan limbah B3, limbah non B3 dan limbah cair serta ketentuan dokumen dan teknis
- Improvement Pengelolaan dan Pemanfaatan Fly Ash dan Bottom Ash (FABA)
- Compliance with all B3 waste management, non-B3 waste, and liquid waste, as well as document and technical provisions
- Improvement of Fly Ash and Bottom Ash (FABA) Management and Utilization
- Jumlah limbah B3 yang dimanfaatkan menjadi batako dan paving block sebanyak 739,55 ton
- Jumlah limbah non B3 yang dimanfaatkan menjadi kompos sebanyak 111,47 ton
- Pemenuhan 100% ketaatan baku mutu limbah cair- Penyusunan kebijakan dan peningkatan
pemanfaatan FABA melalui:1. Pembuatan SK Baru Pengelolaan Limbah2. Pembentukan Tim Percepatan izin Pemanfaatan
FABA3. Pendampingan dan Monitoring Pengajuan Izin
Pemanfaatan FABA
- The amount of B3 waste utilized as brick and paving blocks is 739.55 tons
- The amount of non-B3 waste utilized as compost was 111.47 tons
- 100% compliance with liquid waste quality standards
- Formulating policies and increasing the utilization of FABA through:1. Making New SK on Waste Management2. Establishing FABA Utilization Task Force3. Assistance and Monitoring for Submission of
FABA Utilization Permit
- Pemanfaatan limbah FABA menjadi batako dan paving block, limbah serasah mangrove untuk memproduksi batik serta limbah koran untuk dijadikan berbagai produk handycraft;
- Monitoring dan pengukuran secara periodik sesuai izin pembuangan limbah cair;
- Pemanfaatan aplikasi online untuk menggantikan keperluan pencetakan (reduce limbah kertas);
- Penggunaan kembali (reduce) minyak pelumas trafo dan pelumas mesin pembangkit dengan penyaringan dan pemurnian ulang;
- Pengembangan kompos organik dan daur ulang sampah plastik melalui program Hijaunesia Power.
- Utilization of FABA waste into bricks and paving blocks, mangrove litter waste to produce batik, and newspaper waste to be used as various handicraft products;
- Regular monitoring and measurement in accordance with the liquid waste disposal permit;
- Utilizing online application to replace printing necessities (reducing paper waste);
- Reusing lubricants of transformer and generators by filtering and re-purification;
- Development of organic compost and plastic waste recycling through Hijaunesia Power Program.
Kantor Pusat:- Bidang Lingkungan yang berada di
bawah Vice President Health, Safety and Environment
- Vice President of Project Management and Pre-Construction
Unit Kerja:- Manajer Operasi dan Manajer
Administrasi
Head Office:- Environmental sector, which is the
responsibility of the Vice President Health, Safety, and Environment
- Vice President of Project Management and Pre-Construction
Work Unit:- Operations Manager and
Administration Manager
Melaksanakan program evaluasi pengelolaan limbah di tahun 2019:- Melaksanakan
peningkatan pemanfaatan limbah FABA
- Pengurangan timbulan limbah B3
- Penurunan beban pencemaran limbah cair
Implementing waste management evaluation programs in 2019:- Improving the use of FABA
waste- Reducing the hazardous
waste generation- Reducing the load of liquid
waste pollution
KomitmenCommitment
RealisasiRealization
Sasaran dan TargetGoals and Targets
EvaluasiEvaluation
Program/InisiatifProgram/Initiative
Penanggung JawabPerson in Charge
176 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pengelolaan Dampak LingkunganEnvironmental Impact Management
Upaya lain yang dilakukan Indonesia Power dalam mengelola dampak lingkungan guna mencegah dan meminimalkan dampak negatif yang timbul atas kegiatan operasi Perusahaan adalah melalui pengelolaan limbah. Indonesia Power telah mengkategorikan limbah menjadi dua jenis, yaitu limbah Bahan Beracun dan Berbahaya (B3) dan Limbah Padat Non Bahan Beracun dan Berbahaya (non-B3).
Jenis limbah B3 yang dihasilkan dari kegiatan Perusahaan yakni mengkonversi energi primer menjadi listrik terdiri dari fly ash, bottom ash, pelumas bekas dan lain lain. Bentuk program pengelolaan limbah B3 Indonesia Power terdiri dari tiga bentuk, yaitu penyimpanan, pengangkutan dan pemanfaatan limbah B3 sesuai dengan Peraturan Pemerintah Nomor 101 tahun 2014 tentang Pengelolaan Limbah Bahan Berbahaya dan Beracun.
The Company’s activity generated B3 waste through the conversion of primary energy to electricity, and the types of waste consist of fly ash, bottom ash, used lubricants, etc. Indonesia Power B3 waste management program consists of three categories, i.e. storage, transportation, and utilization of B3 waste in accordance with Government Regulation No. 101 of 2014 on Hazardous Material Waste Management.
Indonesia Power also performed another effort in managing environmental impacts to prevent and minimize negative impacts arising from the Company’s operations through waste management. Indonesia Power has categorized waste into two types, i.e. Toxic and Hazardous Materials (B3) waste and Non-Toxic and Hazardous (non-B3) Solid Waste.
Pengelolaan dan Pemanfaatan Limbah B3B3 Waste Management and Utilization
Bentuk Program Pengelolaan Limbah B3 Indonesia PowerIndonesia Power B3 Waste Management Program
Penyimpanan Limbah B3B3 Waste
torage
Pengangkutan Limbah B3B3 Waste
Transportation
Pemanfaatan Limbah B3B3 WasteUtilization
Proses dan waktu penyimpanan limbah B3 dilakukan sesuai ketentuan peraturan dan izin yang dimiliki oleh masing-masing unit.The B3 waste is stored and processed within the time in accordance with the regulations and permits owned by each unit.
Pengangkutan limbah B3 bekerja sama dengan pihak ketiga pengangkut limbah B3 yang lengkap memiliki izin, kerjasama dan sesuai ketentuan.B3 waste is transported in collaboration with third parties that have the permit as transporter, under the provisions agreed upon and in compliance with the provisions.
Pemanfaatan limbah B3 hanya dilakukan secara internal terhadap Unit yang telah memiliki Izin Pemanfaatan limbah B3 (Labuan, Suralaya dan Pelabuan Ratu). Untuk Unit yang tidak memiliki Izin, limbah B3 dikirim ke Pemanfaat limbah B3 yang memiliki izin dan kerjasama.B3 waste is only utilized internally at Units that already have B3 Waste Utilization Permits (Labuan, Suralaya and Pelabuan Ratu). For Units that do not have the said Permit, B3 waste is sent to B3 waste User with permit and cooperation with the Company.
Seluruh limbah B3 yang dihasilkan unit Perusahaan dikelola oleh pihak ketiga (YPK) dan dikirim ke pengolah/pemanfaat yang memiliki izin dari Kementerian Lingkungan Hidup dan Kehutanan. Selama tahun 2019, jumlah limbah B3 Indonesia Power yang diangkut dari tempat penyimpanan Perusahaan menuju lokasi pengelola (pihak ketiga) sebanyak 1.243.964,62
All B3 waste generated by the Company’s units is managed by a third party (YPK) and sent to processors/users who have licenses from the Ministry of Environment and Forestry. During 2019, Indonesia Power transported B3 waste from the Company’s storage area to the management location (third party) of 1,243,964.62 tons, an increase compared to 2018,
177 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
ton, meningkat dibandingkan tahun 2018 yaitu sebanyak 504.065,38 ton. Hal ini dikarenakan terjadinya peningkatan jumlah konsumsi/operasional PLTU Batubara. Selama tahun 2019, tidak terdapat limbah B3 yang diimpor/diekspor maupun dikirim secara internasional. [GRI 306-2, 306-4]
Selama tahun 2019, Indonesia Power berhasil melakukan pemanfaatan limbah B3 fly ash dan bottom ash menjadi batako dan paving block sebanyak 822,49 ton, meningkat 11,21% dibandingkan tahun 2018 yaitu sebanyak 739,55 ton.
which was 504,065.38 tons. This is due to an increase in the consumption/operations of Coal-Fired SPP. During 2019, no B3 waste was imported/exported or shipped internationally. [GRI 306-2, 306-4]
In 2019, Indonesia Power succeeded in utilizing B3 fly ash and bottom ash waste into brick and paving blocks of 822.49 tons, which increased by 11.21% compared to 2018, which was 739.55 tons.
Bagan Pemanfaatan FABAFaba Utilization
Jenis Limbah B3Type of Toxic and Hazardous Waste
Metode PengelolaanManagement Method
Jumlah Limbah Total Waste
2017 2018 2019
Limbah yang Dikelola Waste Managed
Fly Ash Seluruh Limbah B3 yang dihasilkan unit dikelola oleh YPK dan dikirim ke pengolah/pemanfaat yang memiliki izinAll Toxic and Hazardous Waste produced by the unit is managed by YPK and will be sent to licensed processor/beneficiaries
440.512,15 399.834,93 963.881,55
Bottom Ash 110.128,04 104.054,03 277.195,89Pelumas bekasUsed Lubricants 106,24 130,01 540,50
Lainnya Others 1.606,60 46,41 2.346,67
Jumlah Total 552.353,03 504.065,38 1.243.964,62
Limbah yang Dimanfaatkan Waste Utilized
Fly Ash Limbah B3 Fly Ash dan Bottom Ash dimanfaatkan menjadi batako dan paving blockB3 Fly Ash and Bottom Ash waste are utilized as blocks and paving blocks
28,62 148,88 172,06
Bottom Ash 76,18 590,674 650,44
Jumlah Total 104,80 739,55 822,49
Volume dan Metode Pengelolaan Limbah B3 (Ton) [GRI 306-2]Volume and Methods of Toxic and Hazardous Material (B3) Waste Management (Ton) [GRI 306-2]
FABA adalah abu sisa pembakaran batubara berupa fly ash dan bottom ashFABA is coal combustion residue in the form of fly ash and bottom ash
Pemanfaatan FABA Sampai dengan Desember 2019FABA Utilization as of December 2019
Paving- Suralaya PGU: 427.506 buah- PLTU Banten 2 Labuan OMU: 18.745 buah- Suralaya PGU: 427,506 pieces- SPP Banten 2 Labuan OMU: 18,745 pieces
Tiang Panel Panel Pole- PLTU Banten 2 Labuan OMU: 212 buah- SPP Banten 2 Labuan OMU: 212 pieces
Eco Park Suralaya PGU:- Jogging Track- Tempat Parkir Kendaraan Roda 2- Taman Bermain- Lapangan Futsal- Lapangan Basket- Lapangan Voli
Suralaya PGU:- Jogging Track- Parking for 2-wheeled vehicles- Playground- Futsal field- Basketball court- Volleyball court
178 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pengelolaan Dampak LingkunganEnvironmental Impact Management
Jenis limbah non B3 yang dihasilkan dari kegiatan Perusahaan terdiri dari limbah organik dan non-organik. Bentuk program pengelolaan limbah non B3 Indonesia Power melalui pemisahan jenis sampah antara sampah organik dan non-organik. Sampah organik akan dilanjutkan ke proses pengomposan, sedangkan sampah non-organik akan dikelola bersama dengan pihak ketiga atau mitra Perusahaan menjadi cinderamata atau kerajinan tangan yang bernilai ekonomis bagi masyarakat.
Selama tahun 2019, jumlah limbah non B3 yang dihasilkan dan dikelola Perusahaan sebanyak 5.974,78 ton, menurun dibandingkan tahun 2018 yaitu sebanyak 7.631,72 ton. Hal ini menunjukkan keberhasilan Indonesia Power dikarenakan terdapat beberapa inisiatif program pemanfaatan dalam menekan limbah non B3. Dari limbah yang dihasilkan tersebut, Indonesia Power berhasil melakukan daur ulang sampah organik tersebut untuk pembuatan kompos sebanyak 51,07 ton atau 0,85% dari total limbah non B3.
The Company’s activities generated non-B3 waste consisting of organic and non-organic waste. Indonesia Power manages non-B3 waste through the program to separate organic and non-organic waste. Organic waste would be processed into compost, and non-organic waste would be managed with a third party or the Company’s partner to be processed into a souvenir or handy craft with economic value for the community.
During 2019, the amount of non-B3 waste generated and managed by the Company was 5,974.78 tons, a decline compared to 2018, which was 7,631.72 tons. This reflects Indonesia Power’s success because there are several initiatives of the utilization program to suppress the non-B3 waste. Out of the generated waste, Indonesia Power managed to recycle the organic waste to the compost of 51.07 tons or 0.85% of the total non-B3 waste.
Pengelolaan dan Pemanfaatan Limbah Non B3Non-B3 Waste Management and Utilization
Pengembangan kompos organik dan daur ulang sampah plastik melalui program Hijaunesia Power dan Tempat Olah Sampah Setempat (TOSS)Development of organic compost and plastic waste recycling through Hijaunesia Power and Local Trash Can (TOSS)
Pemanfaatan limbah koran dan kaleng/botol bekas untuk dijadikan berbagai produk-produk handycraftUtilization of old newspaper and used cans/bottles to be made into handy craft products.
Pemanfaatan limbah serasah mangrove untuk memproduksi batikUtilization of mangrove litter waste for batik production
Pemanfaatan aplikasi online untuk menggantikan keperluan pencetakan (reduce limbah kertas)Utilizing online application to replace printing necessities (reducing paper waste)
Jenis Limbah Non-B3Type of Non-B3 Waste
Metode PengelolaanManagement Method
Jumlah Limbah Waste Managed
2017 2018 2019
OrganikOrganic
Dimanfaatkan untuk pembuatan kompos Used in composting 247,62 111,47 51,07
Non-OrganikNon-Organic
Dikirim ke pihak ketiga/TPASent to third party/landfill 9.285,74 7.520,25 5923,71
Jumlah Sampah yang Dihasilkan Waste Generated 9.533,36 7.631,72 5.974,78% Limbah di Daur Ulang (Composting)% Waste Recycled (Composting) 2,60 1,46 0,85
Volume dan Metode Pengelolaan Limbah Non-B3 (Ton) [GRI 306-2]Volume and Methods of Non-Toxic and Non-Hazardous Material (Non-B3) Waste Management (Ton) [GRI 306-2]
179 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Pelepasan efluen atau limbah buangan berbentuk cair (air limbah) yang tidak dikelola dengan baik dapat menimbulkan dampak negatif bagi lingkungan dan kesehatan karena dapat memengaruhi badan air tujuan pembuangan, kualitas pasokan air yang tersedia serta terciptanya hubungan yang tidak baik antara Perusahaan dengan masyarakat dan pengguna air lainnya. Untuk itu, Indonesia Power senantiasa memperhatikan kualitas air limbah yang dihasilkan dari kegiatan produksi maupun kegiatan domestik sesuai dengan standar baku mutu yang berlaku sebelum air limbah tersebut dialirkan ke badan air sesuai dengan Peraturan Pemerintah Nomor 82 tahun 2001 tentang Pengelolaan Kualitas Air dan Pengendalian Pencemaran Air.
The release of effluent or liquid waste that is not managed properly can harm the environment and health because it can affect the body of water for disposal, the quality of available water supply, and create an unfavorable relationship between the Company and the community and other water users. Therefore, Indonesia Power pays attention to the quality of wastewater generated from production and domestic activities, in accordance with the prevailing quality standards before the wastewater is flowed into water bodies, in accordance with Government Regulation No. 82 of 2001 on the Water Quality Management and Water Pollution Control.
Pengelolaan EfluenEffluent Management
Unit Metode Pengelolaan Air LimbahWastewater Management Methods
Badan Air Tujuan Pelepasan Air
LimbahBody of Water for
Wastewater Release
Volume Air LimbahWastewater Volume
2017 2018 2019
Suralaya Waste Water Treatment Plant (WWTP):Prinsip Pengolahan Secara Fisika & KimiaWaste Water Treatment Plant (WWTP):Physical & Chemical Processing
Muara KanalCanal Estuary
87.169,00 77.394,00 79.273,00
Banten 1 Suralaya
Waste Water Treatment Plant (WWTP):Prinsip Pengolahan Secara Fisika & KimiaWaste Water Treatment Plant (WWTP):Physical & Chemical Processing
LautSea
7.067,70 5.607,10 7.172,10
Banten 2 Labuan
Pengendapan - Activated Sludge - Treatment PondSettling - Activated Sludge - Treatment Pond
LautSea
- - -
Banten 3 Lontar
Waste Water Treatment Plant (WWTP):Prinsip Pengolahan Secara Fisika & KimiaWaste Water Treatment Plant (WWTP):Physical & Chemical Processing
Laut Utara JawaNorth Java Sea
19.601,00 41.614,00 27.708,00
Priok Waste Water Treatment Plant (WWTP):Prinsip Pengolahan Secara Fisika & KimiaWaste Water Treatment Plant (WWTP):Physical & Chemical Processing
LautSea
100.590,00 77.394,00 135.989,00
Sewage Treatment PlantSewage Treatment Plant
LautSea 6.443,00 5.315,00 3.946,00
Pelabuhan Ratu
Waste Water Treatment Plant (WWTP):Prinsip Pengolahan Secara Fisika & KimiaWaste Water Treatment Plant (WWTP):Physical & Chemical Processing
LautSea
- - -
Adipala Waste Water Treatment Plant (WWTP):Prinsip Pengolahan Secara Fisika & KimiaWaste Water Treatment Plant (WWTP):Physical & Chemical Processing
LautSea
46.220,20 28.193,64 88.424,02
Pengelolaan Efluen (Air Limbah) Indonesia Power [GRI 306-1, 306-5]Indonesia Power Effluent (Wastewater) Management [GRI 306-1, 306-5]
180 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Unit Metode Pengelolaan Air LimbahWastewater Management Methods
Badan Air Tujuan Pelepasan Air
LimbahBody of Water for
Wastewater Release
Volume Air LimbahWastewater Volume
2017 2018 2019
Semarang Waste Water Treatment Plant (WWTP):Prinsip Pengolahan Secara Fisika & KimiaWaste Water Treatment Plant (WWTP):Physical & Chemical Processing
LautSea
394,00 162,00 230,40
Oil Separator Oil Separator Laut Sea 4.110,00 7.986,00 1.081,30
Grati Waste Water Treatment Plant (WWTP):Prinsip Pengolahan Secara Fisika & KimiaWaste Water Treatment Plant (WWTP):Physical & Chemical Processing
LautSea
16.725,93 32.698,72 82.983,60
Bali Gilimanuk Waste Water GardenWaste Water Garden
TamanPark
228,00 173,00 38,50
Bali Pemaron Waste Water Treatment Plant (WWTP):Prinsip Pengolahan Secara Fisika & KimiaWaste Water Treatment Plant (WWTP):Physical & Chemical Processing
Badan Air Body of Water
870,70 902,40 364,56
Bali Pesanggaran
Separator dan Waste Water GardenSeparator and Waste Water Garden
SungaiRiver
16.580,60 14.303,70 12.572,30
Jumlah Volume Air Limbah (m3) Total Wastewater Volume (m3) 306.000,13 291.743,56 439.782,78
Pengelolaan Dampak LingkunganEnvironmental Impact Management
Pengukuran air limbah dilakukan secara rutin setiap satu atau tiga bulan sekali sesuai dengan standar baku mutu yang berlaku dan ketentuan pada Rencana Pengelolaan Lingkungan/Rencana Pemantauan Lingkungan (RKL/RPL) melalui laboratorium yang terakreditasi Komite Akreditasi Nasional (KAN). Hasil dari pengukuran ini telah dilaporkan kepada Pemerintah Daerah dan Kementerian Lingkungan Hidup dan Kehutanan (KLHK) sesuai dengan ketentuan yang telah ditetapkan.
Wastewater is regularly measured every one or three months, in accordance with applicable quality standards and the provisions of the Environmental Management Plan/Environmental Monitoring Plan (RKL/RPL) through a laboratory accredited by the National Accreditation Committee (KAN). The results of these measurements are reported to the Local Government and the Ministry of Environment and Forestry (KLHK) in accordance with the established provisions.
ParameterParameter
SatuanUnit
Baku MutuStandards
Rata-rata KorporatCorporate Average
KetaatanAdherence
PH - 6-9 7,70 100%
TSS mg/L 100,00 23,46 100%
Fe mg/L 3,00 0,34 100%
Cu mg/L 0,50 0,04 100%
Cr mg/L 0,50 0,04 100%
Zn mg/L 1,00 0,05 100%
PO4 mg/L 10,00 0,31 100%
Klorin Bebas Free Chlorine mg/L - 0,08 100%
Minyak dan Lemak Oil and Grease mg/L 5,00 1,69 100%
Pengukuran Kualitas Air Limbah Indonesia Power Tahun 2019Indonesia Power Wastewater Quality in 2019
181 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Jenis Bahan KimiaType of Chemical
SatuanUnit
VolumeVolume
KeteranganDescription
NaOH Liter 319.729,51 Korosif Corrosive
HCl Liter 518.072,31 Korosif Corrosive
Hidrazine Liter 58.830,10 Beracun Toxic
Phospat/TSP Liter 2.833,09 Beracun Toxic
Bahan Kimia yang Digunakan Tahun 2019Chemicals Used in 2019
Sebagai energi primer, Indonesia Power menggunakan batubara sebagai bahan baku energi untuk menggerakkan Pembangkit Listrik Tenaga Uap (PLTU). Indonesia Power menggunakan pihak ketiga dalam mengangkut batubara ke lokasi proyek Perusahaan. Pada saat pemindahan batubara dari kapal ke tempat penimbunan memungkinkan terjadinya tumpahan batabara. Untuk mencegah terjadinya pencemaran lingkungan terhadap badan air, Indonesia Power mensyaratkan kepada pihak ketiga pemilik kapal agar kapal tersebut dilengkapi dengan alat/tempat penampungan tumpahan (spillage plate) pada tepi kapal. Penanganan dan penyimpanan B3 (minyak pelumas dan bahan kimia) dilakukan sesuai prosedur. Seluruh risiko dan dampak lingkungan juga dilakukan identifikasi dan mitigasi untuk mencegah terjadinya ketidaksesuaian pengelolaan B3. Selama tahun 2019, tercatat tidak terjadi insiden tumpahan batubara, minyak ataupun B3 yang akan digunakan Perusahaan. [GRI 306-3]
Untuk mendukung proses operasi, Indonesia Power juga menggunakan bahan kimia untuk keperluan pengendalian kualitas siklus uap air pembangkit, pengolahan air baku dan pengolahan air limbah. Jenis bahan kimia yang digunakan Perusahaan adalah sebagai berikut:
Sebagai tahap pencegahan, semua bahan kimia yang digunakan Indonesia Power telah dilengkapi dengan Material Safety Data Sheet (MSDS). Selama tahun 2019, tercatat tidak terjadi insiden tumpahan batubara, minyak/pelumas maupun bahan kimia yang digunakan di seluruh unit pembangkit Perusahaan. [GRI 306-3]
As primary energy, Indonesia Power uses coal as the raw material to drive a Steam Power Plant (SPP). Indonesia Power partners with a third party to transport coal to the Company’s project location. When coal is transported from the ship to the storage, coal spills may occur. Indonesia Power requires third party ship-owners to have vessels that are equipped with a spillage plate at the edge of the ship to prevent environmental pollution to the body of water. B3 (lubricating oil and chemicals) handling and storage is carried out in accordance with the procedure. All environmental risks and impacts are also identified and mitigated to prevent the occurrence of B3 management non-compliance. During 2019, there were no incidents of coal, oil, or B3 spills during the Company’s operations. [GRI 306-3]
Indonesia Power also uses chemicals to control the quality of the steam generator cycle, raw water treatment, and wastewater treatment to support the operation process. The Company uses the following types of chemicals:
As a precautionary stage, all chemicals used by Indonesia Power have been equipped with Material Safety Data Sheets (MSDS). During 2019, there were no incidents of coal, oil/lubricant, or chemical spills used in all of the Company’s generating units. [GRI 306-3]
Penanganan TumpahanSpill Management
182 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pendekatan ManajemenTopik Keanekaragaman Hayati[GRI 103-1, 103-2, 103-3]Management Approach to Biodiversity [GRI 103-1, 103-2, 103-3]
Topik Keanekaragaman Hayati menjadi topik yang penting bagi Indonesia Power karena program pelestarian lingkungan tidak hanya dalam pengendalian dan pengelolaan sumber daya air maupun udara. Pengendalian, pengelolaan dan pelestarian lingkungan terhadap flora dan fauna di lingkungan sekitar pembangkit juga terus dilakukan untuk menjaga dan meningkatkan rona awal kondisi keanekaragaman hayati.
Biodiversity is an important topic for Indonesia Power because the environmental preservation program is under the human’s control, along with the management of water or air resources. The Company carries out environmental control, management, and preservation for flora and fauna in the environment surrounding the plants to maintain and improve the initial baseline of biodiversity conditions.
Kebijakan Perusahaan- Keputusan Direksi Nomor 41.K/010/IP/2012 tentang
Kebijakan Keselamatan dan Kesehatan Kerja serta Lingkungan di PT Indonesia Power
- Keputusan Direksi Nomor 211.K/010/IP/2016 tentang Komitmen Menjaga Ekosistem dan Pelestarian dalam Menjaga Keberlanjutan Planet di PT Indonesia Power
Ketentuan Umum- Undang-Undang Nomor 12 Tahun 1992 tentang Sistem
Budidaya Tanaman- Peraturan Menteri Negara Lingkungan Hidup Nomor
29 tahun 2009 tentang Pedoman Konservasi Keanekaragaman Hayati di Daerah
Company’s Policies:- Board of Directors’ Decree No. 41.K/010/IP/2012
on Occupational Health and Safety Policy within PT Indonesia Power
- Board of Directors’ Decree No. 211.K/010/IP/2016 on Commitment to Protecting and Conserving Ecosystem in Ensuring the Planet’s Sustainability at PT Indonesia Power.
General Provisions- Law No. 12 of 1992 on Plant Cultivation System- Minister of Environment Regulation No. 29 of 2009 on the
Guidelines for Biodiversity Conservation in the Region
Kantor Pusat:- Bidang Lingkungan yang berada di bawah Vice President
Health, Safety and Environment- Vice President of Project Management and Pre-Construction- Manager of Corporate Social ResponsibilityUnit Kerja:- Manajer Operasi dan Manajer Administrasi
Head Office:- Environmental sector, which is the responsibility of the Vice
President Health, Safety, and Environment- Vice President of Project Management and Pre-Construction- Manager of Corporate Social ResponsibilityWork Unit:- Operations Manager and Administration Manager
KebijakanPolicy
Penanggung JawabPerson in Charge
Program Pelestarian LingkunganEnvironmental Conservation Program
183 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
- Pengembangan Program Konservasi Keanekaragaman Hayati melalui kerjasama dengan lembaga atau instansi yang terkait dengan pelestarian keanekaragaman hayati.
- Development of Biodiversity Protection and Conservation Program in collaboration with institutions or agencies related to the biodiversity conservation.
- Peningkatan konservasi keanekaragaman hayati
- Enhanced biodiversity conservation
- Total spesies yang telah dikonservasi sebanyak 15.973 Ekor
- There is a total of 15,973 species conserved
- Program Konservasi Elang Jawa, Jalak Bali, Penyu Lekang, Sapi Putih Taro, Tukik, Rusa Timor, Badak Jawa, Mangrove, Terumbu Karang, Pohon Endemik dan Tanaman Langka.
- Conservation Program of Javan Hawk-Eagle, Bali Myna, Olive Ridley Sea Turtle, White Taro Ox, Tukik, Javan Rusa, Javan Rhinoceros, Mangrove, Coral Reef, Endemic Tree, and Rare Plant.
- Melaksanakan peningkatan konservasi dan kerjasama dengan instansi terkait sebagai bagian dari evaluasi pengelolaan keanekaragaman hayati di tahun 2019.
- Conserving and cooperating with relevant agencies as part of the evaluation of biodiversity management in 2019.
KomitmenCommitment
RealisasiRealization
Sasaran dan TargetGoals and Targets
EvaluasiEvaluation
Program/InisiatifProgram/Initiative
184 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Program Pelestarian LingkunganEnvironmental Conservation Program
Komitmen Indonesia Power dalam menjaga ekosistem lingkungan di sekitar Unit Pembangkit yakni pelaksanaan kegiatan pelestarian lingkungan dan keanekaragaman hayati terejawantahkan melalui Program Hijaunesia Power dan Kawan Hijaunesia Power. Program ini dijalankan melalui kerjasama dengan berbagai pihak, diantaranya yaitu:
Indonesia Power’s commitment to protecting the environmental ecosystem around the Generating Unit, i.e. the environmental preservation and biodiversity activities, is manifested through the Hijaunesia Power and Kawan Hijaunesia Power Programs. These programs are carried out in collaboration with various parties, including:
Kerjasama dan Keterlibatan Pemangku Kepentingan Pada Kegiatan Pelestarian LingkunganStakeholders’ Cooperation and Engagement in the Environmental Conservation Activities
Kementerian Lingkungan Hidup –Direktorat Jenderal Pengendalian Pencemarandan Kerusakan LingkunganMinistry of Environment - Directorate General of Pollution and Environmental Damage Control
Balai Taman Nasional Gunung Halimun dan SalakGunung Halimun - Salak National Park
Pemerintah Kabupaten Jombang dan BPLHD JombangJombang Regency Government and Jombang Environmental Management Agency
Pemerintah Daerah Provinsi Jawa Baratdan BPLHD Jawa BaratWest Java Provincial Government and West Java Environmental Management Agency (BPLHD)
Pemerintah Kota CilegonCilegon Municipality
Taman Nasional Ujung Kulon dan Pemkab PandeglangUjung Kulon National Park and PandeglangRegency Government
Gerakan Ciliwung Bersih dan Pengembangan Eco Village di Srengseng Sawah – Jakarta di PLTGU PriokClean Ciliwung Movement and Eco Village Development in Srengseng Sawah - Jakarta at the Priok CCPP
Optimalisasi Pengelolaan Taman Nasional Gunung Halimun Salak (2014-2018) melalui Program Konservasi Elang Jawa di PLTP Gunung Salak, Jawa BaratOptimization of Gunung Halimun Salak National Park (2014-2018) Management through the Javan Hawk-eagle Conservation Program at Gunung Salak GPP, West Java
Pengelolaan lingkungan hidup di Taman Keanekaragaman Hayati Jombang (2015-2019) di PLTGU Grati, Jawa TimurEnvironmental management of Jombang Biodiversity Park (2015-2019) at the Grati CCPP, East Java
Pengelolaan dan Perlindungan Lingkungan Hidup di Provinsi Jawa Barat (2016-2018) diantaranya melalui gerakan Bersih Citarum, Pengembangan Taman Keanekaragaman Hayati Cukang Monteng dan Datar Keusik di PLTA SagulingEnvironmental Management and Protection in West Java Province (2016-2018) covers the Clean Citarum movement, Development of Cukang Monteng and Datar Keusik Biodiversity Park at Saguling Hydroelectric Power Plant
Pelestarian Keanekaragaman Hayati Melalui Program Revitalisasi dan Pembangunan Hutan Kota Cilegon (2014 – 2019) di PLTU Suralaya 8, BantenBiodiversity Conservation through the Revitalization and Development of Cilegon City Forest (2014 - 2019) at Suralaya 8 SPP, Banten
Konservasi Badak Jawa dan Penanaman Pohon Endemik Kokoleceran (Vatica bantamensis) Konservasi Badak Jawa dan Penanaman Pohon Endemik Kokoleceran (Vatica bantamensis)
185 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Sejak tanggal 3 Oktober 2014, Indonesia Power mencanangkan komitmen menjaga ekosistem dan pelestarian lingkungan melalui Program Hijaunesia Power. Program ini merupakan kegiatan kampanye untuk bersemangat menghijaukan negeri oleh insan Indonesia Power. Hal ini didasari karena kegiatan operasi Perusahaan memiliki potensi menimbulkan dampak bagi keberlangsungan ekosistem dan habitat sekitar unit bisnis Perusahaan. Oleh karena itu, Indonesia Power memiliki tanggung jawab terhadap pelestarian keanekaragaman hayati khususnya di sekitar wilayah operasi Perusahaan sekaligus sebagai bentuk komitmen Perusahaan terhadap pencapaian Tujuan Pembangunan Berkelanjutan.
Hingga tahun 2019, terdapat tiga unit bisnis Indonesia Power yang berdekatan dengan kawasan lindung atau kawasan dengan nilai keanekaragaman hayati tinggi, yaitu PLTP Gunung Salak – Kamojang POMU, PLTG Gilimanuk - Bali PGU dan Labuan OMU dengan rincian sebagai berikut:
Since 3 October 2014, Indonesia Power has committed to protecting the ecosystem and preserving the environment through the Hijaunesia Power Program. This program is a campaign activity to passionately make the country greener by the Indonesia Power’s personnel. This is based on the fact that the Company’s operations have the potential to impact on the sustainability of the ecosystem and habitat around the Company’s business units. Therefore, Indonesia Power has responsibility for biodiversity conservation, especially around the Company’s operational areas. This is also a form of the Company’s commitment to the achievement of the Sustainable Development Goals.
Until 2019, there are three Indonesia Power business units that are adjacent to protected areas or high biodiversity areas, Gunung Salak GPP - Kamojang POMU, Gilimanuk GTPP - Bali PGU, and Labuan OMU, with the following details:
Program Hijaunesia PowerHijaunesia Power program
Unit BisnisBusiness Unit
Jenis OperasiType of
Operation
Lokasi GeografisGeographical
Location
Ukuran/Luas LokasiLocation Size/Area
Kawasan Lindung atau Kawasan dengan Nilai Keanekaragaman Hayati Tinggi yang Berdekatan
Nearby Protected Areas or High Biodiversity Areas
PLTP Gunung Salak – Kamojang POMUGunung Salak GPP - Kamojang POMU
PLTPGeothermal
Power Plant (GPP)
Gugusan Gunung Guntur, Kabupaten Bandung, Jawa BaratGuntusan Gunung Guntur, Bandung Regency, West Java
Seluas 13,725 ha wilayah operasi Perusahaan seluruhnya berada di dalam kawasan Taman Nasional Gunung Halimun SalakCovering an area of 13,725 ha, the Company’s operational area is entirely within the Gunung Halimun Salak National Park
Taman Nasional Gunung Halimun Salak, yaitu kawasan konservasi dengan luas 113.357 hektar, memiliki nilai keanekaragaman hayati yaitu >700 jenis tumbuhan berbunga dan fauna yang dilindungi seperti Elang Jawa, Macan Tutul Jawa, Owa Jawa, Surili dan lain-lain.Gunung Halimun Salak National Park is a conservation area of 113,357 hectares, with a biodiversity value of more than 700 species protected flora and fauna, such as Javan Hawk-eagle, Javan Leopard, Javan Gibbon, Surili, etc.
PLTG Gilimanuk - Bali PGUGilimanuk GTPP - Bali PGU
PLTGGas
Turbine Power Plant
(GTPP)
Pesanggaran, Denpasar, BaliPesanggaran, Denpasar, Bali
Seluas 71.970 m2 wilayah operasi Perusahaan dan tidak ada wilayah yang berdekatan dengan Taman Nasional Bali Barat, namun Indonesia Power melakukan program konservasi di wilayah tersebutCovering an area of 71,970 m2. The Company’s operational area is not in the vicinity of West Bali National Park. However, Indonesia Power carries out conservation program in the area
Taman Nasional Bali Barat dengan luas 77,000 hektar, memiliki nilai keanekaragaman hayati 160 spesies hewan dan tumbuhan dilindungi seperti Jalak Bali, Banteng, Rusa, Lutung, Kalong dan aneka burung.West Bali National Park has an area of 77,000 hectares, a biodiversity value of 160 protected species of animals and plants, such as the Bali Myna, Bull, Deer, Lutung, Bats, and various birds.
Unit Bisnis Indonesia Power yang Berdekatan dengan Kawasan Lindung atau Kawasan dengan Nilai Keanekaragaman Hayati Tinggi [GRI 304-1]Indonesia Power Business Unit Adjacent to Protected Areas or High Biodiversity Areas [GRI 304-1]
186 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Program Pelestarian LingkunganEnvironmental Conservation Program
Unit BisnisBusiness Unit
Jenis OperasiType of
Operation
Lokasi GeografisGeographical
Location
Ukuran/Luas LokasiLocation Size/Area
Kawasan Lindung atau Kawasan dengan Nilai Keanekaragaman Hayati Tinggi yang Berdekatan
Nearby Protected Areas or High Biodiversity Areas
Labuan OMULabuan OMU
PLTUSPP
Desa Sukamaju, Kecamatan Labuan, Kabupaten Pandeglang, Provinsi BantenSukamaju Village, Labuan Sub-District, Pandeglang Regency, Banten Province
Seluas 66,4597 ha wilayah operasi Perusahaan dan tidak ada wilayah yang berdekatan dengan Taman Nasional Ujung Kulon, namun Indonesia Power melakukan program konservasi di wilayah tersebutCovering an area of 66.4597 ha. The Company’s operational area is not in the vicinity of Ujung Kulon National Park. However, Indonesia Power carries out conservation program in the area
Taman Nasional Ujung Kulon, yaitu salah satu Warisan Dunia yang dilindungi oleh UNESCO dengan luas sekitar 122.956 hektar, memiliki nilai keanekaragaman hayati yaitu Badak Jawa, Owa Jawa, Surili, Anjing hutan mangrove, dan berbagai tumbuhan langka.Ujung Kulon National Park, which is one of the World Heritage protected by UNESCO, has an area of approximately 122,956 hectares. The Park has biodiversity values, i.e. Javan Rhinocheros, Javan Gibbons, Surili, Mangrove Forest Dogs, and various rare plants.
Dengan adanya satu unit bisnis yang berdekatan dengan kawasan lindung atau kawasan dengan nilai keanekaragaman hayati tinggi yaitu PLTP Gunung Salak – Kamojang POMU yang berada di dalam kawasan Taman Nasional Gunung Halimun Salak, Indonesia Power memiliki komitmen kuat untuk melakukan perlindungan keanekaragaman hayati dengan melakukan kegiatan pelestarian secara langsung di habitat spesies-spesies yang dilindungi (insitu) maupun di luar habitat (ex-situ).
Untuk pelaksanaan pengembangan keanekaragaman hayati pada unit bisnis yang terletak di kawasan yang dilindungi, Indonesia Power bekerjasama dengan Balai Konservasi dan Taman Nasional, sedangkan untuk unit bisnis yang terletak di kawasan yang direstorasi, Indonesia Power bekerjasama dengan Dinas Lingkungan Hidup atau instansi setempat. Indonesia Power telah mengantongi kerjasama dari pihak terkait dengan adanya Surat Perjanjian Kerjasama Nomor PKS.836/T.14/TU/KUM/7/2019-No.01/SKB/060/UPJPKMJ/2019 antara Balai Taman Nasional Gunung Halimun Salak dan PT Indonesia Power Kamojang POMU tentang Penguatan Fungsi Taman Nasional Gunung Halimun Salak dan Nomor PKS.06/T.12/TU/K3/05/2018-No.01.PJ/060/UJPBLB/2018 antara Balai Taman Nasional Ujung Kulon dengan PT Indonesia Power Banten 2 Labuan OMU tentang Konservasi KEHATI dan Ekosistem serta Pemberdayaan Masyarakat di Taman Nasional Ujung Kulon. Metodologi dan penetapan luasan wilayah konservasi, jenis flora dan fauna yang dikembangkan, dikoordinasikan dan ditetapkan bersama dengan pihak terkait yang telah dilakukan kerjasama dalam konservasi KEHATI. Pada tahun 2019, total luas area konservasi yang dilakukan Indonesia Power mencapai 13,725 ha. [GRI 304-1, 304-3]
Indonesia Power telah melakukan berbagai program pelestarian keanekaragaman hayati sebagai berikut:
One of Indonesia Power’s business units is nearby the protected areas or high biodiversity areas. Gunung Salak GPP - Kamojang POMU is located within the Gunung Halimun Salak National Park. Thus, Indonesia Power has a strong commitment to protecting biodiversity by carrying out conservation activities in a sustainable manner through direct conservation (in the habitat of the protected species/insitu), and outside the habitat (ex-situ).
For the biodiversity development implementation in business units located in protected areas, Indonesia Power collaborates with Conservation Centers and National Parks. For business units located in restored areas, Indonesia Power collaborates with the Environmental Office or the local agencies. Indonesia Power has cooperated with related parties under the Cooperation Agreement No. PKS.836/T.14/TU/KUM/7/2019-No.01/SKB/060/UPJPKMJ/2019 between the Gunung Halimun Salak National Park and PT Indonesia Power Kamojang POMU on Strengthening the Function of Gunung Halimun Salak National Park, and PKS.06/T.12/TU/K3/05/2018-No.01.PJ/060/UJPBLB/2018 between Ujung Kulon National Park and PT Indonesia Power Banten 2 Labuan OMU on KEHATI and Ecosystem Conservation and Community Empowerment in Ujung Kulon National Park. The methodology and scope of the conservation areas and types of flora and fauna are developed, coordinated, and set together with related parties in cooperation under KEHATI conservation. In 2019, Indonesia Power’s total area of conservation reached 13,725 ha.[GRI 304-1, 304-3]
Indonesia Power has carried out various biodiversity conservation programs as follows:
187 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
entUnit
Lokasi Perlindungan
Location of the Shelter
[GRI 304-3]
Flora dan Fauna yang dilindungi Protected Flora
and Fauna[GRI 304-4]
Nama IlmiahScientific Name
Status IUCN Red List
Red List IUCN Status
[GRI 304-4]
Upaya PelestarianConservation Effort
PLTP GunungSalak – Kamojang POMUGunung Salak GPP - Kamojang POMU
Taman Nasional Gunung Halimun SalakMount Halimun Salak National Park
Elang JawaJavan hawk-eagle
Nisaetus Bartelsi Genting Endangered
2011 Adopsi empat elang Adopted four hawk-eagles
2012 Pelepasliaran dan program perlindungan bersama masyarakat Release and protection program with the community
2013 program perlindungan sarang (nest protector)nest protector program
2014 Pemantauan spesies kunciMonitoring key species
2015 Monitoring untuk mengetahui data, informasi Elang JawaMonitoring to find information on Javan Hawk
2016 Monitoring lima ekor Elang JawaMonitoring five Javan Hawk-eagles
2017 Monitoring enam ekor Elang Jawa dan pelepasliaran tiga ekor Elang Jawa Monitoring six Javan Hawk-eagles and the release of three Javan Hawk-eagles
2018 Pelepasliaran satu ekor Elang JawaRelease of one Javan Hawk-eagle
2019 Monitoring dan evaluasi konservasiConservation monitoring and evaluation
Pohon Endemik dan dilindungiEndemic and protected tree
- - 2017 Penanaman dan pemeliharaan pohon (Jirak 2700 batang, Pongkongan 450 batang, Kisireum 900 batang, Huru 2.100 batang, Puspa 4.100 batang dan Kihujan 750 batang)Tree planting and maintenance (Jirak: 2700 trunks, Pongkongan: 450 trunks, Kisireum: 900 trunks, Huru: 2,100 trunks, Puspa: 4,100 trunks, and Kihujan: 750 trunks)
2018 Melakukan penanaman dengan total penanaman 7.988 pohonPlanted 7,988 trees
2019 Monitoring dan evaluasi program penanaman pohonMonitoring and evaluating tree planting programs
PLTG Gilimanuk - Bali PGUGilimanuk GTPP - Bali PGU
Kawasan Taman Nasional Bali BaratWest Bali National Park
Jalak BaliBali Myna
Leucopsar Rothschildi
KritisCriticallyCITES Appendix-I
2012 Perbaikan sarang penangkaran yang dibangun sejak 2006Reparation of breeding nest built since 2006
2013 Konservasi spesies 32 ekorConservation of 32 species
2014 Penambahan konservasi menjadi 38 ekorAdding conservation into 38 animals
2015 Pelepasliaran dan penambahan konservasi menjadi 48 ekorRelease and adding the conservation into 48 animals
Pelestarian Keanekaragaman Hayati [GRI 304-3, 304-4]Biodiversity Conservation [GRI 304-3, 304-4]
188 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Program Pelestarian LingkunganEnvironmental Conservation Program
Unit
Lokasi Perlindungan
Location of the Shelter
[GRI 304-3]
Flora dan Fauna yang dilindungi Protected Flora
and Fauna[GRI 304-4]
Nama IlmiahScientific Name
Status IUCN Red List
Red List IUCN Status
[GRI 304-4]
Upaya PelestarianConservation Effort
PLTG Gilimanuk - Bali PGUGilimanuk GTPP - Bali PGU
Kawasan Taman Nasional Bali BaratWest Bali National Park
Jalak BaliBali Myna
Leucopsar Rothschildi
KritisCriticallyCITES Appendix-I
2016 Penambahan konservasi menjadi 56 ekorAdding conservation into 56 animals
2017 Penambahan konservasi menjadi 104 ekorAdding conservation into 104 animals
2018 Penambahan konservasi menjadi 195 ekorAdding conservation into 195 animals
2019 Penambahan konservasi menjadi 88 ekorAdding conservation into 88 animals
LingkunganPembangkitEnvironmentPower Plant
Penyu Lekang Olive Ridley Sea Turtle
Lepidochelys Oliyacea
TerancamPunahCritically endangered
2015 -2017
Penangkaran dan pelepasliaran 400 ekor TukikCaptive breeding and release of 400 Hatchlings
2018 Penangkaran dan pelepasliaran 1.135 ekor TukikCaptive breeding and release of 1,135 Hatchlings
2019 Penangkaran 6.499 ekor tukik6,499 hatchlings breeding
PLTG Pesanggaran - Bali PGUPesanggaran GTPP - Bali PGU
Lingkungan UnitUnit Environment
Mangrove dan Terumbu KarangMangroves and Coral Reefs
Rhizophora and Coral Reef
TerancamPunahCritically endangered
2014 -2016
Konservasi Mangrove dan Terumbu KarangConservation of Mangrove and coral reefs
2017 Penanaman 685 pohon MangrovePlanting 685 Mangrove trees
2018 Penanaman 830 pohon MangrovePlanting 830 Mangrove trees
2019 Penanaman 830 pohon MangrovePlanting 830 Mangrove trees
Taman WisataLembu Putih,GianyarTourism ParkWhite Ox,Gianyar
Sapi Putih Taro White Taro Ox
Bos Sondaicus DilindungiProtected
2017 Konservasi 49 Ekor Sapi Putih TaroConservation of 49 White Taro Ox
2018 Konservasi 51 Ekor Sapi Putih TaroConservation of 51 White Taro Ox
2019 Konservasi 52 Ekor Sapi Putih TaroConservation of 52 White Taro Ox
PLTGPemaronGas Turbine Power Plant (GTPP)Pemaron
Lingkungan UnitUnit Environment
Cemara Geseng Cemara Geseng
Casuaria UngguniawaMiq
- 2017 Penanaman 22.242 Pohon Cemara GesengPlanting 22,242 Pine Trees
2018 Penanaman 150 Pohon Cemara GesengPlanting 150 Pine Trees
2019 Penanaman 200 Pohon Cemara GesengPlanting 200 Pine Trees
TukikHatchlings
Chelonioidea - 2015 Konservasi 29 EkorConservation of 29 hatchlings
2016 Konservasi 1.017 Ekor Conservation of 1,017 hatchlings
2017 Konservasi 2.505 Ekor Conservation of 2,505 hatchlings
2018 Konservasi 1.605 Ekor Conservation of 1,605 hatchlings
2019 Konservasi 2.015 Ekor onservation of 2,015 hatchlings
189 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Unit
Lokasi Perlindungan
Location of the Shelter
[GRI 304-3]
Flora dan Fauna yang dilindungi Protected Flora
and Fauna[GRI 304-4]
Nama IlmiahScientific Name
Status IUCN Red List
Red List IUCN Status
[GRI 304-4]
Upaya PelestarianConservation Effort
Grati POMUGrati POMU
Lingkungan UnitUnit Environment
Rusa TimorJavan Rusa
Rusa Timorensis RentanVulnerable
2012 Melakukan Penangkaran Conserving
2013 -2014
Melakukan pengembangbiakan Conducted breeding
2015 Berhasil pengembangbiakan Successful breeding
2016 Penambahan satu ekor bayi rusa timor. Total konservasi menjadi tujuh ekor. Adding one Javan Rusa baby. Total conserved is 7 animals.
2017 Penangkaran tujuh ekor Rusa Timor Breeding seven Javan Rusa
2018 Penangkaran tujuh ekor Rusa Timor Breeding seven Javan Rusa
2019 Penangkaran delapan ekor Rusa Timor Breeding eight Javan Rusa
Mangrove Rhizopora& AvicenniaMangrove Rhizopora& Avicennia
Rhizopora - 2014 -2017
Konservasi Mangrove 1.725 pohonConserving 1,725 mangrove trees
2018 Konservasi Mangrove 566 pohonConserving 566 mangrove trees
2015 - 2019
Konservasi Mangrove 5.400 pohon Conserving 5,400 mangrove trees
Semarang PGUSemarang PGU
Lingkungan UnitUnit Environment
Mangrove Rhizopora - 2015 -2017
Konservasi MangroveMangrove Conservation
2018 Konservasi dan Penanaman Mangrove 500 pohonMangrove Conservation and Planting of 500 trees
2019 Konservasi dan penanaman dengan total 6.000 pohonConservation and planting a total of 6,000 trees
Tanaman Langka(Cemara Udang, Anggrek Darat, Melati, lamtana Bunga Kuning, Palem Kipas dan Ponik, Anggrek Kirai, palem Phoenik, Asam, Palem Putri)Rare Plants(Beach Sheoak, Land Orchid, Jasmine, Lantana Camara, Livistona Saribus and Pygmy Date Palm, Kirai Orchid, Cuban Royal Palm, Tamarind, Putri Palm)
- - 2017 Konservasi dan penanaman dengan total 760 pohonConservation and planting a total of 760 trees
2018 Konservasi dan penanaman dengan total 350 pohonConservation and planting a total of 350 trees
2019 Konservasi dan penanaman dengantotal 21 pohonConservation and planting a total of 21 trees
190 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Unit
Lokasi Perlindungan
Location of the Shelter
[GRI 304-3]
Flora dan Fauna yang dilindungi Protected Flora
and Fauna[GRI 304-4]
Nama IlmiahScientific Name
Status IUCN Red List
Red List IUCN Status
[GRI 304-4]
Upaya PelestarianConservation Effort
Labuan OMULabuan OMU
Taman Nasional Ujung KulonUjung Kulon National Park
Badak JawaJavan Rhinoceros
Rhinoceros sondaicus
TerancamPunahCritically endangered
2015 -2016
Konservasi 63 Badak JawaConservation of 63 Javan Rhinoceros
2017 Konservasi 67 Badak JawaConservation of 67 Javan Rhinoceros
2018 Konservasi 67 Badak JawaConservation of 67 Javan Rhinoceros
2019 Konservasi 68 Badak JawaConservation of 68 Javan Rhinoceros
Lingkungan Unit (Taman Kehati)Unit Environment(Kehati Park)
Pohon KokoleceranKokoleceran Tree
Vatica bantamensis
- 2017 10 Pohon Kokoleceran, total 17.157 jenis tanaman di taman kehati Labuan OMU10 Kokoleceran trees, a total of 17,157 species of plants in the Labuan OMU Kehati Park
2018 7 Pohon Kokoleceran7 Kokoleceran Trees
2019 7 Pohon Kokoleceran7 Kokoleceran Trees
Banten 1 Suralaya OMUBanten 1 Suralaya OMU
Lingkungan Unit (Kebun Raya Mini)Unit Environment(Mini Botanical Garden)
Tanaman Langka Rare Plants
- - 2017 Konservasi 24 jenis tumbuhan langka, diantaranya Borahol, Daro daroh, Eboni, Empapak lawai, Kamper, Kayu rasak dan lain-lainConservation of 24 rare plant species, including Kepel, Daro daroh, Ebony, Empapak lawai, Camphor, Rasak wood, etc.
2018 Program revitalisasi dan pembangunan hutan kota Cilegon dengan 1.820 Batang Pohon Revitalization and development of cilegon city forest with 1,820 Tree Trunks
2019 Program revitalisasi dan pembangunan hutan kota Cilegon dengan 1.833 Batang PohonRevitalization and development of cilegon city forest with 1,833 Tree Trunks
Program Pelestarian LingkunganEnvironmental Conservation Program
Hingga tahun 2019, Indonesia Power telah melakukan konservasi 10 ekor Elang Jawa, dimana jumlah tersebut sebanyak 1,67% dari total populasi yang ada di Indonesia, konservasi 620 ekor Jalak Bali (100% dari total populasi), konservasi 6.499 ekor Penyu Lekang (100% dari total populasi), konservasi 52 ekor Sapi Putih Taro (100% dari total populasi), konservasi 8.716 ekor Tukik (100% dari total populasi), konservasi 8 ekor Rusa Timor (0,89% dari total populasi) dan konservasi 68 ekor Badak Jawa (94,44% dari total populasi).
As of 2019, Indonesia Power has conserved 10 Javan Hawk-eagles, which is 1.67% of the total population in Indonesia, 620 Bali Myna (100% of the total population), 6,499 Olive Ridley Sea Turtle (100 % of the total population), 52 White Taro Ox (100% of the total population), 8,716 Hatchlings (100% of the total population), 8 Javan Rusa (0.89% of the total population), and 68 Javan Rhinoceros (94.44% of the total population).
191 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Keberhasilan program konservasi keanekaragaman hayati dapat dilihat dari adanya peningkatan indeks keanekaragaman hayati. Untuk itu, Indonesia Power melakukan pengukuran secara periodik bekerjasama dengan lembaga atau laboratorium eksternal yang terakreditasi dengan metodologi pengukuran indeks keanekaragaman hayati menyesuaikan dengan pihak laboratorium eksternal yang melakukan pengukuran. [GRI 304-2, 304-3]
The biodiversity conservation program’s success is reflected in the increase of the biodiversity index. Thus, Indonesia Power conducts periodic measurements in collaboration with external institutions or laboratories accredited with the biodiversity index measurement methodology, in accordance with the external laboratories that perform the measurements.[GRI 304-2, 304-3]
* Data diambil dari Laporan Unit Data is sourced from the Unit Report
No. Jenis Spesies yang dilindungiProtected Species
Jumlah Populasi Spesies Asli*
Total Population of Original Species*
Jumlah Spesies yang Indonesia Power Konservasi
Number of Species Conserved by Indonesia Power
%
1 Elang Jawa Javan hawk-eagle Nisaetus Bartelsi 600 Ekor Ekor 10 Ekor Ekor 1,67%
2 Jalak Bali Bali Myna Leucopsar Rothschildi 620 Ekor Ekor 620 Ekor Ekor 100%
3 Penyu Lekang Olive Ridley Sea TurtleLepidochelys Oliyacea 6.499 Ekor Ekor 6.499 Ekor Ekor 100%
4 Sapi Putih Taro White Taro Ox Bos Sondaicus 52 Ekor Ekor 52 Ekor Ekor 100%
5 Tukik Hatchlings Chelonioidea 8.716 Ekor Ekor 8.716 Ekor Ekor 100%
6 Rusa Timor Javan Rusa Rusa Timorensis 900 Ekor Ekor 8 Ekor Ekor 0,89%
7 Badak Jawa Javan Rhinoceros Rhinoceros sondaicus 72 Ekor Ekor 68 Ekor Ekor 94,44%
Perbandingan Jumlah Populasi Spesies yang di Konservasi dengan Jumlah Populasi Spesies Asli [GRI 304-4, EU13]Number of Population of Conserved Species with Total Populationof Original Species [GRI 304-4, EU13]
Komitmen Indonesia Power dalam menjaga ekosistem dan pelestarian lingkungan juga diimplementasikan melalui Program KaWan Hijaunesia Power. Program ini kegiatan sinergi Indonesia Power dengan Kementerian Lingkungan Hidup dan Kehutanan serta Gerakan Pramuka yang mulai dicanangkan sejak tahun 2016 melalui Keputusan Direksi Nomor 211.K/010/IP/2016 tanggal 10 Oktober 2016 tentang Komitmen Menjaga Ekosistem dan Pelestarian Lingkungan. Kegiatan Program KaWan Hijaunesia Power diantaranya yaitu melakukan penanaman pohon endemik di lingkungan area pembangkit dan di daerah pengembangan proyek baru yang masuk ke dalam perencanaan Perusahaan, melakukan konservasi keanekaragaman hayati lainnya serta bina mitra dan publikasi.
Indonesia Power’s commitment to protecting ecosystems and preserving the environment is implemented through the KaWan Hijaunesia Power Program. This program is a synergy between Indonesia Power, the Ministry of Environment and Forestry, and the Scout Movement that was launched since 2016 through the Board of Directors’ Decree No. 211.K/010/IP/2016 dated 10 October 2016 on the Commitment to Protecting Ecosystems and Conserving Environment. KaWan Hijaunesia Power’s activities include planting endemic trees in the power plant area and areas of the new projects included in the Company’s planning, conservation of another biodiversity, and partner development and publications.
Program Kawan Hijaunesia PowerKawan Hijaunesia Power Program
192 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Selama tahun 2019, Indonesia Power melaksanakan Program KaWan Hijaunesia Power dengan melakukan penanaman pohon sebanyak 40.604 pohon. Berdasarkan Canada’s National Environmental Agency, rata-rata produksi oksigen per-pohon adalah 260 pound atau 130 kg/tahun, sehingga dengan penanaman pohon yang dilakukan Perusahaan sebanyak 40.604 pohon, Indonesia Power berhasil menghasilkan Oksigen (O2) sebesar 5.278.520 kg/tahun.
During 2019, Indonesia Power implemented the KaWan Hijaunesia Power Program by planting 40,604 trees. Based on Canada’s National Environmental Agency, the average oxygen production per tree is 260 pounds or 130 kg/year. Thus, by planting 40,604 trees, Indonesia Power succeeded in producing Oxygen (O2) of 5,278,520 kg/year.
Program Pelestarian LingkunganEnvironmental Conservation Program
Unit 2017 2018 2019
Suralaya PGU Suralaya PGU 1.948 3.824 1948
Priok POMU Priok POMU 2.017 546 463
Saguling POMU Saguling POMU 5.008 1.250 5000
Kamojang POMU Kamojang POMU 1.524 7.841 1.614
Kamojang POMU - Unit Gunung Salak Kamojang POMU - Gunung Salak Unit - 147 -
Mrica PGU Mrica PGU 5.265 21.230 4.300
Semarang PGU - Unit Tambak Lorok Semarang PGU - Tambak Lorok Unit 760 850 461
Semarang PGU - Unit Sunyaragi Semarang PGU - Sunyaragi Unit - - -
Grati POMU Grati POMU 9.482 106 1.003
Bali PGU - Unit Pesanggaran Bali PGU - Pesanggaran Unit 4.275 1.201 2.400
Bali PGU - Unit Gilimanuk Bali PGU - Gilimanuk Unit 1.500 1.100 350
Bali PGU - Unit Pemaron Bali PGU - Pemaron Unit 750 275 1.413
PLTU Banten 1 Suralaya OMU SPP Banten 1 Suralaya OMU 132 15 50
PLTU Banten 2 Labuan OMU SPP Banten 2 Labuan OMU 1.061 158 1.726
PLTU Banten 3 Lontar OMU SPP Banten 3 Lontar OMU 5.517 5.614 2.909PLTU Jawa Barat 2 Pelabuhan Ratu OMU SPP West Java 2 Pelabuhan Ratu OMU 839 140 995
PLTU Jawa Tengah 2 Adipala OMU SPP Central Java 2 Adipala OMU 4.848 746 5.809
PLTGU Cilegon OMU CCPP Cilegon OMU 850 2.030 2.037
PLTU Pangkalan Susu OMU SPP Pangkalan Susu OMU 6.642 - 7.168
PLTU Barru OMU SPP Barru OMU 1.450 - 445
PLTU Jeranjang OMU SPP Jeranjang OMU 2.590 - 407
PLTU Sanggau OMU SPP Sanggau OMU - - 105
PLTU Holtecamp OMU SPP Haultecamp OMU - - 1
Jumlah Penanaman Pohon Tree Planted 56.458 47.073 40.604
Jumlah Penanaman Pohon Indonesia PowerIndonesia Power Tree Planting
193 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Sejuta Mangrove, Lestarikan Kawasan Pesisir IndonesiaOne Million Mangroves to Preserve Indonesian Coastal Areas
Dalam kegiatan penanaman 5.000 batang mangrove yang diinisiasi oleh Organisasi Aksi Solidaritas Kabinet Kerja (OASE) pada 11 Maret 2019, Indonesia Power turut mendukung kegiatan tersebut. Kegiatan penanaman mangrove ini sejalan dengan misi Indonesia Power, yaitu menyelenggarakan bisnis pembangkitan tenaga listrik dan jasa terkait yang bersahabat dengan lingkungan.
Pada kesempatan tersebut, Direktur Utama Indonesia Power mengatakan bahwa keberadaan hutan mangrove sangat penting untuk mengantisipasi dan mengurangi abrasi dan tsunami yang terjadi di pesisir pantai. Hal ini tentunya akan memberikan manfaat pula bagi Indonesia Power yang sebagian besar unit pembangkitnya berlokasi di wilayah pesisir.
Indonesia Power mengucapkan terima kasih yang sebesar-besarnya atas dukungan dari Ibu Iriana Joko Widodo pada kegiatan ini. Selain Indonesia Power, kegiatan ini juga didukung oleh Kementerian Lingkungan Hidup dan Kehutanan yang dihadiri pula oleh Menteri Lingkungan Hidup dan Kehutanan, Siti Nurbaya. Dukungan pun datang dari Pemda, TNI dan berbagai pihak terkait lainnya.
Kegiatan penanaman mangrove ini dilaksanakan serentak di sembilan provinsi lainnya di Indonesia. Tercatat, sebanyak sejuta batang tanaman mangrove ditanam melalui kegiatan ini. Indonesia Power sendiri berpartisipasi sebanyak 1.000 batang mangrove.
On 11 March 2019, Indonesia Power supported the planting of 5,000 mangrove stems which were initiated by the Working Cabinet of Solidarity Organization (OASE). This mangrove planting activity is in line with Indonesia Power’s mission, providing a power generation business and related services that are environmentally-friendly.
On that occasion, the Managing Director of Indonesia Power said that the existence of mangrove forests is very important to anticipate and reduce abrasion and tsunamis that occur on the coast. This will certainly benefit Indonesia Power, where most of the generating units are located in coastal areas.
Indonesia Power would like to express our special gratitude for the support of Mrs. Iriana Joko Widodo on this activity. In addition to Indonesia Power, this activity was also supported by the Ministry of Environment and Forestry, which was also attended by the Minister of Environment and Forestry, Siti Nurbaya. The Local Government, Indonesian National Army, and other relevant parties also supported the event.
The mangrove planting activities were carried out simultaneously in nine other provinces in Indonesia. The event recorded that one million mangroves were planted. Indonesia Power participated as many as 1,000 mangrove stems.
Kegiatan Penanaman Sejuta MangroveOne Million Mangroves Planting
194 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Program Eco-officeEco-Office Program
Program Eco-office atau kantor peduli lingkungan merupakan refleksi kebijakan Perusahaan dalam menerapkan Sistem Manajemen Lingkungan (SML) sebagai upaya menciptakan lingkungan kerja yang bersih dan nyaman. Eco-office melibatkan seluruh aktivitas individu yang berada di dalam lingkup aktivitas perkantoran. Kegiatan Eco-office yang dilakukan Indonesia Power tahun 2019 diantaranya yaitu pengelolaan sampah, penggunaan aplikasi untuk penghematan kertas, pemasangan eco-sign pada saklar lampu, keran air, lokasi strategis dan ruang publik lainnya di sekitar lingkungan sebagai bentuk dan ajakan kepedulian terhadap lingkungan.
Eco-office program or environmentally friendly office is a reflection of the Company’s policy in implementing the Environmental Management System (SML) as an effort to create a clean and comfortable work environment. Eco-office involves all personnel within the scope of office activities. Indonesia Power conducted eco-office activities in 2019 which include waste management, use of applications for saving paper, eco-signs installation on light switches, water taps, strategic locations, and other public spaces around the environment as a form and invitation to care for the environment.
Pengelolaan sampah yang terpilah sesuai dengan jenis sampahnya.Sorting waste management according to the type of waste.
Penggunaan aplikasi untuk penghematan kertas.Use ofapplication for saving paper.
Pemasangan eco-sign pada saklar lampu, keran air, lokasi strategis dan ruang publik lainnya di sekitar lingkungan sebagai bentuk dan ajakan kepedulian terhadap lingkungan.Eco-signs installation on light switches, water taps, strategic locations, and other public spaces around the environment as a form and invitation to care for the environment.
Implementasi Eco-office di Unit Pembangkit Indonesia PowerEco-office in the Indonesia Power Generating Units
195 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Pengembangan PembangkitEnergi Baru TerbarukanNew Renewable Energy Power Plant Development
Menurut Peraturan Menteri ESDM No 53 tahun 2018 Pasal 1 menyatakan bahwa sumber energi terbarukan adalah energi yang berasal/dihasilkan dari sumber daya energi yang berkelanjutan jika dikelola dengan baik, antara lain panas bumi, angin, bioenergi, sinar matahari, aliran dan terjunan air serta gerakan dan perbedaan suhu lapisan laut.
Pengembangan dan pemanfaatan EBT terus didorong, di samping untuk memenuhi kebutuhan tenaga listrik nasional 35.000 MW, juga dalam rangka menjaga kenaikan temperatur global tidak melebihi 2oC dan mengupayakan menjadi 1,5oC, dimana sesuai Perjanjian Paris (Paris Agreement), Indonesia telah menetapkan target penurunan emisi sebesar 29% pada 2030 secara mandiri atau business as usual, dan sebesar 41% dengan bantuan internasional.
Berdasarkan Rencana Umum Energi Nasional (RUEN) dan Keputusan Menteri Energi dan Sumber Daya Mineral Republik Indonesia Nomor 39K/20/MEM/2019 tentang Pengesahan Rencana Usaha Penyediaan Tenaga Listrik (RUPTL) PT PLN (Persero) Tahun 2019-2028, Pemerintah telah menetapkan target porsi bauran energi nasional dari sumber EBT sebesar 23% pada 2025 mendatang. Untuk itu, diperlukan upaya strategis dalam mengoptimalkan pemanfaatan EBT.
Dengan target porsi bauran energi nasional dari sumber EBT yang ditetapkan Pemerintah tersebut, mendorong sektor energi nasional untuk mengoptimalkan pemanfaatan EBT secara berkesinambungan, tak terkecuali Indonesia Power. Pada 10 Januari 2019, Indonesia Power telah mengukuhkan sebuah komitmen yang diejawantahkan dalam Indonesia Power Annual Cycle (IPAC). Komitmen ini mencakup lima eksekusi langkah strategis Perusahaan yang dilakukan di tahun 2019, salah satunya yaitu komitmen untuk mengeksekusi program Energi Baru Terbarukan (EBT).
Indonesia Power kian gencar meningkatkan kemampuan untuk mengeksekusi proyek-proyek EBT yang tersebar di berbagai daerah di Indonesia. Kemampuan yang terus ditingkatkan yakni melakukan Research & Development (R&D) yang kuat terkait potensi dan teknologi EBT dan melakukan penguatan kompetensi dan keahlian teknis SDM dan para expertise Indonesia Power menuju Human Capital Excellence. Aksi nyata ini merupakan bentuk eksekusi ekselen proyek EBT yang dilakukan Indonesia Power untuk senantiasa mencapai kinerja unggul sekaligus sebagai wujud komitmen Indonesia Power dalam mendorong tercapainya target 23% EBT dalam bauran energi primer di tahun 2025 mendatang, meningkatkan efisiensi biaya pokok produksi (BPP) listrik, menurunkan emisi gas rumah kaca yang dapat mendukung pencapaian tujuan pembangunan berkelanjutan dalam memastikan tersedianya akses energi yang berkelanjutan dan dapat diandalkan.
Pursuant to the Minister of EMR Regulation No. 53 of 2018 Article 1, renewable energy sources are energy derived/generated from sustainable energy resources if managed properly, including geothermal, wind, bioenergy, solar photovoltaic, water flow and movement, and sea-level temperature differences.
NRE development and utilization are encouraged. In addition to meeting the national electricity needs of 35,000 MW, NRE shall maintain the global temperatures not to increase more than 2oC, and strive to achieve 1.5oC. Pursuant to the Paris Agreement, Indonesia has set emission reduction targets by 29% in 2030 independently (business as usual), and by 41% with international assistance.
Based on the National Energy Masterplan (RUEN), and Decree of the Minister of Energy and Mineral Resources of the Republic of Indonesia No. 39K/20/MEM/2019 on the Ratification of the 2019-2018 Electricity Supply Business Plan (RUPTL) of PT PLN (Persero), the Government has set a target of the 23% of NRE in the national energy mix by 2025. Therefore, strategic efforts are needed to optimize the NRE utilization.
The target of the NRE in the national energy mix set by the Government, encourages the national energy sector to optimize the use of NRE on a sustainable basis, including Indonesia Power. On 10 January 2019, Indonesia Power confirmed a commitment embodied in the Indonesia Power Annual Cycle (IPAC). This commitment includes five of the Company’s strategic steps carried out in 2019, one of which is the commitment to executing the New Renewable Energy (NRE) program.
Indonesia Power is aggressively increasing its ability to execute NRE projects across various regions in Indonesia. Indonesia Power continues to improve by conducting Research & Development (R&D) related to the NRE potential and technology, and by strengthening the HR competence and technical expertise, and Indonesia Power’s expertise towards Human Capital Excellence. This action is an exemplary form of NRE project excellence by Indonesia Power to achieve excellent performance as well as a manifestation of Indonesia Power’s commitment to encouraging the achievement of the 23% NRE target in the primary energy mix by 2025, increasing the Electricity Generation Cost (BPP), reducing greenhouse gas emissions that can support the achievement of sustainable development goals in ensuring the availability of sustainable and reliable energy.
196 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pengembangan Pembangkit Energi Baru TerbarukanNew Renewable Energy Power Plant Development
Selama tahun 2019, Indonesia Power telah memproduksi energi listrik yang bersumber dari EBT sebesar 5.874,54 GWh atau 15,02% dari bauran energi Perusahaan, dengan komposisi terdiri dari 3.133,74 GWh atau 8,01% untuk tenaga air, 2.738,94 GWh atau 7,00% untuk panas bumi dan 1,86 GWh atau 0,01% untuk Biofame. Jumlah ini mengalami penurunan 4,54% dari tahun 2018 yaitu sebesar 6.154,01 GWh dikarenakan variasi musim yaitu pola normal ke kering pada tahun 2019 yang menyebabkan penurunan produksi PLTA dan bertambahnya pembangkit di Jawa sehingga PLTP dioptimalkan operasi sesuai kebutuhan sistem dengan memperhatikan batas Take or Pay (TOP).
Hingga akhir tahun 2019, Indonesia Power telah memiliki pembangkit dari sumber EBT yang terdiri dari Pembangkit Listrik Tenaga Air (PLTA), Pembangkit Listrik Tenaga Mini Hidro (PLTM) dan Pembangkit Listrik Tenaga Panas Bumi (PLTP) dengan rincian sebagai berikut:
During 2019, Indonesia Power generated electricity sourced from NRE of 5,874.54 GWh or 15.02% of the Company’s energy mix, with a composition of 3,133.74 GWh or 8.01% for hydropower, 2,738.94 GWh or 7.00% for geothermal, and 1.86 GWh or 0.01% for Biofame. This number decreased by 4.54% from 2018, which was 6,154.01 GWh due to seasonal variations, i.e. the normal to dry season in 2019, which caused a decline in the hydropower plant generation, and an increase in Java’s power plants to optimize GPP operations in line with the system requirements, taking into account the Take or Pay (TOP) limit.
Until the end of 2019, Indonesia Power has NRE Power Plants, which consist of Hydroelectric Power Plants (HPP), Mini Hydro Power Plants (MHPP), and Geothermal Power Plants (GPP), with the following details:
Bauran Energi Indonesia PowerIndonesia Power’s Energy Mix
Pembangkit Energi Baru Terbarukan yang Telah BeroperasiNew Renewable Energy Power Plants That Have Been Operating
Sumber EnergiEnergy Sources
Bauran Energi (GWh)Energy Mix (GWh)
2017 2018 2019
Energi Baru Terbarukan New Renewable Energy
Air Water 4.318,71 3.284,31 3.133,74
Panas Bumi Geothermal 2.781,27 2.869,27 2.738,94
Biofame Biofame - 0,43 1,86Jumlah Energi Baru TerbarukanTotal New Renewable Energy 7.099,98 6.154,01 5.874,54
Energi Fosil Fossil Energy
Gas Gas 11.113,01 10.255,83 8.565,18
Batubara Coal 23.894,44 24.776,14 24.506,85
BBM Oil Fuel 112,97 758,58 166,29
Jumlah Energi Fosil Total Fossil Energy 35.120,42 35.790,55 33.238,31
Total 42.220,40 41.944,56 39.112,86
Bauran Energi Indonesia PowerIndonesia Power’s Energy Mix
197 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
No. Jenis PembangkitType of Power Plant
LokasiLocation
Kapasitas Capacity
1 Pembangkit Listrik Tenaga Air (PLTA)Hydro Power Plant (HPP)
PLTA Panglima Besar SoedirmanPanglima Besar Soedirman HPP
Kabupaten Banjarnegara, Jawa tengahBanjarnegara Regency, Central Java
180,90 MW
PLTA SagulingPLTA Saguling
Kabupaten Bandung Barat, Jawa BaratWest Bandung Regency, West Java
700,72 MW
PLTA RajamandalaRajamandala HPP
Kabupaten Bandung Barat, Jawa BaratWest Bandung Regency, West Java
47,00 MW
2 Pembangkit Listrik Tenaga Mini Hidro (PLTM)Mini Hydropower Plant (MHPP)
PLTM TapenTapen MHPP
Kabupaten Banjarnegara, Jawa TengahBanjarnegara Regency, Central Java
0,75 MW
PLTM SitekiSiteki MHPP
Kabupaten Banjarnegara, Jawa TengahBanjarnegara Regency, Central Java
1,20 MW
PLTM PlumbunganPlumbungan MHPP
Kabupaten Banjarnegara, Jawa TengahBanjarnegara Regency, Central Java
1,60 MW
PLTM LamburLambur MHPP
Kabupaten Pekalongan, Jawa TengahPekalongan Regency, Central Java
8,00 MW
PLTM HarjosariHarjosari MHPP
Kabupaten Pekalongan, Jawa TengahPekalongan Regency, Central Java
9,90 MW
3 Pembangkit Listrik Tenaga Panas Bumi (PLTP)Geothermal Power Plant (GPP)
PLTP KamojangKamojang GPP
Kabupaten Bandung, Jawa BaratBandung Regency, West Java
142,00 MW
PLTP DarajatDarajat GPP
Kabupaten Garut, Jawa BaratGarut Regency, West Java
55,00 MW
PLTP Gunung SalakGunung Salak GPP
Kabupaten Sukabumi, Jawa BaratSukabumi Regency, West Java
180,00 MW
O&M PLTP Ulumbu (Milik PLN)O&M GPP Ulumbu (PLN-owned)
Kabupaten Manggarai Tengah, Nusa Tenggara TimurManggarai Tengah Regency,East Nusa Tenggara
9,60 MW
Pembangkit Energi Baru Terbarukan yang Telah BeroperasiNew Renewable Energy Power Plants That Have Been Operating
198 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
PLTA RajamandalaWujud PengembanganEnergi Baru Terbarukan (EBT) di Tanah Air
Rajamandala HPPManifestation of the New and Renewable Energy (NRE) Development in the Country
PLTA Rajamandala merupakan pembangkit bertenaga hidro yang dikembangkan Indonesia Power melalui anak perusahaannya, yaitu PT Putra Indotenaga bersama dengan Kansai Electric Power Co. asal Jepang. Konsorsium kedua perusahaan listrik ini ditindaklanjuti dengan pembentukan perusahaan patungan, yaituPT Rajamandala Electric Power (REP). PT REP didirikan guna mengelola serta melaksanakan operasi dan pemeliharaan PLTA Rajamandala yang memiliki kapasitas sebesar 47 MW. PLTA Rajamandala berada di hilir PLTA Saguling. Pengoperasiannya memanfaatkan aliran air Sungai Citarum keluaran dari PLTA Saguling. Dengan kata lain, pembangkit ini merupakan jenis PLTA run-off-river yang tidak memerlukan waduk dan memanfaatkan debit air 168 m3 serta ketinggian jatuh air (gross head) 34 m.
Pembangkit ini merupakan unmanned power plant, dimana pengoperasiannya langsung dari control room di Saguling sehingga tidak ada lagi SDM di power plant. Petugas turun langsung ke lapangan saat daily patrol yang dilakukan sekali dalam sehari. Pemantauan kondisi pembangkit juga dilakukan melalui kamera pengawas (CCTV).
Sejak beroperasi secara komersial (Commercial Operation Date – COD) pada 12 Mei 2019, PLTA Rajamandala telah siap memasok listrik bagi sistem kelistrikan Jawa-Bali. Kehadiran PLTA Rajamandala memiliki arti penting, tak hanya bagi Indonesia Power, melainkan juga PT PLN (Persero), yakni mendukung pencapaian target Rencana Umum Energi Nasional (RUEN) dalam pengembangan pembangkit listrik nasional; sebagai terobosan atas persoalan pembiayaan pembangunan proyek pembangkit melalui skema International Project Financing; serta
Rajamandala Hydroelectric Power Plant is a hydro-powered generator developed by Indonesia Power through its subsidiary, PT Putra Indotenaga, in collaboration with Kansai Electric Power Co. from Japan. The consortium of these two electricity companies was followed up with the establishment of a joint venture, i.e. PT Rajamandala Electric Power (REP). PT REP was established to manage and carry out the operation and maintenance of the Rajamandala Hydropower Plant with a capacity of 47 MW. Rajamandala HPP is located in the downstream of the Saguling HPP. The operation utilizes the Citarum River water flow output from the Saguling HPP. In other words, this power plant is a run-of-river HPP that does not require reservoirs and utilizes 168 m3 of water flow and 34 m of water gross head.
Rajamandala HPP is an unmanned power plant, as the operation is directly from the control room in Saguling, there is no human in the power plant. Officers visit the field during daily patrol once a day. The plant is also monitored through surveillance cameras (CCTV).
Since operating commercially (Commercial Operation Date - COD) on 12 May 2019, Rajamandala HPP has been ready to supply electricity for the Java-Bali electricity system. The existence of Rajamandala HPP has an important meaning, not only for Indonesia Power, but also for PT PLN (Persero), i.e. to support the achievement of the target of the National Energy Masterplan (RUEN) in the development of national power plants; as a breakthrough in financing the construction of power plant projects using the International Project Financing scheme; and as
Pengembangan Pembangkit Energi Baru TerbarukanNew Renewable Energy Power Plant Development
199 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Peresmian PLTA RajamandalaInauguration of Rajamandala HPP
sebagai langkah menuju target bauran EBT sebesar 23% di tahun 2025 mendatang. Dengan beroperasinya PLTA Rajamandala, diharapkan dapat mendukung program pemerintah dalam pemerataan pasokan energi listrik ke seluruh wilayah Indonesia melalui peningkatan rasio elektrifikasi. Berdasarkan data Kementerian ESDM, hingga kuartal IV tahun 2019, rasio elektrifikasi telah mencapai 98,89%. Pada tahun 2019, target rasio elektrifikasi yang ditetapkan adalah sebesar 99,90%.
Dengan sepak terjang Indonesia Power yang selama ini yang memiliki komitmen kuat dalam pengembangan EBT, PLN sangat yakin Indonesia Power akan menjadi leading dalam pengembangan EBT di Tanah Air. Karenanya, PLTA Rajamandala dapat menjadi pilot project sekaligus best practices bagi program kelistrikan nasional.
a step towards the target of 23% NRE mix by 2025. The operation of the Rajamandala HPP, Hydroelectric Power Plant shall be able to support the government’s program in the distribution of electricity supply throughout Indonesia by increasing the electrification ratio. Based on data from the Ministry of Energy and Mineral Resources, up to Quarter IV 2019, the electrification ratio has reached 98.89%. In 2019, the target of the electrification ratio was 99.90%.
PLN is very confident that Indonesia Power will become the leading in developing NRE in the country, evidenced by Indonesia Power’s actions, with a strong commitment for NRE development. Therefore, Rajamandala HPP becomes the pilot project as well as best practices for the national electricity program.
200 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pengembangan Pembangkit Energi Baru TerbarukanNew Renewable Energy Power Plant Development
PLTA RajamandalaRajamandala HPP
Dikembangkan dan dikelola PT Rajamandala Electric Power (REP). REP adalah Special Purpose Company (SPC) yang dibentuk oleh Indonesia Power melalui anak perusahaannya, yaitu PT Putra Indotenaga dan Kansai Electric Power Co. Inc.
Pembangunan & Pembiayaan- Menelan biaya 158 juta dolar AS- Pinjaman dari Japan Bank
International Cooperation dan Mizuho Bank
- Skema pembiayaan International Project Financing
- Pembiayaan tanpa Jaminan Kelayakan Usaha (JKU) Pemerintah Indonesia
- Penjamin proyek: Multilateral Investment Guarantee Agency (MIGA)
Development & Financing:- Total cost of 158 million US dollars- Loans from Japan Bank
International Cooperation and Mizuho Bank
- International Project Financing scheme
- Financing without Business Feasibility Guarantee (JKU) from the Government of Indonesia
- Project guarantor: Multilateral Investment Guarantee Agency (MIGA)
Keunggulan- PLTA run-off-river sehingga
tidak memerlukan bendungan- Ramah lingkungan: tidak ada
limbah dan rendah polusi
Advantages:- A run-of-river HPP so there is
no need for dam- Environment-friendly: no waste
and low pollution
Komitmen Pemerintah- Capai target RUEN sebesar 23% EBT
pada tahun 2025- Mendorong pengembangan teknologi
untuk Energi Terbarukan di Indonesia
Government’s Commitment:- Achieve the RUEN target of 23% NRE
by 2025- Encourage the development of
technology for Renewable Energy in Indonesia
Sumber Energi Tak Terbatas- Memanfaatkan arus Sungai Citarum- Maksimum debit air 168 m/detik dari
ketinggian jatuh air (gross head) 34 meter
Infinite Energy Sources:- Utilizing the currents of the Citarum River- The maximum water discharge is 168 m/sec
from the gross head, i.e. 34 meters
Terhubung dengan Sistem Interkoneksi Jawa-Bali yang Dikelola PT PLN (Persero) P2B Jawa Bali- Output 181 GWH per tahun, setara produksi listrik yang
dihasilkan dari 70 juta liter BBM*)- Menambah pasokan listrik Jawa-Bali- Bersertifikat Laik Operasi (SLO) dari Ditjen
Ketenagalistrikan Kementerian ESDM
Connected To The Java-Bali Interconnected Network Managed By PT PLN (Persero) P2B Jawa Bali- Output of 181 GWH per year, equivalent to electricity
production generated from 70 million liters of oil fuel*)- Increasing Java-Bali electricity supply- Obtained Commissioning Certificate (SLO) from the
Directorate General of Electricity of the Ministry of Energy and Mineral Resources
Developed and managed by PT Rajamandala Electric Power (REP). REP is a Special Purpose Company (SPC) established by Indonesia Power through its subsidiaries, i.e. PT Putra Indotenaga and Kansai Electric Power Co. Inc.
201 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Pengembangan pembangkit EBT tak terlepas dari berbagai tantangan, antara lain terkait permasalahan perizinan, ketersediaan lahan, feed-in tariff, ketersediaan energi primer, teknologi, pendanaan dan kesiapan grid. Untuk menjawab tantangan tersebut, Indonesia Power telah menetapkan langkah strategi sebagai berikut:
NRE plant development is inseparable from various challenges, including licensing issues, land availability, feed-in tariffs, availability of primary energy, technology, funding, and grid readiness. Indonesia Power has established the following strategic steps to respond to these challenges:
Pengembangan Pembangkit Energi Baru Terbarukan Tahun 2019 [GRI 102-15, EU8]Development of New Renewable Energy Power Plants in 2019 [GRI 102-15, EU8]
Permasalahan Issues
TantanganChallenges
Strategi Strategy
Perizinan Permits
- Umumnya pembangkit EBT khususnya pembangkit yang menggunakan tenaga air atau angin berada di daerah dataran tinggi yang masih alami dan merupakan kawasan hutan lindung dan atau konservasi sehingga proses Izin Pinjam Pakai Kawasan Hutan membutuhkan jangka waktu yang cukup panjang; dan
- Izin lingkungan berdasarkan pada pembahasan dokumen ANDAL dan UKL/UPL yang mencakup kepada semua aspek lingkungan termasuk kawasan hutan.
- In general, NRE power plants, especially those that use water or wind power, are located in natural highland areas that are part of protected and/or conservation forest areas. Thus, the process of Borrow-to-Use Forestry Permit may require more time; and
- The environmental permit is based on the discussion of AMDAL and UKL/UPL documents that cover all aspects of the environment, including forest areas.
- Melakukan koordinasi dengan stakeholder terkait untuk pengurusan perizinan seperti Pemerintah Daerah setempat, Kementerian Lingkungan Hidup, PLN dan stakeholder lainnya terkait isu perizinan serta menyampaikan permohonan pinjam pakai kawasan hutan kepada Perhutani.
- Coordinating with relevant stakeholders for licensing arrangements, such as the local government, the Ministry of the Environment, PLN, and other stakeholders related to licensing issues, and submitting a request for a Borrow-to-Use Forestry Permit to Perhutani.
Ketersediaan LahanAvailability of Land
- Pembangkit EBT umumnya berada dekat dengan sumber energi primer yang potensial dan membutuhkan lokasi dengan area yang luas sehingga pembebasan lahan yang diperlukan untuk pembangkit EBT juga sangat luas termasuk penggunaan lahan kawasan hutan, lahan warga atau lahan industri.
- NRE generators are generally located nearby the potential primary energy sources and require a large area. Thus, the land acquisition for the NRE power plant is very extensive, including the use of forest area, community land, or industrial land.
- Melakukan pendekatan dan sosialisasi kepada masyarakat terkait pentingnya pengembangan atau penambahan pembangkit EBT untuk meningkatkan rasio elektrifikasi di daerah tersebut dan mengurangi dampak lingkungan;
- Melakukan tanggung jawab kepada masyarakat dan perusahaan dengan melakukan ganti rugi;
- Melakukan joint program pengembangan EBT kepada pemerintah, perusahaan atau industri lain; dan
- Melakukan pembebasan lahan untuk titik atau lokasi atau bidang yang belum dibebaskan.
- Approaching and disseminating information to the public in terms of the importance of developing or adding a new NRE plant to increase the electrification ratio in the area and reduce the environmental impact;
- Carrying out responsibility to the community by providing compensation;
- Conducting NRE development joint program with the Government, companies, or other industries; and
- Conducting land exemption for a point or location or area that has not been exempted.
Tantangan dan Strategi Pengembangan Energi Baru Terbarukan Tahun 2019Challenges and Strategies in Developing New Renewable Energy Plants in 2019
202 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Permasalahan Issues
TantanganChallenges
Strategi Strategy
Feed-In Tariff - Kebijakan feed-in tariff yang ada belum mendukung pengembangan EBT sepenuhnya dan belum dapat bersaing dengan tarif listrik yang dihasilkan dari energi fosil. Harga pembelian listrik untuk pembangkit EBT saat ini lebih rendah dari sistem feed in tariff yang diterapkan Kementerian ESDM.
- The existing feed-in tariff policy does not fully support the development of NRE and cannot compete with electricity tariffs generated from fossil energy. The purchase price of electricity generated from NRE Plant is lower than the feed-in tariff system implemented by the Ministry of EMR.
- Indonesia Power melalui PLN berkoordinasi dengan Direktorat Jenderal Ketenagalistrikan untuk mengkaji terkait feed in tarif pembangkit EBT.
- Indonesia Power, through PLN, is coordinating with the Directorate General of Electricity to conduct a study related to feed-in tariff for NRE Plant.
Ketersediaan Energi PrimerPrimary Energy Availability
- Ketersediaan sumber daya energi primer untuk pembangkit EBT umumnya bersifat intermittent (ketersediaannya terputus-putus) bergantung kepada kondisi iklim dan cuaca.
- The energy resources for NRE Plant have intermittent availability, depending on climate and weather.
- Diperlukan pengembangan design teknologi yang lebih efisien dalam memanfaatkan sumber energi untuk pembangkit-pembangkit EBT;
- Berperan aktif dalam menjaga dan melestarikan lingkungan untuk menjaga ketersediaan energi primer alam agar tidak rusak dan tetap optimal.
- It is necessary to develop more efficient technology designs in utilizing energy sources for NRE power plants;
- Play an active role in protecting and preserving the environment to maintain the availability of natural primary energy so the resources are not damaged and remain optimal.
TeknologiTechnology
- Teknologi EBT masih relatif mahal dan belum dapat bersaing dengan teknologi energi komersial. Sebagian besar teknologi yang sudah ada saat ini, baru dapat menghasilkan daya/kapasitas pembangkitan listrik dalam jumlah yang terbatas.
- NRE technology is still relatively expensive and is not yet able to compete against commercial energy technology. The majority of existing technologies, has limited power generation capacity.
- Melakukan Research & Development (R&D) yang kuat dan melakukan benchmarking kepada perusahaan atau industri terkait untuk melakukan pengembangan teknologi EBT.
- Conducting heavy Research & Development (R&D) and benchmarking companies or related industries to develop NRE technology.
Pendanaan Financing
- Pembangkit EBT membutuhkan investasi besar di awal, meskipun biaya operasional pembangkit EBT jauh lebih murah dan relatif berumur lebih panjang dibandingkan pembangkit berbahan baku energi fosil.
- Although operating NRE plants are significantly more cost effective and with a relatively longer lifetime compared to fossil fuel plants, initially, the NRE plants require large investment.
- Mencari mitra untuk pendanaan proyek dan bekerjasama dengan Pemerintah Daerah untuk melakukan kolaborasi penyediaan sumber energi EBT.
- Finding partners to fund the project and collaborating with the Local Government to cooperate in the provision of NRE energy sources.
Kesiapan Grid Grid Readiness
- Dalam menerima masuknya pembangkit EBT, terutama untuk Pembangkit Listrik Tenaga Surya (PLTS) dan Pembangkit Listrik Tenaga Biomassa (PLTB) yang bersifat intermittent, diperlukan kajian yang lebih komprehensif terkait konektifitasnya ke jaringan PLN; dan
- Pengembangan Photovoltaic (PV) terpusat untuk daerah terpencil yang relatif jauh dari grid yang ada. Kawasan ini bisa jadi daerah yang belum berkembang, daerah perbatasan dan pulau terluar.
- In accepting the entry of NRE plants, especially for Solar Power Plants (SoPP) and intermittent Biomass Power Plants (BmPP), a more comprehensive study in terms of the connectivity to the PLN network is necessary; and
- Centralized photovoltaic (PV) development for remote areas that are relatively far from the existing grid. This area could be an undeveloped area, a border area, and outermost islands.
- Melakukan koordinasi dengan PLN untuk mengembangkan sistem smart grid untuk meningkatkan penetrasi intermittent renewable energy dan meningkatkan keandalan sistem tenaga; dan
- Melakukan koordinasi dengan PLN untuk mengembangkan jaringan mikro atau micro grid (biasanya menggunakan PV) untuk daerah dimana jalur distribusi tidak akan dikembangkan dalam 2-3 tahun ke depan.
- Coordinating with PLN to develop smart grid systems to increase intermittent renewable energy penetration and improve power system reliability; and
- Coordinating with PLN to develop microgrids (usually using PV) for areas where the distribution channels will not be developed in the next 2-3 years.
Pengembangan Pembangkit Energi Baru TerbarukanNew Renewable Energy Power Plant Development
203 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Selain itu, Indonesia Power juga terus memperkuat lini renewable energy sebagai second curve of business Perusahaan dengan melakukan berbagai strategi inisiatif sebagai berikut:1. Menata ulang atas bisnis dan peran anak perusahaan
(alignment & parenting strategy) serta keselarasan dengan PLN Group melalui pendirian anak perusahaan yang bergerak di bidang EBT, bernama Indo Tenaga Hijau (ITH) yang diharapkan dapat menjadi ujung tombak proses pengembangan EBT;
2. Membentuk Section Power Generation Technology and Renewable Energy Research yang berperan penting dalam mempercepat dan memastikan keberlanjutan pengembangan EBT dengan melakukan riset, kajian teknologi baru, modifikasi pembangkit dan pengembangan teknologi EBT untuk memaksimalkan kinerja Perusahaan;
3. Memperkuat bidang riset EBT guna mendukung dan mempercepat proses alih teknologi dengan melakukan adopsi dan verifikasi terhadap teknologi yang sudah proven. Saat ini, Indonesia Power telah menyelesaikan tahap pre-feasibility study untuk floating solar PV yang akan segera diaplikasikan di lokasi waduk PLTA Saguling, PBS Mrica dan PLTS Apung Danau Singkarak;
4. Melakukan penjajakan dengan berkomunikasi, berkoordinasi maupun melihat ke lapangan secara langsung bersama dengan pihak-pihak yang memiliki kompetensi di bidang EBT, baik dari dalam maupun luar negeri;
5. Mengkaji potensi EBT yang ada dengan berpedoman pada Rencana Usaha Penyediaan Tenaga Listrik (RUPTL) 2019-2028;
6. Menyiapkan program kolaborasi dengan menggandeng perguruan tinggi dalam mengembangkan inovasi-inovasi di bidang EBT sehingga dapat menemukan sebuah teknologi yang lebih efisien dalam mengembangkan EBT; dan
7. Melakukan kerjasama pengembangan pembangkit EBT dengan pihak lain, dimana selama tahun 2019 Indonesia Power telah menandatangani perjanjian kerjasama dengan Waskita Karya dalam pengolahan instalasi pengolah sampah PLTSa Regional Sarbagita – Bali, Pemerintah Provinsi Babel dalam mengkaji, mengembangkan dan memanfaatkan sumber daya alam dan sumber energi terbarukan yang ada di Provinsi Bangka Belitung dan Pd Tebo Holding Company untuk membangun Pembangkit Listrik Biomass.
In addition, Indonesia Power strengthens its renewable energy line as the Company’s second curve of business by undertaking various initiative strategies as follows:1. Reconstructing the business and the role of subsidiaries
(alignment & parenting strategy), and aligning with the PLN Group by establishing a subsidiary engaged in the NRE sector, named Indo Tenaga Hijau (ITH), which shall be the frontliner of the NRE development process;
2. Establishing a Power Generation Technology and Renewable Energy Research Section that plays an important role in accelerating and ensuring the sustainability of NRE development by conducting research, researching new technologies, modifying plants, and developing NRE technology to maximize Company’s performance;
3. Strengthening NRE research field to support and accelerate the process of technology transfer by adopting and verifying proven technologies. To date, Indonesia Power has completed the pre-feasibility study phase for floating solar PV, which will be applied at the Saguling Hydroelectric Plant Reservoir, PBS Mrica, and Lake Singkarak Floating SoPP;
4. Communicating, coordinating, or conducting site visits with competent parties in the field of NRE, local and internationally;
5. Assessing the existing potential of NRE by referring to the 2019-2028 Electric Supply Business Plan (RUPTL);
6. Preparing a collaboration program by engaging universities in developing innovations in the field of NRE to find a more efficient technology for developing; and
7. Entering into collaboration of NRE plant development with other parties. In 2019, Indonesia Power has signed a cooperation agreement with Waskita Karya in processing the Sarbagita Regional WEPP waste processing installation in Bali; the Babel Provincial Government in assessing, developing, and utilizing natural resources and renewable energy sources at Bangka Belitung Province; and Pd Tebo Holding Company to build a Biomass Power Plant.
204 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Pengembangan Pembangkit Energi Baru TerbarukanNew Renewable Energy Power Plant Development
Indo Tenaga Hijau, Sebagai Special Purpose Company (SPC) Indonesia Power Dalam Mewujudkan Pengembangan Peluang Bisnis Grid Solar Photo Voltage (PV)Indo Tenaga Hijau, a Special Purpose Company (SPC) of Indonesia Power, to Realize the Development of Grid Solar Photo Voltage (PV) Business Opportunities
PT Indo Tenaga Hijau (PT ITH) sebelumnya bernama PT Tangkuban Parahu Geothermal Power (TPGP) didirikan tanggal 1 Oktober 2009 merupakan anak perusahaan Indonesia Power melalui PT Putra Indotenaga yang bergerak dalam bidang Pengusahaan Energi Baru dan/atau Terbarukan, Jasa Penunjang Ketenagalistrikan serta Perdagangan dan Jasa terkait Ketenagalistrikan berbasis Energi dan/atau Terbarukan.
Pengembangan usaha saat ini yang tengah dilakukan oleh PT Indo Tenaga Hijau adalah:
1. Pengembangan Wilayah Kerja Panas Bumi (WKP) Tangkuban Parahu
PT ITH berperan sebagai Tim Counterpart PLN dalam melakukan studi persiapan eksplorasi yang dilakukan dalam pengembangan WKP Tangkuban Parahu.
2. Pengembangan Usaha Pembangkit Energi Baru dan Terbarukana. PT ITH telah mendapatkan beberapa penugasan
dari Pemegang Saham atas pengembangan pembangkit EBT, antara lain pengembangan Pembangkit Listrik Tenaga Bayu dan Pembangkit Listrik Tenaga Surya; dan
b. Pada 10 Januari 2020 PT ITH telah berhasil menyelesaikan proyek PLTS Atap di lingkungan Pembangkit Indonesia Power yaitu Bali PGU yang telah diinisiasi sejak pertengahan 2019. Memanfaatkan modul PV dari Canadian Solar, teknologi ini menjadi salah satu jalan untuk menurunkan emisi yang dihasilkan oleh unit pembangkit. PLTS Atap ini terpasang di dua titik, masing-masing berdaya 136 Kilo Watt Peak (kWp) di PLTDG Pesanggaran dan 90 kWp di Sub-unit PLTG Pemaron, diperkirakan akan mampu memangkas emisi hingga 39T CO2. Selain itu, keberadaan PLTS Atap turut membantu memenuhi kebutuhan energi
PT Indo Tenaga Hijau (PT ITH), formerly known as PT Tangkuban Parahu Geothermal Power (TPGP), was established on 1 October 2009. PT Indonesia Tenaga Hijau is a subsidiary of Indonesia Power through PT Putra Indotenaga which is engaged in the New and/or Renewable Energy business, Electricity Support Services and Trading, and New and/or Renewable Electricity related Services.
The current business development performed by PT Indo Tenaga Hijau:
1. Development of Tangkuban Parahu Geothermal Working Area (WKP)
PT ITH acts as the PLN’s Counterpart Team in conducting an exploratory study to develop Tangkuban Parahu WKP.
2. New and Renewable Energy Power Plant Business Development a. PT ITH has received several assignments from the
Shareholders for the development of the NRE plant, including the development of the Wind Power Plant and the Solar Power Plant; and
b. On 10 January 2020, PT ITH successfully completed the Rooftop Solar Grid Power Plant project in the environment of Indonesia Power’s Plant, i.e. Bali PGU, which had been initiated since mid-2019. Utilizing PV modules from Canadian Solar, this technology is a solution to reduce emissions generated by the generating units. The Rooftop Solar Grid Power Plant is installed at two points, each with a capacity of 136 Kilo Watt Peak (kWp) at Pesanggaran DGPP, and 90 kWp in the Pemaron GTPP Sub-unit. The grid is estimated to be able to cut emissions to 39T CO2. In addition, the presence of Rooftop Solar Grid Power Plant supported to fulfill the energy needs of Bali PGU and made the
205 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Bali PGU dan menjadikannya zero energy building. Selanjutnya, di tahun 2020 ini PT ITH akan melakukan pengembangan PLTS Atap di lingkungan pembangkit Indonesia Power lainnya yaitu Semarang PGU, Grati POMU dan Bali PGU Extension dengan total kapasitas sebesar 4377,46 kWp.
3. Pengembangan Usaha Lainnya Sejak tahun 2018, PT ITH melakukan penyewaan
peralatan Micro Earth Quake (MEQ) sebagai alat pendeteksi analisis getaran dan gempa bumi, dimana kontrak yang telah didapatkan penggunaan alat tersebut di PLTP Songa, PLTP Tangkuban Parahu dan PLTP Atedai.
Ke depannya, PT ITH merupakan anak perusahaan yang dioptimalkan untuk mewujudkan pengembangan peluang bisnis Grid Solar Photo Voltage (PV) agar tumbuh signifikan serta sejalan dengan rencana jangka panjang membangun Renewable Energy Based Industrial Development (REBID) berbasis blockchain. Lebih lanjut, yang merupakan core competency PT ITH sekaligus menjalankan mandat dari PLN, PT ITH menginisiasi untuk melakukan penyediaan tenaga listrik ke pulau-pulau Terluar, Terdepan dan Tertinggal menggunakan EBT antara lain PLTS, PLTB maupun hybrid PLTD. [GRI 102-15]
building into a zero energy building. Further, in 2020, PT ITH will develop the Rooftop Solar Grid Power Plant in other Indonesia Power plant environments, i.e. Semarang PGU, Grati POMU, and Bali PGU Extension with a total capacity of 4,377.46 kWp.
3. Other Business Development Since 2018, PT ITH has leased Micro Earth Quake (MEQ)
equipment as a detector for vibration and earthquake analysis. The contracts have been obtained for the use of this equipment at Songa GPP, Tangkuban Parahu GPP, and Atedai GPP.
In the future, PT ITH, as a subsidiary, is optimized to realize the development of Grid Solar Photo Voltage (PV) business opportunities to grow significantly and in line with the long-term plan to build a blockchain-based Renewable Energy Based Industrial Development (REBID). Further, PT ITH initiated electricity supply to the Outermost, Frontier, and Underdeveloped Islands using NRE (WEPP, WPP, or Hybrid DPP) as the core competency of PT ITH and to carry out the mandate from PLN. [GRI 102-15]
206 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Dari sisi jenis pembangkit, pada tahun 2019 Indonesia Power telah melakukan pengembangan pembangkit dari sumber EBT yaitu Pembangkit Listrik Tenaga Air (PLTA), Pembangkit Listrik Tenaga Mini Hidro (PLTM) dan Pembangkit Listrik Hybrid dengan rincian sebagai berikut:
In terms of types of power plants, in 2019, Indonesia Power has developed NRE Power Plants, i.e. Hydro Power Plants (HPP), Mini Hydro Power Plants (MHPP) and Hybrid Power Plants with the following details:
Pengembangan Pembangkit Energi Baru TerbarukanNew Renewable Energy Power Plant Development
No. Jenis PembangkitType of Power Plant
LokasiLocation
KapasitasCapacity
Dampak Impact
1 Pembangkit Listrik Tenaga Air (PLTA)Hydro Power Plant (HPP)
PLTA Poigar 2Poigar 2 HPP
2x15 MW Dampak Ekonomi:- Biaya operasi yang relatif murahDampak Lingkungan:- Tidak akan menimbulkan emisi CO2 dan polusi udara yang bisa
berdampak pada perubahan iklim- Timbulan limbah B3 sedikit- Tidak menghasilkan limbah cairDampak Sosial:- Solusi bagi permasalahan energi di daerah-daerah terpencil karena
konstruksi yang sederhana serta pengoperasian yang relatif mudahEconomic Impact:- Relatively inexpensive operating costsEnvironmental Impact:- Will not cause CO2 emissions and air pollution that can impact on
climate change- Generating B3 waste- Does not generate liquid wasteSocial Impact:- Solutions to energy problems in remote areas because of the simple
construction and relatively easy operation
2 Pembangkit Listrik Tenaga Mini Hidro (PLTM)Mini Hydropower Plant (MHPP)
PLTM HarjosariHarjosari MHPP
3x3,3 MW
PLTM CileuncaCileunca MHPP
2x500 kW
PLTM GunungwugulGunungwugul MHPP
2x1,5 MW
PLTM LamburLambur MHPP
2x4 MW
3 Pembangkit Listrik HybridHybrid Power Plant
PLT Hybrid Nusa PenidaNusa Penida Hybrid Power Plant
10 MW Dampak Lingkungan:- Menurunkan timbulnya emisi CO2 dan polusi udara yang bisa
berdampak pada perubahan iklim- Menurunkan volume limbah B3- Meminimalisir timbulnya limbah cairEnvironmental Impact:- Reducing CO2 emissions and air pollution which can impact on
climate change- Reducing the volume of B3 waste- Minimizing liquid waste generated
Pengembangan Pembangkit Energi Baru Terbarukan Tahun 2019Development of New Renewable Energy Power Plants in 2019
207 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Pertama di Indonesia: Uji Coba Co-firing dengan Pellet Sampah [EU8]
Pioneer in Indonesia:Co-firing Trial with Trash Pellet [EU8]
Di tengah ketersediaan batubara yang kian menipis di alam, diperlukan sebuah langkah konkret untuk mereduksi pemakaian batubara maupun mencari energi alternatif. Sebagai pemilik dan pengelola sejumlah pembangkit thermal berbahan bakar batubara, Indonesia Power pun mengambil sebuah langkah nyata dengan melakukan uji coba co-firing Refused Derived Fuel (RDF) dengan batubara. Uji coba co-firing ini pun bukan hanya menjadi yang pertama bagi Indonesia Power, tetapi juga yang pertama kali dilakukan di Indonesia.
Co-firing adalah metode substitusi sebagian batubara dengan bahan bakar renewable pada rasio tertentu dengan tetap memperhatikan kualitas bahan bakar sesuai kebutuhan. Adapun bahan bakar substitusi yang digunakan adalah pellet RDF. Pellet ini merupakan hasil pengolahan sampah domestik pada Program Tempat Olah Sampah Setempat (TOSS) yang dikembangkan Indonesia Power UP Bali bersama STT PLN serta Pemkab dan masyarakat Klungkung, Bali. Hasil riset pengolahan sampah menjadi pellet menunjukkan adanya parameter fisik dan kimia pellet yang mendekati parameter low rank coal (jenis batubara yang digunakan pada pembangkit). Pengelolaan sampah menjadi pellet RDF mampu meningkatkan nilai kalori sampah. Selain itu, pellet RDF juga mengandung lebih sedikit sulfur dibandingkan batubara sehingga penggunaan pellet berpotensi menurunkan emisi CO2 , NOx dan SOx.
Di samping riset terhadap pellet, Indonesia Power juga melakukan riset lanjutan untuk memastikan kemungkinan pemanfaatan pellet bahan bakar di PLTU batubara. Kemudian, proses uji coba co-firing pun dimulai dengan menentukan jenis teknologi boiler terlebih dulu. Lokasi uji coba co-firing ini adalah PLTU Jeranjang. Secara umum, uji coba yang dilakukan pada beban 25 MW menunjukkan hasil yang positif. Sebagian besar parameter operasi dalam batas aman. Emisi gas buang yang didapat juga dalam batas normal. Dengan uji coba co-firing ini, diharapkan dapat mendorong pertumbuhan porsi EBT dalam bauran energi nasional.
Because of the decreasing stock of coal availability in nature, a concrete step to reduce the use of coal and find alternative energy are necessary. As the owner and manager of several coal-fired thermal plants, Indonesia Power took a step by conducting a co-firing trial of Refused Derived Fuel (RDF) with coal. This co-firing trial was not only the first for Indonesia Power, but also the first time in Indonesia.
Co-firing is a method of substituting some coal with renewable fuels at a certain ratio with due regards to the fuel quality requirements. The fuel is substitute with RDF pellet. This pellet is the result of domestic waste processing in the Local Trash Can (TOSS) Program developed by Indonesia Power UP Bali, in collaboration with STT PLN and the Regency Government and the Klungkung community in Bali.
The research resulted in waste processing into pellet, which shows that the physical and chemical parameters of pellets are similar to the low-rank coal parameters (low-rank coal is the type of coal used in the power plant). Management of waste converted into RDF pellets can increase the value of waste calories. In addition, RDF pellets also contain less sulfur than coal. Thus, pellets consumption has the potential to reduce CO2, NOx, and SOx emissions.
In addition to research on pellets, Indonesia Power performed advanced research to ascertain the possibility of utilizing pellets in Coal-Fired SPP. After, the co-firing trial process begins by determining the type of boiler technology. The co-firing trial is performed at Jeranjang SPP. In general, trials conducted at a 25 MW load showed positive results. Most operating parameters are within safe limits. Exhaust emissions obtained are within normal limits. The co-firing trial is expected to encourage growth in the NRE portion in the national energy mix.
Uji Coba Co-firing Co-firing Trial
208 Laporan Keberlanjutan 2019PT Indonesia Power
Ling
kung
an
Investasi Bagi Pengelolaandan Pelestarian LingkunganInvestment in Environmental Management and Conservation
Selama tahun 2019, Indonesia Power telah mengeluarkan biaya untuk pengelolaan dan pelestarian lingkungan sebesar Rp63.603,89 juta, meningkat 62,30% dibandingkan tahun 2018 yaitu sebesar Rp39.188,45 juta.
During 2019, Indonesia Power spent Rp63,603.89 million for environmental management and conservation, increased by 62.30% compared to 2018, which was Rp39,188.45 million.
Biaya Pengelolaan dan Pelestarian Lingkungan (Rp juta)Cost of Environmental Management and Conservation (Rp million)
No. Program Pengelolaan Management Program 2017 2018 2019
1 Pemeliharaan Lingkungan Environmental Maintenance 6.347,65 8.219,89 13.060,54
2 Dokumentasi Lingkungan Environmental Documentation 3.855,62 2.894,96 4.278,07
3 Pemantauan Lingkungan Environmental Monitoring 6.695,77 11.013,61 15.052,37
4 Pengelolaan Lingkungan Environmental Management 9.127,00 10.892,65 15.722,71
5 Pemeliharaan Instalasi/ Alat Pengelolaan LingkunganInstallation/Maintenance of Environmental Management Equipment 6.976,74 6.167,34 15.490,21
Jumlah Total 33.002,78 39.188,45 63.603,89
209 Sustainability Report 2019
PT Indonesia Power
Envi
ronm
ent
Penanganan Pengaduan LingkunganEnvironmental Complaint Handling
Sebagai wadah untuk menampung keluhan, pengaduan dan laporan terkait dampak lingkungan dari pemangku kepentingan khususnya masyarakat sekitar lokasi operasi Perusahan, Indonesia Power menyediakan saluran komunikasi beserta mekanisme penanganan pengaduan lingkungan. Setiap pengaduan masalah lingkungan, dapat disampaikan kepada Unit Pembangkit terkait yang ditujukan kepada General Manager masing-masing unit. Pengaduan tersebut akan ditindaklanjuti secara cepat untuk dapat diselesaikan sesuai dengan prosedur yang berlaku.
Selama tahun 2019, Indonesia Power tidak menerima pengaduan terkait lingkungan dari masyarakat sekitar dan pemangku kepentingan lainnya sehingga Perusahaan tidak menerima denda ataupun sanksi yang berhubungan dengan ketidakpatuhan terhadap Undang-undang dan peraturan terkait lingkungan.
As a forum to accommodate complaints, grievances, and reports related to the environmental impacts on the stakeholders, especially the communities surrounding the Company’s operations, Indonesia Power provides a communication channel with mechanisms for handling environmental complaints. Complaints on environmental issues are delivered to the related Generating Unit, and addressed to the unit’s respective General Manager. The complaint will be followed up quickly to be resolved in accordance with the prevailing procedures.
During 2019, Indonesia Power did not receive environmental complaints from surrounding communities and other stakeholders. Thus, the Company was not fined or sanctioned in terms of non-compliance with environmental laws and regulations.
Menerima pengaduan/pertanyaan/ keluhan pihak
eksternalReceive complaints/
questions/grievances from external parties
Penyampaian informasi/jawaban kepada pihak
eksternalDeliver the information/
answers to external parties
Verifikasi pengaduan/pertanyaan/ keluhan oleh
BidkomVerification of complaints/questions/grievances by
Communication Department
Penyusunan informasi/jawaban
Prepare the information/answers
Penyampaian pengaduan/pertanyaan/ keluhan kepada
bidang terkaitSubmit the complaints/
questions/grievances to the related department
Penyampaian informasi/ jawaban kepada pihak
eksternal Deliver the information/
answers to external parties
Mekanisme Penanganan Pengaduan Lingkungan [GRI 103-2, 103-3]Environmental Complaint Handling Mechanism [GRI 103-2, 103-3]
210 Laporan Keberlanjutan 2019PT Indonesia Power
Mencapai Kinerja Ekselen Dengan SDM Unggul
Achieving Excellent Performance With Superior HR
211 Sustainability Report 2019PT Indonesia Power
Sumber Daya Manusia (SDM) memiliki peran kunci terhadap pencapaian kinerja Perusahaan yang ekselen. Sejalan dengan
era digitalisasi, Indonesia Power berupaya mengelola dan meningkatkan kompetensi dan keahlian pegawai dalam satu
wadah “IP Academy” dan mengembangkan berbagai platform digital untuk mengakomodir dan menunjang kinerja dan
kompetensi seluruh pegawai guna mewujudkan SDM unggul.Human Resources (HR) has a key role in achieving the Company’s excellent
performance. In accordance with the digitalization era, Indonesia Power strives to manage and improve employee competence and expertise in “IP
Academy” forum, and develop various digital platforms to accommodate and support the performance and competence of all employees
to actualize superior HR.
SOSIAL SOCIAL
212 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Menghadapi iklim kompetisi dan tuntutan bisnis yang semakin ketat, akselerasi pengembangan kompetensi pegawai menjadi prioritas utama Indonesia Power dalam menjawab tantangan industri listrik nasional. Memasuki era revolusi industri keempat yang ditandai dengan perkembangan teknologi informasi, generasi milenial pun berkembang pesat di Indonesia Power. Untuk itulah, Indonesia Power secara konsisten menyesuaikan manajemen SDM guna mengatasi tantangan tersebut dengan merumuskan peta jalan pengelolaan SDM jangka panjang yang tertuang dalam Roadmap Human Capital Excellence 2018 – 2023. Untuk tahun 2018-2019, Indonesia Power fokus untuk mendorong terciptanya kebijakan unggul dan pelaksanaan human capital. Di tahun 2020, diharapkan dapat terwujud organisasi yang inovatif melalui penguatan pegawai ahli yang tersertifikasi internasional.
Indonesia Power prioritizes the employee competence development acceleration as the Company faces an increasingly competitive climate and business demands, to respond to the challenges of the national electricity industry. Entering the era of the fourth industrial revolution marked by developments in information technology, Indonesia Power welcomes the millennial generation. Therefore, Indonesia Power consistently adjusts the HR management to overcome these challenges by formulating a long-term HR management road map, stipulated in the 2018-2023 Human Capital Excellence Roadmap. For 2018-2019, Indonesia Power focuses on encouraging the creation of superior policies and human capital implementation.
Kebijakan Unggul dan Pelaksanaan Human Capital Excellence Superior Policy and Human Capital Excellence Implementation
2018-2019Policy Excellence & HC Implementation
2020Innovative Organization
2021Outstanding Execution
2022The Art ofCompetitive
2023HCE fit to Industry 4.0
Terciptanya fondasi transformasi perusahaan menuju Industry 4.0 melalui lingkungan kerja kolaboratif, penguatan kompetensi kepemimpinan & technical expert, HCMS terintegrasi, serta budaya baru yang sesuai dengan Industri 4.0
The creation of the Company’s transformation foundation towards Industry 4.0 in a collaborative work environment, by strengthening leadership competencies & technical expertise, integrated HCMS, as well as a new culture that is in accordance with Industry 4.0
Terciptanya Expert berkualifikasi internasional dan Leader yang unggul untuk mencapai strategi korporasi melalui transformasi budaya Hyper Connected to Hyper Productive yang didukung pengelolaan Big Data
The creation of internationally qualified experts and superior Leaders to achieve corporate strategies by Hyper Connected to Hyper Productive cultural transformation, supported by Big Data management
Optimalisasi Expert dan Knowledge Management sebagai solusi bisnis untuk mendukung execution premium berlandaskan leadership serta budaya digital yang kuat
Optimizing Expert and Knowledge Management as business solutions to support premium execution based on leadership and advanced digital culture
Terciptanya Expert dan Leader yang kompetitif didukung oleh budaya pemenang dan sistem pengambilan keputusan berbasis Artificial Intelligent
The creation of competitive Experts and Leaders, supported by a culture of winners and a Artificial Intelligent-based decision support system
Terciptanya strategic expert sebagai pilar pusat solusi O&M dngan penguasaan teknologi digital & HCE kompetitif untuk sustainability Perusahaan
The creation of a strategic expert as a central pillar of O&M solutions with expertise in digital technology & competitive HCE for the Company’s sustainability
Roadmap Human Capital Excellence 2018-2023Roadmap Human Capital Excellence 2018-2023
213 Sustainability Report 2019
PT Indonesia Power
Soci
al
Dalam roadmap tersebut dituangkan tujuan demi tujuan yang akan dicapai setiap tahunnya dalam kurun waktu lima tahun ke depan. Adapun monitoring program selama tahun 2019 dilakukan dengan menggunakan aplikasi Teamgantt. Teamgantt adalah aplikasi berbasis web manajemen proyek yang memungkinkan untuk memperbarui dan mengelola proyek yang sudah mobile base. Berikut capaian program ditahun 2019:
The roadmap stipulates goals to be achieved every year for the next five years. In 2018-2019, Indonesia Power refined policies to be implemented. In 2020, an innovative organization shall be realized through the strengthening of internationally certified expert staff.
Industrial Relation97%
Performance Management82%
Kolaborasi DigitalDigital Collaboration
90%
Whats on 2019As seen on
Culture100%
Pengembangan LeadershipLeadership
Development
76%
Community of Expertise
70%
TalentManagement
93%
Integrated Career Path
90%
Agile Organization95%
Assessment HCR-OCR100%
Pengembangan KompetensiCompetenceDevelopment
82%
Capaian Program Tahun 2019Performance Achievement in 2019
214 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Selama tahun 2019, total jumlah komposisi pegawai tetap Perusahaan sebanyak 4.320 orang. Jumlah ini mengalami peningkatan 0,61% dibanding tahun 2018 yaitu sebanyak 4.294. Berikut ini, data komposisi jumlah pegawai Perusahaan hingga tahun 2019:
During 2019, the Company has 4,320 permanent employees. The number increased by 0.61% from 2018, which was 4,294 employees. The following is the Company’s employees composition until 2019:
Komposisi Pegawai Employees Composition
Status KepegawaianEmployment Status
2017 2018 2019
PriaMale
WanitaFemale
JumlahTotal
PriaMale
WanitaFemale
JumlahTotal
PriaMale
WanitaFemale
JumlahTotal
Pegawai TetapPermanent Employee
3.772 437 4.209 3.868 426 4.294 3.870 450 4.320
Outsourcing/Alih DayaOutsourcing
(tidak terdefinisi)
(undefined)
(tidak terdefinisi)
(undefined)
2.688 (tidak terdefinisi)
(undefined)
(tidak terdefinisi)
(undefined)
2.900 4.071 450 4.521
Jumlah Total 3.772 437 6.897 3.868 426 7.194 7.941 900 8.841
Tingkat PendidikanEducation
2017 2018 2019
PriaMale
WanitaFemale
JumlahTotal
PriaMale
WanitaFemale
JumlahTotal
PriaMale
WanitaFemale
JumlahTotal
SD-SLTPElementary School - Junior High School
37 - 37 27 - 27 23 - 23
SLTA High School 1.290 76 1.366 1.177 60 1.237 1.064 54 1.118
Diploma (D1-D3)Young Bachelor (D1-D3)
1.195 121 1.316 1.392 134 1.526 1.433 149 1.582
S1 Bachelor’s Degree (S1) 1.166 219 1.385 1.182 207 1.389 1.255 222 1.477
S2 Master’s Degree (S2) 84 21 105 89 25 114 94 25 119
S3 Doctoral Degree - - - 1 - 1 1 - 1
Jumlah Total 3.772 437 4.209 3.868 426 4.294 3.870 450 4.320
UsiaAge
2017 2018 2019
PriaMale
WanitaFemale
JumlahTotal
PriaMale
WanitaFemale
JumlahTotal
PriaMale
WanitaFemale
JumlahTotal
< 30 tahun Years 1.855 177 2.032 2.020 152 2.172 1.975 166 2.141
31-50 tahun Years 1.447 217 1.664 1.469 246 1.715 1.542 258 1.800
> 51 tahun Years 470 43 513 379 28 407 353 26 379
Jumlah Total 3.772 437 4.209 3.868 426 4.294 3.870 450 4.320
Komposisi Pegawai Berdasarkan Status Kepegawaian [GRI 102-8]Employee Composition by Status [GRI 102-8]
Komposisi Pegawai Tetap Berdasarkan Tingkat Pendidikan [GRI 102-8]Permanent Employee Composition by Education Level [GRI 102-8]
Komposisi Pegawai Tetap Berdasarkan Usia [GRI 102-8]Permanent Employee Composition by Age [GRI 102-8]
215 Sustainability Report 2019
PT Indonesia Power
Soci
al
Unit BisnisBusiness Unit
2017 2018 2019
PriaMale
WanitaFemale
JumlahTotal
PriaMale
WanitaFemale
JumlahTotal
PriaMale
WanitaFemale
JumlahTotal
Head Office 380 135 515 384 145 529 448 169 617
Suralaya PGU 709 53 762 678 44 722 654 43 697
Priok POMU 292 27 319 299 24 323 309 27 336
Saguling POMU 182 21 203 178 17 195 170 20 190
Kamojang POMU 236 19 255 227 14 241 218 15 233
Semarang PGU 257 26 283 254 23 277 253 21 274
Mrica PGU 160 20 180 146 18 164 144 17 161
Grati POMU 180 28 208 186 27 213 179 27 206
Bali PGU 192 17 209 193 15 208 187 15 202
MSU 251 30 281 282 35 317 300 34 334
PLTU SPP Banten 1 Suralaya OMU
78 12 90 81 11 92 84 11 95
PLTU SPP Banten 2 Labuan OMU
99 6 105 118 6 124 111 5 116
PLTU SPP Banten 3 Lontar OMU
161 8 169 151 8 159 152 8 160
PLTU SPP Jawa Barat 2 Pelabuhan Ratu OMU
132 6 138 142 2 144 144 2 146
PLTU SPP Jawa Tengah 2 Adipala OMU
96 7 103 98 7 105 96 8 104
PLTU SPP Pangkalan Susu OMU
101 7 108 110 7 117 117 7 124
PLTGU CCPP Cilegon OMU 102 8 110 104 11 115 98 9 107
PLTU SPP Barru OMU 72 5 77 73 3 76 55 3 58
PLTU SPP Jeranjang OMU 81 2 83 85 2 87 81 1 82
PLTU SPP Sanggau OMU 2 - 2 1 0 1 1 - 1
PLTU SPP Sintang OMU 3 - 3 1 0 1 1 - 1
Holtekamp POMU 6 - 6 5 0 5 2 - 2
PLTA WPP Orya Genyem OMU
- - - 13 0 13 - - 0
Project Unit - - - 59 7 66 66 8 74
Jumlah Total 3.772 437 4.209 3.868 426 4.294 3.870 450 4.320
Komposisi Pegawai Tetap Berdasarkan Unit Bisnis [GRI 102-8]Permanent Employee Composition by Business Unit [GRI 102-8]
Unit BisnisBusiness Unit
2018 2019
Pegawai Tetap
Permanent Employee
Pegawai Tidak Tetap
Contract Employee
Outsourcing/ Alih
DayaOutsourc
ing
JumlahTotal
Pegawai Tetap
Permanent Employee
Outsourcing/ Alih
Daya*Outsourc
ing
JumlahTotal
Head Office 529 7 68 604 617 152 769
Suralaya PGU 722 1 311 1.034 697 194 891
Priok POMU 323 2 224 549 336 187 523
Saguling POMU 195 1 280 476 190 574 764
Komposisi Pegawai Berdasarkan Status Kepegawaian dan Unit Bisnis [GRI 102-8]Employee Composition by Employment Status and Business Unit [GRI 102-8]
216 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Komposisi Pegawai berdasarkan Tingkat Jabatan [GRI 405-1]Employee Composition by Position [GRI 405-1]
Komposisi PegawaiEmployees Composition
* di tahun 2019 terjadi perubahan status kepegawaian, dimana pegawai tidak tetap masuk ke dalam status Outsourcing/Alih Daya in 2019, there was a change to employment status, the contract employee is categorized as outsourcing
KeteranganDescription
2017 2018 2019
Ekse-kutif
Utama Chief
Execu-tive
Ekse-kutif
SeniorSenior Execu-
tive
Ekse-kutif
Execu-tive
Penye-lia
Super-visor
Pelak-sana
Practi-tioner
JumlahTotal
Ekse-kutif
Utama Chief
Execu-tive
Ekse-kutif
SeniorSenior Execu-
tive
Ekse-kutif
Execu-tive
Penye-lia
Super-visor
Pelak-sana
Practi-tioner
JumlahTotal
Ekse-kutif
Utama Chief
Execu-tive
Ekse-kutif
SeniorSenior Execu-
tive
Ekse-kutif
Execu-tive
Penye-lia
Super-visor
Pelak-sana
Practi-tioner
JumlahTotal
Jenis Kelamin Gender
Pria Male 6 75 245 1.522 1.924 3.772 7 77 250 1.584 1.950 3.868 8 79 241 1.659 1.883 3.870
Wanita Female 1 6 47 246 137 437 1 6 47 243 129 426 - 8 45 232 165 450
Jumlah Total 7 81 292 1.768 2.061 4.209 8 83 297 1.827 2.079 4.294 8 87 286 1.891 2.048 4.320
Status Kepegawaian Employment Status
Pegawai TetapPermanent Employee
7 81 292 1.768 2.061 4.209 8 83 297 1.827 2.079 4.294 8 87 286 1.891 2.048 4.320
Jumlah Total 7 81 292 1.768 2.061 4.209 8 83 297 1.827 2.079 4.294 8 87 286 1.891 2.048 4.320
Unit Bisnis Business Unit
Head Office 5 61 162 196 91 515 5 60 151 203 110 529 4 62 153 231 167 617
Suralaya PGU 1 3 16 286 456 762 1 3 16 264 438 722 1 3 14 256 423 697
Priok POMU - 1 6 101 211 319 - 1 6 116 200 323 1 2 7 119 207 336
Saguling POMU - 1 5 83 114 203 - 1 5 86 103 195 - 1 5 84 100 190
Kamojang POMU - 1 5 100 149 255 - 1 5 96 139 241 - 1 4 92 136 233
Semarang PGU - 1 6 104 172 283 - 1 6 108 162 277 - 1 5 109 159 274
Mrica PGU - 1 4 88 87 180 - 1 4 85 74 164 - 1 4 86 70 161
Grati POMU - 1 7 94 106 208 - 1 6 95 111 213 - 1 5 101 99 206
Bali PGU - 1 5 109 94 209 - 1 5 104 98 208 - 1 5 106 90 202
MSU 1 3 32 100 145 281 1 4 30 95 187 317 1 5 24 106 198 334
Unit BisnisBusiness Unit
2018 2019
Pegawai Tetap
Permanent Employee
Pegawai Tidak Tetap
Contract Employee
Outsourcing/ Alih
DayaOutsourc
ing
JumlahTotal
Pegawai Tetap
Permanent Employee
Outsourcing/ Alih
Daya*Outsourc
ing
JumlahTotal
Kamojang POMU 241 1 93 335 233 3 236
Semarang PGU 277 1 171 449 274 328 602
Mrica PGU 164 - 144 308 161 409 570
Grati POMU 213 2 66 281 206 242 448
Bali PGU 208 - 105 313 202 193 395
MSU 317 9 59 385 334 38 372
PLTU SPP Banten 1 Suralaya OMU 92 - 247 339 95 - 95
PLTU SPP Banten 2 Labuan OMU 124 - 308 432 116 417 533
PLTU SPP Banten 3 Lontar OMU 159 2 310 471 160 426 586
PLTU SPP Jawa Barat 2 Pelabuhan Ratu OMU
144 2 42 188 146 431 577
PLTU SPP Jawa Tengah 2 Adipala OMU 105 - 146 251 104 103 207
PLTU SPP Pangkalan Susu OMU 117 - 57 174 124 438 562
PLTGU CCPP Cilegon OMU 115 - 74 189 107 100 207
PLTU SPP Barru OMU 76 2 - 78 58 11 69
PLTU SPP Jeranjang OMU 87 - 165 252 82 185 267
PLTU SPP Sanggau OMU 1 - - 1 1 - 1
PLTU SPP Sintang OMU 1 - - 1 1 90 91
Holtekamp POMU 5 - - 5 2 - 2
PLTA WPP Orya Genyem OMU 13 - - 13 - - -
Project Unit 66 - - 66 74 - 74
Total 4.294 30 2.870 7.194 4.320 4.521 8.841
217 Sustainability Report 2019
PT Indonesia Power
Soci
al
KeteranganDescription
2017 2018 2019
Ekse-kutif
Utama Chief
Execu-tive
Ekse-kutif
SeniorSenior Execu-
tive
Ekse-kutif
Execu-tive
Penye-lia
Super-visor
Pelak-sana
Practi-tioner
JumlahTotal
Ekse-kutif
Utama Chief
Execu-tive
Ekse-kutif
SeniorSenior Execu-
tive
Ekse-kutif
Execu-tive
Penye-lia
Super-visor
Pelak-sana
Practi-tioner
JumlahTotal
Ekse-kutif
Utama Chief
Execu-tive
Ekse-kutif
SeniorSenior Execu-
tive
Ekse-kutif
Execu-tive
Penye-lia
Super-visor
Pelak-sana
Practi-tioner
JumlahTotal
PLTU SPP Banten 1 Suralaya OMU
- 1 6 57 26 90 - 1 6 59 26 92 - 1 6 59 29 95
PLTU SPP Banten 2 Labuan OMU
- 1 6 53 45 105 - 1 6 55 62 124 - 1 5 76 34 116
PLTU SPP Banten 3 Lontar OMU
- 1 7 94 67 169 - 1 6 95 57 159 - 1 6 92 61 160
PLTU SPP Jawa Barat 2 Pelabuhan Ratu OMU
- 1 6 80 51 138 - 1 6 88 49 144 - 1 6 90 49 146
PLTU SPP Jawa Tengah 2 Adipala OMU
- 1 6 55 41 103 - 1 6 68 30 105 - 1 6 66 31 104
PLTU SPP Pangkalan Susu OMU
- 1 4 59 44 108 - 1 5 61 50 117 - 1 5 74 44 124
PLTGU CCPP Cilegon OMU
- 1 4 41 64 110 - 1 5 53 56 115 - 1 5 54 47 107
PLTU SPP Barru OMU
- - 1 24 52 77 - - 1 20 55 76 - - 1 27 30 58
PLTU SPP Jeranjang OMU
- - 1 36 46 83 - - 1 42 44 87 - - 1 44 37 82
PLTU SPP Sanggau OMU
- - 1 1 - 2 - - 1 - - 1 - - 1 - - 1
PLTU SPP Sintang OMU
- - 1 2 - 3 - - 1 - - 1 - - 1 - - 1
Holtekamp POMU - - 1 5 - 6 - - 1 4 - 5 - - 1 1 - 2
PLTA WPP Orya Genyem OMU
- - - - - - - - 1 9 3 13 - - - - - -
Project Unit - - - - - - 1 2 17 21 25 66 1 2 16 18 37 74
Jumlah Total 7 81 292 1.768 2.061 4.209 8 83 297 1.827 2.079 4.294 8 87 286 1.891 2.048 4.320
Pendidikan Education
SD-SLTPElementary School - Junior High School
- - - 2 35 37 - - - 2 25 27 - - - 2 21 23
SLTA High School - 3 35 708 620 1.366 - 2 34 667 534 1.237 - 1 23 635 459 1.118
Diploma (D1-D3)Young Bachelor
- 2 22 358 934 1.316 - 2 28 427 1069 1.526 - 3 28 456 1.095 1.582
S1 Bachelor’s Degree
4 47 188 679 467 1.385 5 51 189 702 442 1.389 2 56 187 768 464 1.477
S2 Master’s Degree
3 29 47 21 5 105 2 28 46 29 9 114 5 27 48 30 9 119
S3 Doctoral Degree
- - - - - - 1 - - - - 1 1 - - - - 1
Jumlah Total 7 81 292 1.768 2.061 4.209 8 83 297 1.827 2.079 4.294 8 87 286 1.891 2.048 4.320
Usia Age
< 31 tahun Years - - - 276 1.631 1.907 - - - 402 1.770 2.172 - - - 387 1.754 2.141
31-50 tahun Years 4 61 232 1.190 285 1.789 3 62 245 1.181 224 1.715 2 59 245 1.276 218 1.800
> 50 tahun Years 3 20 60 302 128 513 5 21 52 244 85 407 6 28 41 228 76 379
Jumlah Total 7 81 292 1.768 2.061 4.209 8 83 297 1.827 2.079 4.294 8 87 286 1.891 2.048 4.320
Keberadaan Indonesia Power di setiap wilayah dimana unit-unit Perusahaan beroperasi membawa dampak ekonomi signifikan terhadap kondisi pasar tenaga kerja di wilayah tersebut. Hal ini dikarenakan jumlah tenaga kerja yang dipekerjakan di setiap unit Perusahaan, baik sebagai pekerja tetap maupun pekerja outsourcing/alih daya mencapai ribuan orang. Dalam laporan ini, pekerja lokal didefiniskan sebagai pekerja yang berdomisili di sekitar unit Perusahaan. Perusahaan bekerja sama dengan Anak Perusahaan dalam merekrut tenaga kerja lokal khususnya untuk mengisi posisi di level operator hingga manajer unit. Sedangkan Perusahaan secara langsung melakukan rekrutmen tenaga kerja lokal untuk pekerjaan seperti helper, keamanan dan pekerjaan sejenisnya. Pada tahun 2019, Indonesia Power belum mempekerjakan tenaga kerja lokal untuk posisi level manajemen senior. Namun hal ini tidak menutup kesempatan apabila dikemudian hari Perusahaan memberikan kesempatan yang sama dengan menempatkan tenaga kerja lokal di posisi manajemen senior. [GRI 202-2]
Indonesia Power’s presence in the region where the Company’s units operate significantly impacts the economy in terms of the labor market conditions in said region. This is because the number of employees in each unit of the Company, both permanent and outsourced, amounted to thousands of people. In this report, local employees are defined as employees who live in the area of the Company’s units. The Company cooperates with Subsidiaries in recruiting local employees, especially to fill positions from operator to unit manager. Whereas the Company directly recruits local employees for jobs such as helper, security, and other similar work. In 2019, Indonesia Power has not employed any local manpower for the senior management positions. However, this does not close any opportunity in the event that in the future the Company opens the opportunity to place local manpower in the senior manager positions. [GRI 202-2]
218 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al Pendekatan Manajemen Topik Kepegawaian terkait Rekrutmen, Turnover, Tunjangan dan Cuti [GRI 103-1, 103-2, 103-3]Management Approach to Employment related to Recruitment, Turnover, Allowances, and Leave [GRI 103-1, 103-2, 103-3]
Rekrutmen, Turnover, Tunjangan dan Cuti menjadi topik yang penting karena Indonesia Power meyakini bahwa makna keberlanjutan dalam pengelolaan SDM adalah pencapaian keseimbangan antara target usaha dengan pemenuhan hak dan harapan pegawai. SDM sebagai aset utama Perusahaan sekaligus mitra harus ditunjang dengan sistem pengelolaan SDM yang baik dimulai dari proses rekrutmen hingga pemberian remunerasi dan komponen kesejahteraan lain dengan menjunjung tinggi aspek keberagaman dan kesetaraan tanpa diskriminasi jenis kelamin, agama dan aspek lainnya.
Recruitment, Turnover, Allowances, and Leave are important topics because Indonesia Power believes that the sustainability in HR management is equivalent to achieving a balance between business targets and fulfilling employees’ rights and expectations. HR as the Company’s main asset and partners must be supported by a good HR management system, starting from the recruitment process, to remuneration, and other welfare components, by upholding the diversity and equality without discrimination by gender, religion, and other aspects.
Kebijakan Perusahaan• Surat Keputusan Direksi Nomor 38.K/010/IP/2009 tentang
Sistem Manajemen Sumber Daya Manusia• Surat Keputusan Direksi Nomor 85.K/010/IP/2012 tentang
Sistem Rekrutmen Pegawai• Surat Keputusan Direksi Nomor 63.K/010/IP/2009 tentang
Sistem Penghargaan PegawaiKetentuan Umum• Undang-Undang Nomor 13 tahun 2003 tentang
Ketenagakerjaan• Peraturan Kementerian Tenaga Kerja dan Transmigrasi Nomor
7 Tahun 2013 Tentang Upah Minimum• Peraturan Menteri Ketenagakerjaan Republik Indonesia
Nomor 15 Tahun 2018 tentang Upah Minimum
Company’s Policies:• Board of Directors’ Decree No. 38.K/010/IP/2009 on the
Human Resources Management System• Board of Directors’ Decree No. 85.K/010/IP/2012 on the
Employee Recruitment System• Board of Directors’ Decree No. 63.K/010/IP/2009 on the
Employee Award SystemGeneral Provisions:• Law No. 13 of 2003 on Employment• Regulation of the Minister of Manpower and Transmigration
No. 7 of 2013 on Minimum Wage• Regulation of the Minister of Employment of the Republic of
Indonesia No. 15 of 2018 on Minimum Wage
KebijakanPolicy
Komposisi PegawaiEmployees Composition
219 Sustainability Report 2019
PT Indonesia Power
Soci
al
• Pengelolaan dan pengembangan sumber daya manusia secara adil dengan didukung oleh peningkatan kompetensi dan keahlian pegawai agar tercapai human capital excellence; dan
• Mematuhi segala ketentuan dan peraturan pemberian remunerasi dan upah minimum yang telah ditetapkan.
• Managing and developing human resources in a fair manner, supported by enhanced employees’ competence and expertise to achieve human capital excellence; and
• Complying with all provisions and regulations on the provision of remuneration and minimum wages that have been enforced.
• Mencapai human capital excellence; dan
• Pengembangan SDM yang kompeten dalam jumlah yang cukup dan waktu yang tepat yang diselaraskan dengan strategi Perusahaan.
• Achieving human capital excellence; and
• Developing adequate numbers of competent human resources in a timely manner, that is aligned with the Company’s strategy.
• Pada tahun 2019 sebanyak 155 pegawai berhasil direkrut;
• Tingkat turnover tahun 2019 sebesar 3,49 dibanding keseluruhan pegawai;
• Pemberian remunerasi tidak dibedakan berdasarkan gender, namun berdasarkan penilain kinerja masing-masing individu; dan
• Tidak ada insiden diskriminasi yang dilaporkan di tahun 2019.
• In 2019, there were 155 employees recruited.
• The turnover rate in 2019 is 3.49 compared to all employees;
• The remuneration is not differentiated based on gender, but based on the performance assessment of each individual; and
• No discrimination incidents were reported in 2019.
KomitmenCommitment
RealisasiRealization
Sasaran dan TargetGoals and Targets
• Kerja sama dengan Anak Perusahaan terkait rekrutmen pegawai; dan
• Melakukan penyesuain upah tahun 2019 yang memperhatikan nilai inflasi nasional.
• Cooperation with subsidiaries in terms of employee recruitment; and
• Adjusting wages in 2019 with due regards to the national inflation.
Program/InisiatifProgram/Initiative
• Vice President of Human Capital and Change Management
• Vice President of Human Capital Development
• Vice President of Industrial Relation and Remuneration
• Vice President of Human Capital and Change Management
• Vice President of Human Capital Development
• Vice President of Industrial Relation and Remuneration
• Survei Human Resources Satisfaction & Enggagement (HRSE)
• Penanganan pengaduan pegawai
• Human Resources Satisfaction & Engagement (HRSE) Survey
• Employee Complaint Handling
EvaluasiEvaluation
Penanggung JawabPerson in Charge
220 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Untuk memenuhi standar formasi jabatan seiring dengan pertumbuhan Perusahaan, Indonesia Power telah melaksanakan proses rekrutmen dan seleksi guna mengisi kebutuhan formasi pegawai. Proses rekrutmen pegawai yang dilakukan terdiri dari lima tahapan, yakni (1) seleksi administrasi, (2) seleksi akademik dan kemampuan umum, (3) seleksi psikologis, (4) seleksi kesehatan dan (5) seleksi wawancara.
Dalam proses rekrutmen, Indonesia Power menetapkan syarat usia minimum yaitu 20 tahun bagi para calon pegawai, Indonesia Power juga mengedepankan asas keberagaman dan kesetaraan dengan tanpa memandang perbedaan jenis kelamin, suku, ras, agama maupun aspek diskriminasi lainnya.
Selama tahun 2019, Indonesia Power telah melakukan rekrutmen pegawai baru sebanyak 155 orang yang ditempatkan di berbagai unit bisnis Perusahaan dengan tingkat rekrutmen sebesar 3,59%. Komposisi pegawai baru yang direkrut selama tahun 2019 adalah sebagai berikut:
Indonesia Power has implemented a recruitment and selection process to fill the organizational formation to meet the standards in line with the Company’s growth. The employee recruitment process consists of five stages: (1) administrative selection, (2) academic selection and general capability, (3) psychological selection, (4) health, and (5) interview.
In the recruitment process, Indonesia Power determines the minimum age required is 20 years for prospective employees. Indonesia Power promotes diversity and equality regardless of gender, ethnicity, race, religion, or other aspects.
During 2019, Indonesia Power recruited 155 new employees who were placed in various business units of the Company, with a recruitment rate of 3.59%. The composition of new employees recruited in 2019 is as follows:
Rekrutmen dan Turnover Pegawai Employees’ Recruitment and Turnover
KeteranganDescription 2017 2018 2019
Jenis Kelamin Gender
Pria Male 226 79 112
Wanita Female 15 19 43
Jumlah Total 241 98 155
Unit Bisnis Business Unit
Head Office 18 2 41
Suralaya PGU 23 4 12
Priok POMU 13 4 17
Saguling POMU 18 3 9
Kamojang POMU 12 8 3
Semarang PGU 14 10 6
Mrica PGU 10 2 8
Grati POMU 16 9 5
Bali PGU 15 9 5
MSU 16 8 9
PLTU SPP Banten 1 Suralaya OMU 5 - 4
PLTU SPP Banten 2 Labuan OMU 7 2 6
PLTU SPP Banten 3 Lontar OMU 13 11 4
PLTU SPP Jawa Barat 2 Pelabuhan Ratu OMU 8 2 3
PLTU SPP Jawa Tengah 2 Adipala OMU 5 - 1
PLTU SPP Pangkalan Susu OMU 13 6 4
PLTGU CCPP Cilegon OMU 14 8 -
PLTU SPP Barru OMU 10 2 3
Komposisi Pegawai Baru Indonesia Power Tahun 2019 [GRI 401-1]Indonesia Power’s New Employees Composition in 2019 [GRI 401-1]
221 Sustainability Report 2019
PT Indonesia Power
Soci
al
Selain proses rekrutmen, sepanjang tahun 2019, terdapat sejumlah pegawai Indonesia Power yang keluar atau putus hubungan kerja (turnover). Penyebabnya beragam, yakni pensiun, meninggal dunia, diberhentikan maupun mengundurkan diri. Pada tahun 2019, tingkat turnover pegawai Indonesia Power mencapai 3,50%. Besarnya tingkat turnover pegawai khususnya disebabkan oleh banyaknya jumlah pegawai yang memasuki masa pensiun.
In addition to the recruitment process, throughout 2019, there were several Indonesia Power’s employees who left or resigned (turnover). The causes varied, i.e. retirement, death, dismissal, or resignation. In 2019, Indonesia Power’s employee turnover rate reached 3.50%. The large employee turnover rate is mainly due to the number of employees entering retirement.
KeteranganDescription 2017 2018 2019
PLTU SPP Jeranjang OMU 4 1 3
PLTU SPP Sanggau OMU - - -
PLTU SPP Sintang OMU - - -
Holtekamp POMU - - -
PLTA HPP Orya Genyem OMU - - -
Project Unit 7 7 12
Jumlah Total 241 98 155
Usia Age
< 30 tahun Years 241 98 155
31 – 50 tahun Years - - -
> 50 tahun Years - - -
Jumlah Total 241 98 155
KeteranganDescription 2017 2018 2019
Jenis Kelamin Gender
Pria Male 156 154 134
Wanita Female 13 25 17
Jumlah Total 169 179 151
Unit Bisnis Business Unit
Head Office 18 17 21
Suralaya PGU 32 48 43
Priok POMU 12 10 10
Saguling POMU 23 20 17
Kamojang POMU 10 16 12
Semarang PGU 23 16 4
Mrica PGU 19 21 11
Grati POMU 7 4 5
Bali PGU 2 9 8
MSU 5 6 8
PLTU SPP Banten 1 Suralaya OMU 4 2 2
PLTU SPP Banten 2 Labuan OMU 3 - 3
Total Turnover Pegawai berdasarkan Unit Kerja Tahun 2019 [GRI 401-1]Total Employee Turnover by Work Unit in 2019 [GRI 401-1]
222 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
KeteranganDescription 2017 2018 2019
PLTU SPP Banten 3 Lontar OMU 7 2 3
PLTU SPP Jawa Barat 2 Pelabuhan Ratu OMU 3 6 2
PLTU SPP Jawa Tengah 2 Adipala OMU 1 1 -
PLTU SPP Pangkalan Susu OMU - - -
PLTGU CCPP Cilegon OMU - - 1
PLTU SPP Barru OMU - 1 -
PLTU SPP Jeranjang OMU - - -
PLTU SPP Sanggau OMU - - -
PLTU SPP Sintang OMU - - -
Holtekamp POMU - - -
PLTA HPP Orya Genyem OMU - - -
Project Unit - - 1
Jumlah Total 169 179 151
Usia Age
< 30 tahun Years - 4 4
31 – 50 tahun Years 9 11 9
> 50 tahun Years 160 164 138
Jumlah Total 169 179 151
Rekrutmen dan Turnover PegawaiEmployees’ Recruitment and Turnover
223 Sustainability Report 2019
PT Indonesia Power
Soci
al
Sebagai Perusahaan yang bergerak dalam industri pembangkitan tenaga listrik, Indonesia Power menyadari karakter pekerjaan di sebagian besar unit bisnis menyebabkan jumlah pegawai pria lebih banyak dari pada pegawai wanita. Namun, untuk menyikapi hal tersebut, Indonesia Power telah memiliki kebijakan Perusahaan yaitu Pedoman Etika Perusahaan (Code of Conduct) PT Indonesia Power yang di dalamnya memuat tentang hak asasi manusia seperti adanya penerapan prinsip keberagaman dan kesetaraan bagi seluruh pegawai. Melalui kebijakan tersebut, diharapkan akan tercipta lingkungan kerja yang adil dan dapat merangkul seluruh golongan, tanpa membedakan jenis kelamin, ras, suku, agama maupun asal wilayah.
Secara umum, terdapat peningkatan jumlah pegawai wanita di tahun 2019 dibandingkan tahun 2018. Jumlah pegawai wanita meningkat sebanyak 5,63% menjadi 450 pegawai di tahun 2019 dari tahun sebelumnya yakni 426 pegawai. Walaupun peningkatan jumlah tersebut tidak signifikan, namun Indonesia Power tetap memberikan kesempatan seluas-luasnya bagi pegawai wanita untuk berkarier. Pegawai wanita juga memiliki kesempatan yang sama dengan pegawai pria selama memiliki kompetensi yang mumpuni sesuai bidang.
As a company engaged in the electricity generation industry, Indonesia Power is aware that the nature of the work causes the Company to have more male employees than female employees. However, to address this, Indonesia Power has a Company’s policy in the form of the Code of Conduct of PT Indonesia Power, which stipulates human rights, such as the principle of diversity and equality for all employees. Through this policy, the Company shall create a fair working environment that can embrace all groups, regardless of gender, race, ethnicity, religion, or origin.
Generally, the number of female employees increased compared to 2018. In 2019, the number of female employees increased by 5.63% to 450 employees from the previous year of 426 employees. Although the increase is not significant, Indonesia Power provides equal opportunities for female employees to have a career. Female employees have the same opportunities as male employees as long as they have qualified competence required in the field.
Keberagaman dan Kesempataan SetaraDiversity and Equal Opportunities
Pemenuhan Hak-Hak Pegawai Fulfillment of Employee Rights
Komposisi Pegawai Wanita Indonesia Power Composition of Female Employees Indonesia Power
TOTAL
450
Eksekutif Senior Senior Executive
8Eksekutif Executive
45
Penyelia Supervisor
232Pelaksana Practioner
165
224 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Indonesia Power memberikan perhatian yang besar terhadap kesejahteraan pegawai di setiap unit bisnis dan kantor pusat Perusahaan. Salah satunya adalah dengan menerapkan standar pemberian remunerasi yang kompetitif dengan mempertimbangkan persaingan industri sejenis, regulasi pemerintah dan kemampuan Perusahaan. Pemberian remunerasi juga mempertimbangkan kompetensi, kemampuan dan kinerja individu pada tahun tersebut. Indonesia Power tidak pernah membedakan jumlah remunerasi yang diterima pegawai pria atau wanita pada setiap kategori pegawai di setiap lokasi operasi Perusahaan. Seluruh pegawai baik pria maupun wanita pada jenjang yang sama memiliki besaran gaji yang sama di setiap unit bisnis Perusahaan, sehingga rasio basic salary yaitu 1:1. [GRI 405-2]
Komponen remunerasi yang diterima oleh pegawai ada berbagai macam, salah satunya adalah upah atau gaji. Untuk pembayaran upah atau gaji pegawai, Indonesia Power sepenuhnya telah memberikan upah sesuai dengan ketentuan Upah Minimum Regional yang berlaku di masing-masing wilayah dimana unit bisnis dan kantor pusat Perusahaan berada. Berikut perbandingan gaji pegawai entry level Indonesia Power dengan Upah Minimum Regional masing-masing daerah:
Indonesia Power takes into account the employees’ welfare in each of the Company’s business units and head office. One of the measures is to apply a competitive remuneration standard with due regard to similar industry, government regulations, and the Company’s ability. The provision of remuneration also considers the competence, abilities, and performance of individuals within the year. Indonesia Power never distinguishes the amount of remuneration of male or female employees in any employee category in any of the Company’s operating locations. Both male and female employees at the same level have the same salary amount in the Company’s business unit. Thus, the basic salary ratio is 1: 1. [GRI 405-2]
There are various remuneration components received by employees, one of which is wage or salary. Indonesia Power provides wages in accordance with the Regional Minimum Wage provisions in force in each region where the Company’s business units and head office are located to pay the employees their wages or salaries. The following is a comparison of Indonesia Power entry level employee salaries with Regional Minimum Wages of each region:
Remunerasi dan Kesejahteraan PegawaiEmployees’ Remuneration and Welfare
Pemenuhan Hak-Hak PegawaiFulfillment of Employee Rights
Unit ProvinsiProvince
Gaji Pegawai Entry Level (Rp)Entry Level
Employee’s Salary (Rp)
Upah MinimumMinimum Wage in the Province
(Rp)
Rasio Gaji Pegawai Baru Dibandingkan Upah
MinimumRatio of Entry Level Employee Salary to
Minimum Wage
Head Office DKI Jakarta 5.749.000 3.648.035 1,58
Suralaya PGU Banten 5.593.000 2.099.385 2,66
Priok POMU DKI Jakarta 5.716.000 3.648.035 1,57
Saguling POMU Jawa BaratWest java
5.574.000 1.544.360 3,61
Kamojang POMU Jawa BaratWest java
5.593.000 1.544.360 3,62
Semarang PGU Jawa TengahCentral Java
5.593.000 1.486.065 3,76
Mrica PGU Jawa TengahCentral Java
5.574.000 1.486.065 3,75
Grati POMU Jawa TimurEast Java
5.593.000 1.508.894 3,71
Bali PGU Bali 5.901.000 2.127.157 2,77
MSU DKI Jakarta 5.749.000 3.648.035 1,58
Perbandingan gaji pegawai entry level Indonesia Power dengan Upah Minimum [GRI 202-1]Comparison of Indonesia Power’s entry level employee Salary and Minimum Wages in 2019 [GRI 202-1]
225 Sustainability Report 2019
PT Indonesia Power
Soci
al
Dalam menjalankan operasional sehari-hari, Indonesia Power memiliki pegawai tetap dan pegawai tidak tetap yang tediri dari tenaga kerja waktu tertentu (TKWT) dan alih daya. Perbedaan status kepegawaian itu berdampak pada pemberian komponen remunerasi atau benefit yang diperoleh. Namun, Indonesia Power tetap memastikan bahwa hak-hak pegawai tidak tetap telah terpenuhi sesuai dengan standar peraturan ketenagakerjaan yang berlaku. Berikut perbedaan komponen remunerasi berdasarkan status kepegawaian. [GRI 401-2]
In carrying out day-to-day operations, Indonesia Power has permanent employees and non-permanent employees consisting of contract employees (TKWT) and outsourcing. The difference in employment status impacts on the provision of the remuneration or benefits component obtained. However, Indonesia Power ensures that the rights of non-permanent employees are fulfilled in line with the prevailing employment provision standards. The following are the differences in the remuneration component by employment status. [GRI 401-2]
Perbedaan Komponen Remunerasi Berdasarkan Status Kepegawaian [GRI 401-2]Different Remuneration Components by Employment Status [GRI 401-2]
Unit ProvinsiProvince
Gaji Pegawai Entry Level (Rp)Entry Level
Employee’s Salary (Rp)
Upah MinimumMinimum Wage in the Province
(Rp)
Rasio Gaji Pegawai Baru Dibandingkan Upah
MinimumRatio of Entry Level Employee Salary to
Minimum Wage
PLTU SPP Banten 1 Suralaya OMU
Banten 5.593.000 2.099.385 2,66
PLTU SPP Banten 2 Labuan OMU
Banten 5.593.000 2.099.385 2,66
PLTU SPP Banten 3 Lontar OMU
Banten 5.716.000 2.099.385 2,72
PLTU SPP Jawa Barat 2 Pelabuhan Ratu OMU
Jawa BaratWest java
5.593.000 1.544.360 3,62
PLTU SPP Jawa Tengah 2 Adipala OMU
Jawa TengahCentral Java
5.593.000 1.486.065 3,76
PLTU SPP Pangkalan Susu OMU
Sumatera UtaraNorth Sumatera
5.716.000 2.132.188 2,68
PLTGU CCPP Cilegon OMU Banten 5.593.000 2.099.385 2,66
PLTU SPP Barru OMU Sulawesi SelatanSouth Sulawesi
5.697.000 2.647.767 2,15
PLTU SPP Jeranjang OMU Nusa Tenggara BaratWest Nusa Tenggara
5.697.000 1.825.000 3,12
Project Unit DKI Jakarta 5.716.000 3.940.972 1,45
Rata-rata Average 2,80
KebijakanPolicy Benefit
Status Kepegawaian Employment Status
Pegawai TetapPermanent Employee
TKWTContract Employees
Alih DayaOutsourcing
RemunerasiRemuneration
Gaji/Imbalan Salary/Compensation √ √ √
Kompensasi LemburOvertime Compensation
√ - √
Uang Pelepasan Severance Pay √ - -
Tunjangan Hari TuaPension Allowances
√ - -
Asuransi Insurance √ - √
Pemeliharaan KesehatanHealth Care
Jaminan KesehatanHealth Insurance
√ √ √
Tunjangan Kecelakaan KerjaOccupational Accident Allowances
√ √ √
226 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
KebijakanPolicy Benefit
Status Kepegawaian Employment Status
Pegawai TetapPermanent Employee
TKWTContract Employees
Alih DayaOutsourcing
Pendidikan/PelatihanEducation/Training
Pendidikan FormalFormal Education
√ - -
Pelatihan Training √ - √
Kebijakan LainnyaOther Policies
Pinjaman Lunak Soft Loans √ - -
Bantuan Pemakaman dan DukacitaFuneral and Grief Assistance
√ - -
Bantuan Bencana AlamNatural Disaster Support
√ - -
Family Gathering √ - -
Bantuan Fasilitas Sewa Rumah (BFSR)House Rental Facilities Assistance (BFSR)
√(tertentu)(certain)
- -
Fasilitas KerjaWork Facilities
Pakaian Kerja/ORWork/Sports Uniform
√ - √
Rumah Jabatan Official Housing √(tertentu)(certain)
- -
Kendaraan Dinas Official Vehicle √(tertentu)(certain)
- -
Kendaraan OperasionalOperational Vehicle
√ √ √
Perjalanan Dinas Business Trip √ √ √
Alat Komunikasi Communication Device
√(tertentu)(certain)
- -
Alat Penunjang Supporting Device √ √ √
Indonesia Power membangun hubungan industrial yang harmonis antar pegawai dan Perusahaan melalui pembentukan serikat pekerja dengan nama Persatuan Pegawai PT Indonesia Power (PP-IP). Indonesia Power memberikan kebebasaan kepada setiap individu pegawai untuk bergabung dan berserikat, guna mendukung pertumbuhan Perusahaan dan kesejahteraan pegawai. Pegawai secara bebas dapat bergabung bersama PP-IP.
Sebagai tindak lanjut atas keberadaan serikat pekerja, maka pegawai dan manajemen Perusahaan kemudian menyusun dan menyepakati Perjanjian Kerja Bersama (PKB). Kesepakatan bersama, tugas, tanggung jawab dan hak-hak pegawai dalam PKB ditinjau secara berkala dan ditandatangani oleh perwakilan manajemen dan PP-IP. Seluruh pegawai tetap Indonesia Power (100% pegawai) terlindungi hak dan kewajibannya di dalam PKB. Sementara untuk pegawai tidak tetap atau alih daya, hak dan kewajibannya dituangkan dalam Perjanjian Kerja Waktu Tertentu (PKWT). [GRI 102-41]
Indonesia Power builds harmonious industrial relations between employees and the Company by establishing a trade union under the name of PT Indonesia Power Trade Union (PP-IP). Indonesia Power gives freedom to each employee to join and associate, to support the Company’s growth and employees’ welfare. Employees can freely join PP-IP.
As a follow-up to the presence of the union, the employees and the Company’s management formulate and agree on a Collective Labor Agreement (CLA). Employees’ collective agreements, duties, responsibilities, and rights in the Collective Labor Agreement are periodically reviewed and signed by management representatives and PP-IP. The rights of all permanent employees of Indonesia Power (100% employees) are protected in the CLA, as well as their obligations. For non-permanent employees or outsourced, their rights and obligations are set forth in the Fixed-Term Employment Contract (PKWT). [GRI 102-41]
Hubungan Industrial yang HarmonisHarmonious Industrial Relations
Pemenuhan Hak-Hak PegawaiFulfillment of Employee Rights
227 Sustainability Report 2019
PT Indonesia Power
Soci
al
Indonesia Power memberikan hak cuti melahirkan (maternity leave) kepada pegawai wanita selama tiga bulan dengan atau ±90 hari. Untuk pegawai pria, diberikan hak cuti paternity leave selama dua hari di luar cuti tahunan ketika menemani istrinya yang sedang melahirkan. Pemberian hak cuti tersebut, diatur secara formal dalam Surat Keputusan Direksi Nomor 49.K/010/IP/2010 tanggal 19 Mei 2010 tentang Cuti Sakit, Cuti Haid dan Cuti Bersalin dan PKB Bab VII Perlindungan Pasal 82 tentang Cuti Bersalin, Pasal 86 tentang Ijin Karena Kepentingan.
Pada tahun 2019, terdapat 58 orang pegawai wanita yang menggunakan hak maternity leave, dengan tingkat pegawai kembali bekerja setelah masa cuti berakhir sebesar 98,28%. Sementara itu, pegawai pria yang telah menggunakan hak paternity leave karena istrinya melahirkan tercatat sebanyak 326 orang, dan seluruhnya sudah kembali bekerja ketika masa cuti berakhir (100%). [GRI 401-3]
Indonesia Power provides maternity leave to female employees for three months or ±90 days. For male employees, paternity leave is granted for two days not considered as annual leave when accompanying his wife is about to give birth. The leave rights is formally regulated in Directors’ Decree No. 49.K/010/IP/2010 dated 19 May 2010 on the Sick Leave, Menstruation Leave, and Maternity Leave, and CLA Chapter VII Protection Article 82 on the Maternity Leave, Article 86 on the Permit to Leave.
In 2019, there were 58 female employees who exercised their rights to maternity leave. The rate of employees returning to work after maternity leave is 98.28%. Meanwhile, there are 326 male employees who exercised their rights to paternity leave because their wives gave birth. All those male employees have returned to work after the paternity leave (100%). [GRI 401-3]
Cuti MelahirkanMaternity Leave
Sebagai Perusahaan yang bertanggung jawab, Indonesia Power taat dan patuh terhadap norma dan aturan ketenagakerjaan yang berlaku secara internasional dan nasional. Sudah menjadi norma internasional yang diterima dan diratifikasi oleh berbagai negara untuk menolak praktik kerja paksa. Indonesia Power memastikan hal demikian tidak terjadi di setiap unit bisnis Perusahaan. Demikian pula dengan pekerja anak, Indonesia Power memiliki mekanisme untuk menyaring usia minimum pegawai yang diterima oleh Perusahaan. Kepatuhan tersebut juga diperluas cakupannya hingga ke kontraktor dan atau sub-kontraktor hingga pemasok Perusahaan. Kebijakan yang tegas dan pelaksanaan yang konsisten merupakan komitmen Perusahaan untuk senantiasa patuh pada aturan dan norma ketenagakerjaan. Secara umum, Indonesia Power mencatat tidak ada insiden terkait kerja paksa dan pekerja anak pada operasi dan pemasok Perusahaan yang terjadi selama tahun 2019.
As a responsible company, Indonesia Power obeys and complies with employment norms and regulations that apply internationally and nationally. The common international practices are accepted and ratified by various countries to reject the practice of forced labor. Indonesia Power ensures that this does not happen in any Company’s business unit. Likewise, with child labor, Indonesia Power has a mechanism to screen the minimum age of employees recruited by the Company. The compliance standard is also extended to the contractors and/or sub-contractors, as well as the Company’s suppliers. The Company is committed to complying w the employment rules and regulations in the form of firm policies and consistent implementation. Generally, Indonesia Power recorded no incidents related to forced labor and child labor in the Company’s operations and Company’s suppliers during 2019.
228 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Realisasi Maternity dan Paternity Leave tahun 2019 [GRI 401-3]Maternity and Paternity Leave in 2019 [GRI 401-3]
Keterangan Description
Pegawai Employee
Wanita Female(Maternity Leave)
Pria Male(Paternity leave)
Jumlah pegawai yang berhak mendapatkan hak cuti Total employees who can exercise their rights to leave
450 1.821*
Jumlah pegawai yang menggunakan hak cuti Total employees who exercise their rights to leave
58 326
Jumlah pegawai yang kembali bekerja setelah masa cuti berakhirTotal employees who returned to work after the leave ends
57 326
Jumlah pegawai yang kembali bekerja setelah masa cuti berakhir, yang masih dipekerjakan kembali 12 bulan setelah kembali bekerjaTotal employees who returned to work after the leave ends, and still working 12 months after his/her return
56 326
Tingkat pegawai yang menggunakan hak cuti yang kembali bekerja (%)Rate of employees who returned to work after exercising their rights to leave (%)
98,28% 100%
* jumlah pegawai pria dengan status M0 sampai dengan M2 total male employees with status M0 up to M2
Indonesia Power memberikan perhatian besar terhadap pegawai yang hendak memasuki masa pensiun (purnabakti). Salah satunya diwujudkan dengan memberikan pelatihan kepada mereka melalui pelatihan program pensiun. Pelatihan diselenggarakan dengan tujuan mempersiapkan masa pensiun pegawai dalam mengembangkan potensi diri dan dapat mengelola permasalahan yang akan terjadi. Melalui bekal itu, diharapkan para pegawai tersebut siap secara mental dan spiritual dalam menghadapi masa pensiun dan dapat tetap nyaman dan produktif.
Indonesia Power telah mempersiapkan Program Masa Persiapan Pensiun (MPP), bagi pegawai yang akan memasuki masa pensiun, meliputi: [GRI 404-2]1. Pembekalan pra-purna bhakti untuk menyiapkan psikologis
terkait dengan pengelolaan keuangan dan kesehatan yang diberikan minimal tiga tahun sebelum pegawai memasuki masa pensiun; dan
2. Pembekalan diklat purna bhakti yang diberikan dua tahun sebelum pegawai memasuki masa pensiun, dengan pilihan: kewirausahaan, sertifikasi dan pembekalan rohani.
Indonesia Power takes into account employees who are about to retire (pension). One of the forms is to provide training to the employees through retirement program training. The training has the objective to prepare the employees’ retirement period to develop their potential and manage problems that may arise. Through this provision, the employees are expected to be mentally and spiritually prepared for retirement and remain comfortable and productive.
Indonesia Power has prepared a Retirement Preparation Program (MPP) for employees who will retire, including:[GRI 404-2]1. Pre-retirement to prepare psychologically related to financial
and health management, provided at least three years before the employee enters retirement; and
2. After-service training, provided two years before the employee enters retirement, with several choices: entrepreneurship, certification, and spiritual training.
Program PensiunRetirement Program
Pemenuhan Hak-Hak PegawaiFulfillment of Employee Rights
229 Sustainability Report 2019
PT Indonesia Power
Soci
al
Melalui program tersebut, diharapakan peserta akan mendapatkan pengetahuan dan pengalaman langsung yang dapat diterapkan selama menjalani masa pensiun. Selama tahun 2019, Indonesia Power telah melaksanakan 130 kali program pelatihan MPP yang diikuti oleh 135 pegawai tetap yang akan memasuki masa pensiun. [GRI 404-2]
Selain itu, Indonesia Power juga menyelenggarakan program pensiun imbalan pasti untuk seluruh pegawai tetap yang memenuhi syarat seperti yang tercantum dalam PKB Bab V Pemberhentian Pegawai Pasal 31 tentang Kepesertaan Pensiun. Program pensiun ini memberikan imbalan berdasarkan penghasilan dasar pensiun dan masa kerja pegawai. Dana pensiun ini dikelola oleh Dana Pensiun PLN (DP-PLN), pihak berelasi yang bertanggung jawab atas peningkatan imbalan pasti pensiun yang disediakan Perusahaan dalam program dana pensiun. Pendanaan DP-PLN terutama berasal dari pegawai dan pemberi kerja masing-masing sebesar 6,00% dan 15,45% dari penghasilan dasar pensiun. [GRI 201-3]
Selain progam pensiun yang dikelola oleh DP-PLN, Perusahaan menyediakan Program Pensiun Iuran Pasti, berupa manfaat pensiun sebesar formula yang sudah ditentukan oleh Dana Pensiun Lembaga Keuangan (DPLK). Manfaat pensiun ini jumlahnya tidak pasti karena ditentukan oleh akumulasi iuran bulanan dan hasil pengembangan oleh DPLK. Perusahaan juga memberikan imbalan program pemeliharaan kesehatan tanpa pendanaan bagi pensiunan dan tanggungannya yang memenuhi persyaratan. Perusahaan juga menyediakan imbalan pesangon dan penghargaan purna jabatan tanpa pendanaan bagi pegawai yang memenuhi syarat.
Bagi pegawai yang akan mengajukan pensiun dini, Perusahaan menyediakan Program Pensiun Dini yang penawarannya bersifat terbatas, yaitu khusus bagi pegawai yang telah memiliki kriteria tertentu. Manfaat yang akan diterima oleh pegawai berupa pesangon dan pembekalan program pensiun maksimal enam bulan sejak ditetapkannya Keputusan Direksi terkait pemberhentiannya sebagai pegawai.
Sepanjang tahun 2019, sebanyak 135 pegawai memasuki masa purnabakti dengan total dana yang dikeluarkan Perusahaan untuk program pensiun sebesar Rp115.572,91 juta.
Indonesia Power juga telah membuat proyeksi pegawai yang akan memasuki masa pensiun dalam jangka waktu 5 dan 10 tahun ke depan yang diuraikan pada tabel-tabel di bawah ini:
Through this program, the participants shall have knowledge and experience that can be applied during retirement. During 2019, Indonesia Power has implemented 130 times MPP training program, with 135 permanent employees who will retire. [GRI 404-2]
In addition, Indonesia Power also holds a defined benefit pension program for all permanent employees who meet the requirements as listed in CLA Chapter V on Employee Dismissal Article 31 on Pension Participation. This pension program provides benefits based on basic retirement income and years of service of the employee. This pension fund is managed by the PLN Pension Fund (DP-PLN), a related party responsible for refining the defined pension benefits provided by the Company in the pension fund program. DP-PLN funding comes mainly from employees and employers in the amount of 6.00% and 15.45% of basic pension income. [GRI 201-3]
In addition to the pension program managed by the DP-PLN, the Company provides a Fully Funded Pension Plan, in the form of pension benefits with a formula determined by the Financial Institution Pension Fund (DPLK). The amount of the pension benefit is not fixed as it is determined by the accumulated monthly contribution and return of investment by the DPLK. The Company also provides compensation for health care programs without funding for pensioners and dependents who meet the requirements. The Company provides severance pay and post-service awards without funding for qualified employees.
The Company provides an Early Retirement Program with limited offers for employees who are applying for early retirement, specifically for employees with certain criteria. The employees may receive benefits in the form of severance pay and provision of pension plans for a maximum of six months from the determination of the Board of Directors’ Decree related to his/her termination of employment.
Throughout 2019, 135 employees entered the retirement period, and the Company spent Rp115,572.91 million for the pension program.
Indonesia Power has also made projections for employees who will retire in the next 5 and 10 years, which are described in the tables below:
230 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Proyeksi Jumlah Pegawai Pensiun dalam 5 Tahun ke Depan [EU15]Projected Total Number of Retired Employees in the Upcoming 5 Years [EU15]
Unit KerjaWorking Unit
Jenis Kelamin Gender Tingkat Jabatan Level Bidang Field
Pria Male
WanitaFemale
JumlahTotal
Eksekutif Utama
Chief Ex-ecutive
Eksekutif SeniorSenior Execu-
tive
Eksekutif Execu-
tive
Penyelia AtasHead
Supervi-sor
Penyelia Dasar
Supervi-sor
Pelak-sana
Practi-tioner
JumlahTotal
TeknikTechni-
cal
Non Teknik
Non Techni-
cal
JumlahTotal
Head Office 51 10 61 7 22 17 11 4 - 61 39 22 61
Suralaya PGU 95 6 101 1 - 2 22 44 32 101 79 22 101
Priok POMU 25 4 29 - - - 10 11 8 29 18 11 29
Saguling POMU
26 3 29 - 1 1 11 9 7 29 23 6 29
Kamojang POMU
18 1 19 - - 1 5 6 7 19 19 - 19
Semarang PGU 15 0 15 - - 1 9 2 3 15 11 4 15
Mrica PGU 27 1 28 - 1 2 5 10 10 28 21 7 28
Grati POMU 4 2 6 - - - 4 1 1 6 3 3 6
Bali PGU 25 - 25 - - 2 9 9 5 25 20 5 25
MSU 12 - 12 1 2 2 7 - - 12 11 1 12
PLTU SPP Banten 1 Suralaya OMU
6 - 6 - - 0 5 1 - 6 5 1 6
PLTU SPP Banten 2 Labuan OMU
8 - 8 - - 3 3 2 - 8 7 1 8
PLTU SPP Banten 3 Lontar OMU
8 - 8 - - - 8 - - 8 7 1 8
PLTU SPP Jawa Barat 2 Pelabuhan Ratu OMU
6 - 6 - - 1 5 - - 6 6 - 6
PLTU SPP Jawa Tengah 2 Adipala OMU
9 - 9 - - 1 7 1 - 9 9 - 9
PLTGU CCPP Cilegon OMU
1 - 1 - - 1 0 - - 1 1 - 1
Holtekamp POMU
1 - 1 - - - 1 - - 1 1 - 1
PLTU SPP Jeranjang OMU
1 - 1 - - - 1 - - 1 - 1 1
PLTU SPP Pangkalan Susu OMU
1 - 1 - - 1 - - - 1 - 1 1
Project Unit 2 - 2 1 - 1 - - - 2 1 1 2
Jumlah Total 341 27 368 10 26 36 123 100 73 368 281 87 368
Pemenuhan Hak-Hak PegawaiFulfillment of Employee Rights
231 Sustainability Report 2019
PT Indonesia Power
Soci
al
Proyeksi Jumlah Pegawai Pensiun dalam 10 Tahun ke Depan [EU15]Projected Total Number of Retired Employees in the Upcoming 10 Years [EU15]
Unit KerjaWorking Unit
Jenis Kelamin Gender Tingkat Jabatan Level Bidang Field
Pria Male
WanitaFemale
JumlahTotal
Eksekutif Utama
Chief Ex-ecutive
Eksekutif SeniorSenior Execu-
tive
Eksekutif Execu-
tive
Penyelia AtasHead
Supervi-sor
Penyelia Dasar
Supervi-sor
Pelak-sana
Practi-tioner
JumlahTotal
TeknikTechni-
cal
Non Teknik
Non Techni-
cal
JumlahTotal
Head Office 112 22 134 8 43 49 28 6 0 134 71 63 134
Suralaya PGU 160 10 170 1 1 5 45 75 43 170 135 35 170
Priok POMU 87 7 94 1 1 2 28 34 28 94 67 27 94
Saguling POMU
43 5 48 - 1 3 24 11 9 48 35 13 48
Kamojang POMU
108 4 112 - 1 3 32 39 37 112 91 21 112
Semarang PGU 53 3 56 - 1 1 26 19 9 56 44 12 56
Mrica PGU 50 8 58 - 1 3 15 21 18 58 38 20 58
Grati POMU 31 6 37 - - 1 25 7 4 37 23 14 37
Bali PGU 71 - 71 - 1 3 25 31 11 71 53 18 71
MSU 38 5 43 1 3 14 21 3 1 43 36 7 43
PLTU SPP Banten 1 Suralaya OMU
14 - 14 - 1 2 9 2 - 14 11 3 14
PLTU SPP Banten 2 Labuan OMU
19 - 19 - 1 4 12 2 - 19 17 2 19
PLTU SPP Banten 3 Lontar OMU
16 - 16 - - 2 14 - - 16 13 3 16
PLTU SPP Jawa Barat 2 Pelabuhan Ratu OMU
13 - 13 - - 2 10 1 - 13 11 2 13
PLTU SPP Jawa Tengah 2 Adipala OMU
16 - 16 - - 2 10 4 - 16 13 3 16
PLTU SPP Pangkalan Susu OMU
1 - 1 - - 1 - - - 1 - 1 1
PLTGU CCPP Cilegon OMU
6 - 6 - - 2 4 - - 6 5 1 6
Holtekamp POMU
1 - 1 - - - 1 - - 1 1 - 1
PLTU SPP Jeranjang OMU
3 - 3 - - - 3 - - 3 2 1 3
Project Unit 6 - 6 1 - 3 2 - - 6 5 1 6
PLTU SPP Barru OMU
2 - 2 - - 1 1 - - 2 2 - 2
PLTU SPP Sintang OMU
- - 0 - - - - - - - - - -
Jumlah Total 850 70 920 12 55 103 337 256 160 920 673 247 920
232 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Proyeksi Jumlah Pekerja yang Akan Memasuki Masa PensiunDalam 5-10 Tahun Ke Depan Berdasarkan Kategori Pekerjaan [EU15]Projected Number of Employees Entering Retirement in the Upcoming 5-10 Years by Work Category [EU15]
Kategori PekerjaanWork Category
Jumlah Pegawai
Employees
Proyeksi Jumlah Pegawai PensiunProjected Number of Retired Employees
5 Tahun Ke DepanThe next 5 years
10 Tahun Ke DepanThe next 10 years
Jumlah Pegawai PensiunNumber
of Retired Employees
%
Jumlah Pegawai PensiunNumber
of Retired Employees
%
Non Teknik Non-Technical 341 94 27,57% 247 72,43%
Teknik Technical 947 274 28,93% 673 71,07%
- Audit 23 9 39,13% 14 60,87%
- K3 OHS 41 16 39,02% 25 60,98%
- Kajian dan Optimalisasi Review and Optimization
263 84 31,94% 179 68,06%
- Mutu, Kinerja dan Risiko Quality, Performance, and
Risks
6 2 33,33% 4 66,67%
- Operasi Operations 254 65 25,59% 189 74,41%
- Pemeliharaan Maintenance 218 60 27,52% 158 72,48%
- Pengembangan Usaha Business Development
10 2 20,00% 8 80,00%
- Supply Chain Management 12 1 8,33% 11 91,67%
- Tata Niaga Listrik Electricity Commerce
20 4 20,00% 16 80,00%
- Technical Support 100 31 31,00% 69 69,00%
Jumlah Total 1.288 368 28,57% 920 71,43%
Pemenuhan Hak-Hak PegawaiFulfillment of Employee Rights
233 Sustainability Report 2019
PT Indonesia Power
Soci
al
234 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al Pendekatan Manajemen Topik Kepegawaian terkait Pelatihan dan Pendidikan [GRI 103-1, 103-2, 103-3]Management Approach to Employment related toTraining and Education [GRI 103-1, 103-2, 103-3]
Pelatihan dan Pendidikan adalah topik penting bagi Indonesia Power untuk membina SDM yang andal dalam rangka pencapaian kinerja ekselen. Untuk itu Indonesia Power memberikan perhatian besar pada pengelolaan dan pengembangan kompetensi SDM agar mampu mendukung kinerja operasional secara maksimal dan menjadi competitive advantage Perusahaan. Training and Education are important topics for Indonesia Power to foster reliable HR in achieving excellent performance. Therefore, Indonesia Power heavily focuses on the HR competence Development and management to support the operational performance optimally in order to be the Company’s competitive advantage.
Kebijakan Perusahaan• Surat Keputusan Direksi Nomor 38.K/010/IP/2009 tentang Sistem
Manajemen Sumber Daya Manusia berbasis Kompetensi• Surat Keputusan Direksi Nomor 50.K/010/IP/2011 tentang Sistem
Pembelajaran Pegawai• Surat Keputusan Direksi Nomor 80.K/010/IP/2012 tentang Sistem
Manajemen Kinerja Pegawai• Surat Keputusan Direksi Nomor 186.K/010/IP/2012 tentang Perubahan atas
Keputusan Direksi Nomor 38.K/010/IP/2009 tentang Sistem Manajemen Sumber Daya Manusia berbasis Kompetensi
• Surat Keputusan Direksi Nomor 144.K/010/IP/2018 tentang Sistem Pembinaan Kompetensi dan Karir Pegawai
• Surat Keputusan Direksi Nomor 111.K/010/IP/2017 tentang Diklat Prajabatan
• Surat Keputusan Direksi Nomor 144.K/010/IP/2018 tentang Sistem Manajemen Kinerja Pegawai
• Surat Keputusan Direksi Nomor 111.K/010/IP/2017 tentang Sistem Tugas Karya
• Surat Keputusan Direksi Nomor 017.K/010/IP/2019 tentang Sistem Expertise Operasi, Pemeliharaan dan Enjiniring
• Surat Keputusan Direksi Nomor 048.K/010/IP/2019 tentang Struktur Profesi di Lingkungan PT Indonesia Power
• Surat Keputusan Direksi Nomor 062.K/010/IP/2019 tentang Direktori Kompetensi Bidang dan Kebutuhan Kompetensi Jabatan
• Surat Keputusan Direksi Nomor 231.K/010/IP/2019 tentang Sistem Manajemen Talenta
• PKB Bab IV Pembinaan dan Pengembangan Pegawai pasal 22 tentang Pendidikan dan Pelatihan
Ketentuan Umum• Undang-undang Republik Indonesia Nomor 30 Tahun 2009 tentang
Ketenagalistrikan Bab XI Lingkungan Hidup dan Keteknikan Pasal 44 Ayat (6) “Setiap tenaga teknik dalam usaha ketenagalistrikan wajib memiliki sertifikat kompetensi”
• Keputusan Direktur Jenderal Pembinaan Hubungan Industrial dan Pengawasan Ketenagakerjaan Nomor Kep-311/BW/2002
Company’s Policies:• Board of Directors’ Decree No. 38.K/010/IP/2009 on the Competency-Based
Human Resources Management System• Board of Directors’ Decree No. 50.K/010/IP/2011 on the Employee Learning
System• Board of Directors’ Decree No. 80.K/010/IP/2012 on the Employee
Performance Management System• Board of Directors’ Decree No. 186.K/010/IP/2012 on Amendment to the
Board of Directors’ Decree No. 38.K/010/IP/2009 on the Competency-Based Human Resources Management System
• Board of Directors’ Decree No. 144.K/010/IP/2018 on the Employee Competency Development and Career System
• Board of Directors’ Decree No. 111.K/010/IP/2017 on the Pre-service Training
• Board of Directors’ Decree No. 144.K/010/IP/2018 on the Employee Performance Management System
• Board of Directors’ Decree No. 111.K/010/IP/2017 on the Work Duties System
• Board of Directors’ Decree No. 017.K/010/IP/2019 on the System Expertise of Operation, Maintenance, and Engineering
• Board of Directors’ Decree No. 048.K/010/IP/2019 on the Professional Structure within PT Indonesia Power
• Board of Directors’ Decree No. 062.K/010/IP/2019 on the Field Competence Directory and Positions Competency Requirement
• Board of Directors’ Decree No. 231.K/010/IP/2019 on the Talent Management System
• CLA Chapter IV Employee Development and Mentoring article 22 on the Education and Training
General Provisions:• Law of the Republic of Indonesia No. 30 of 2009 on the Electricity Chapter
XI Environment and Engineering Article 44 Paragraph (6) “Every technical person in the electricity business must have a competency certificate”
• Decree of the Director General of Industrial Relations Development and Labor Inspection No. Kep-311/BW/2002
KebijakanPolicy
Pemenuhan Hak-Hak PegawaiFulfillment of Employee Rights
235 Sustainability Report 2019
PT Indonesia Power
Soci
al
Mengelola pengembangan kompetensi dengan berbasis kinerja dengan ukuran kesiapan human capital
Managing performance-based competency development by assessing the human capital readiness
Skor kesiapan human capital (Human Capital Readiness - HCR) adalah 4,45 (skala 5).
Human Capital Readiness (HCR) score is 4.45 (out of 5).
Realiasasi akhir tahun skor HCR adalah 4,45.
The realization of HCR at the end of the year is 4.45.
KomitmenCommitment
RealisasiRealization
Sasaran dan TargetGoals and Targets
• Peningkatan Kapabilitas Problem Solving dalam Permasalahan Pembangkit yang Berulang (Kronis);
• Pengembangan Kompetensi SDM Bidang Business Development Excellence (BDE);
• Akselerasi Kompetensi Operation Maintenance Excellence (OME) di IP Group;
• Program IP PINTAR (Program Internship, Asesmen dan Sertifikasi);
• Pembentukan Maintenance Learning Centre; dan
• Pembentukan Centre of Excellence Pemaron.
• Improvement of Problem-Solving Capabilities in Chronic Generating Problems;
• HR Competencies Development in the Business Development Excellence (BDE);
• Acceleration of Operation Maintenance Excellence (OME) Competencies in the IP Group;
• IP PINTAR (Internship, Assessment, and Certification Program) Program;
• Establishment of Maintenance Learning Center; and
• Establishment of Pemaron Center of Excellence.
Program/InisiatifProgram/Initiative
• Vice President of Human Capital and Change Management
• Vice President of Human Capital Development
• Vice President of Talent Management
• Vice President of Human Capital and Change Management
• Vice President of Human Capital Development
• Vice President of Talent Management
• Penilaian Kinerja dan Pengembangan Karir
• Pelaksanaan Survei HRSE• Penanganan Pengaduan Pegawai
• Performance Assessment and Career Development
• HRSE Survey • Employee Complaint
Management
EvaluasiEvaluation
Penanggung JawabPerson in Charge
236 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Sejalan dengan upaya untuk menciptakan sumber daya manusia yang mumpuni dan kapabel dibidangnya demi tercapainya kinerja ekselen, Indonesia Power melakukan pengembangan pegawai melalui berbagai program pendidikan dan pelatihan. Sejak tahun 2018, Indonesia Power telah meluncurkan program IP Academy yang menjadi wadah untuk mempersiapkan sumber daya manusia yang tidak hanya kompeten, tetapi juga profesional. Dengan mengusung visi “Menjadi Pusat Pengembangan Expertise dan Centre of Excellence di bidang operasi, pemeliharaan dan pengembangan pembangkit listrik”, IP Academy pun menjadi sebuah pusat pembelajaran yang terintegrasi sehingga dapat menjawab beragam persoalan terkait kinerja korporat sekaligus sebagai complementary dari PLN Corporate University.
Konsep pembelajaran yang diterapkan IP Academy adalah pembelajaran berdasarkan learning value chain dengan metode In Class Training (ICT), Tatap Muka, seperti Focus Group Discussion (FGD), Case Study, Active Debate dan Role Playing, serta E-Learning berbasis website dan mobile.
Kemudian, untuk mewujudkan proses pembelajaran yang dapat memberikan dampak pada peningkatan kinerja Perusahaan, maka ditetapkan House of IP Academy yang memiliki tujuh School. Masing-masing school dipimpin oleh Vice Dean sebagai Head of School.
Pursuant to the efforts to create qualified and capable human resources in their fields for excellent performance, Indonesia Power develops employees through various education and training programs. Since 2018, Indonesia Power has launched the IP Academy program as a forum to prepare human resources who are not only competent, but also professional. By having the vision of “Becoming a Center for Expertise Development and Center of Excellence in the operation, maintenance, and development of power plants”, IP Academy has become an integrated learning center to answer various issues related to corporate performance as well as a complementary of PLN Corporate University.
he IP Academy applies learning concept based on learning value chain with In-Class Training (ICT), Conservative Face-to-face methods, such as Focus Group Discussion (FGD), Case Study, Active Debate, and Role Playing, as well as website and mobile-based E-Learning.
The House of IP Academy has seven Schools to actualize the learning process to impact on enhancing the Company’s performance. Each school is led by Vice Dean as the Head of School.
Pengembangan Kompetensi dan Keahlian Pegawai [GRI 404-2] Employees’ Competence Development and Expertise [GRI 404-2]
Roadmap IP AcademyIP Academy Roadmap
2018 2019 2020 2021 2022
Readiness IP Academy
(early performance)
Corporate Performance
Booster(good performance)
Corporate Performance
Alignment (early result)
Centre of Excellence in
Learning (emerging learning leader)
Extraordinary in Learning
(benchmark leader)
237 Sustainability Report 2019
PT Indonesia Power
Soci
al
Tujuh School IP Academy beserta Head Of SchoolSeven IP Academy Schools and Head of School
Corporate Strategic Initiative School
Business Enabler School
Power Plant Operation Excellence
School
Health, Safety, Environment (HSE) School
BusinessDevelopment
School
Power Plant Engineering Excellence
School
Power Plant Maintenance
Excellence School
Vice DeanDirektur SDM dan AdministrasiDirector of HR and AdministrationOkto Rinaldo Sagala
Vice DeanDirektur Operasi IDirector of Operations IM. Hanafi Nur Rifai
Vice DeanDirektur KeuanganDirector of Finance
Susy Liestiowaty
Vice DeanDirektur Operasi IDirector of Operations IM. Hanafi Nur Rifai
Vice DeanDirektur Pengembangan
dan NiagaDirector of Development
and CommerceAdi Supriono
Vice DeanDirektur Operasi IIDirector of Operations IIBambang Anggono
Vice DeanDirektur Operasi II
Director of Operations IIBambang Anggono
School PenjelasanDescription
Realisasi Pelatihan 2019
Training in 2019
Realisasi Jumlah Peserta 2019Participants in
2019
Power Plant OperationExcellence School (POE School)
Pusat pembelajaran bidang operasi pembangkitCenter for power plant operation learning
19 271
Power Plant MaintenanceExcellence School (PME School)
Pusat pembelajaran bidang pemeliharaan peralatan sistem mekanik pembangkit, instalasi listrik PembangkitCenter for learning of power plant mechanical system and Plant electricity installations
41 591
Health Safety,Environment School (HSE School)
Pusat pembelajaran bidang Health, Safety & EnvironmentCenter of learning in the field of Health, Safety, and Environment
41 1.019
Realisasi Pembelajaran IP Academy Tahun 2019 [GRI 404-2, EU14]IP Academy Learning in 2019 [GRI 404-2, EU14]
238 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Pengembangan Kompetensi dan Keahlian Pegawai [GRI 404-2]Employees’ Competence Development and Expertise [GRI 404-2]
Centre of Excellence (COE) merupakan fasilitas pembelajaran IP Academy yang menjadi pusat pembelajaran terintegrasi dan sinergik yang mendukung Kompetensi Inti Perusahaan. Beberapa COE yang telah dibangun antara lain Centre of Excellence Fire and Safety Academy, Maintenance Centre, Pemaron Centre of Excellence, Kamojang Centre of Excellence, Lontar Centre of Excellence, Labuan Learning Unit, Pangkalan Susu Learning Unit dan Adipala Learning Unit.
Excellence Fire and Safety Academy
Lontar Centre of Excellence
Kamojang Centre of Excellence
Pemaron Centre of Excellence
Maintenance Centre
Labuan Learning Unit, Pangkalan Susu Learning Unit dan Adipala Learning Unit
The Center of Excellence (COE) is an IP Academy learning facility as an integrated and synergistic learning center to support the Company’s Core Competencies. Several COEs have been established, i.e. Center of Excellence Fire and Safety Academy, Maintenance Center, Pemaron Center of Excellence, Kamojang Center of Excellence, Lontar Center of Excellence, Labuan Learning Unit, Pangkalan Susu Learning Unit, and Adipala Learning Unit.
Centre of ExcellenceCentre of Excellence
School PenjelasanDescription
Realisasi Pelatihan 2019
Training in 2019
Realisasi Jumlah Peserta 2019Participants in
2019
Power Plant EngineeringExcellence School (PEE School)
Pusat pembelajaran di bidang enjineering pembangkitCenter for power plant engineering learning
29 839
Business DevelopmentExcellence School (BDE School)
Pusat pembelajaran di bidang perencanaan dan pengembangan bisnis korporatThe center of learning corporate business planning and development
9 189
Business EnablerSchool (BEN School)
Pusat pembelajaran terkait dengan pemenuhan kebutuhan kompetensi penunjang bisnis di Indonesia PowerThe center of learning related to meeting the needs of business support competencies in Indonesia Power
53 1.283
Corporate StrategicInitiative School (CSI School)
Pusat pembelajaran dalam pengembangan kompetensi pegawai untuk seluruh proses bisnis yang bersifat korporatThe center of learning in developing employee competencies for all corporate business processes
36 1.254
239 Sustainability Report 2019
PT Indonesia Power
Soci
al
Center of Excellence PenjelasanDescription
Realisasi pelaksanaan programProgram realization
Pembangunan Center of ExcellenceCenter of Excellence Construction
Fire & Safety Academy Pusat pelatihan, asessment dan konsultasi bidang K3, PMK dan Low Rank Coal bertempat di Pandean Lamper SemarangThe center of training, assessment, and consultation in the OHS, PMK, and Low-Rank Coal is located at Pandean Lamper Semarang
100%
Maintenance Centre Pusat pelatihan, asessment dan konsultasi bidang pemeliharaan pembangkit bertempat di SemarangThe center of training, assessment, and consultation in the power plant maintenance is located in Semarang
100%
Pemaron Centre of Excellence
Pusat pelatihan enjiniring bertempat di Pemaron BaliThe engineering training center is located in Pemaron Bali
80%
Kamojang Centre of Excellence
Pusat pelatihan di bidang Geothermal guna meningkatkan daya saing dan memajukan pengembangan panas bumi sebagai energi terbarukanThe Geothermal training center to increase competitiveness and advance the development of geothermal energy as a renewable energy
0%(tahun 2019 berfokus pada pembangunan infrastruktur penunjang berupa renovasi ruangan)(In 2019, the focus is on constructing supporting infrastructure, i.e. renovating rooms)
Lontar Centre of Excellence
Pelatihan dan percontohan dalam implementasi di bidang K3 di PerusahaanTraining and pilot project in the OHS field in the Company
0%(tahun 2019 berfokus pada pembangunan infrastruktur dan pengayaan materi ajar)0%(In 2019, the focus is on constructing supporting infrastructure and enriching teaching materials)
Labuan Learning Unit, Pangkalan SusuLearning Unit, Adipala Learning Unit
Pusat pembelajaran di bidang operasi PLTU dengan dukungan simulator PLTUThe center of learning in SPP operations with SPP simulators
100%
Rencana program Pembangunan COE ke depanCOEs Development program in the future
Optimalisasi COE yang sudah ada dan memperbaiki COE yang belum diresmikanOptimizing existing COEs and improving COEs that has not yet been inaugurated
240 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Program akselerasi kompetensi merupakan program persiapan tenaga ahli baru yang mampu mengoperasikan dan memelihara pembangkit-pembangkit baru guna menunjang upaya Perusahaan dalam mendukung Program 35.000 MW yang dicanangkan Pemerintah. Program yang dimulai sejak tahun 2016 ini, diyakini menjadi cara terbaik untuk membekali segenap pegawai Indonesia Power dengan kompetensi di bidang pembangkitan dalam waktu 2-3 tahun, dari waktu yang dibutuhkan untuk menguasai kompetensi pembangkitan tersebut sekitar 5-6 tahun. Metode pembelajaran yang digunakan adalah In Class Training sebesar 30% dan On the Job Training sebesar 70%.
Program akselerasi bidang operasi maupun bidang pemeliharaaan terbagi menjadi 3 level, yang terdiri dari 132 modul pembelajaran, dengan fasilitas 4 simulator PLTU (3 simulator subcritical boiler dan 1 simulator supercritical boiler) yang tersebar di 4 lokasi yang berbeda.
Untuk membangun organisasi yang lebih profesional, Indonesia Power juga memfasilitasi pegawai untuk mendapatkan kualifikasi profesional melalui jalur pendidikan formal dengan program beasiswa. Program ini diberikan oleh Perusahaan kepada pegawai sebagai bentuk penghargaan atas kontribusi nyata kepada perusahaan. Dengan bekerjasama dengan Lembaga pendidikan Tinggi yang berkualitas dan berkompeten dalam mengajarkan bidang ilmu sesuai kebutuhan Perusahaan, serta memenuhi ketentuan yang berlaku membuat program ini menjadi program yang sangat baik untuk meningkatkan kompetensi Pegawai yang sesuai dengan kebutuhan Perusahaan. Pada tahun 2019, jumlah pegawai yang menerima program beasiswa ini sebanyak 46 orang pegawai.
The competency acceleration program is a preparation program for new experts who can operate and maintain new power plants to bolster the Company’s efforts in supporting the 35,000-MW Program of the Government. The program, which began in 2016, is believed to be the best way to equip all Indonesia Power’s employees with competencies in the generation sector within 2-3 years, from the normal time needed to master the generation competencies of 5-6 years. The method is 30% In-Class Training and 70% On the Job Training.
The acceleration program of the operation and maintenance fields is divided into 3 levels, consisting of 132 learning modules, with 4 SPP simulators (3 subcritical boiler simulators and 1 supercritical boiler simulator) spread throughout 4 different locations.
Indonesia Power facilitates employees to obtain professional qualifications through formal education through scholarship to establish a more professional organization. This program is provided by the Company to employees as a form of appreciation for the employees’ tangible contributions to the Company. This program is an excellent program to improve employee competencies in accordance with the Company’s needs by cooperating with qualified and competent Higher Education Institutions in teaching knowledge according to the Company’s needs, as well as meeting the prevailing regulations. In 2019, 46 employees received the scholarship.
Akselerasi Percepatan Kompetensi Operasi dan PemeliharaanAcceleration of Operational and Maintenance Competencies
Pendidikan FormalFormal Education
Akselerasi Percepatan Kompetensi Operasi dan Pemeliharaan [GRI 404-2, EU14]Acceleration of Operational and Maintenance Competencies [GRI 404-2, EU14]
Program
2019
Bidang Operasi Operations
Bidang Pemeliharaan Maintenance
Jumlah PesertaParticipant
Jumlah PelatihanTraining
Jumlah PesertaJumlah Peserta
Jumlah PelatihanTraining
Program Akselerasi Percepatan Kompetensi Bidang Operasi dan Pemeliharaan PembangkitPower Plant Operational and Maintenance Competencies Acceleration Program
402 35 591 38
Pengembangan Kompetensi dan Keahlian Pegawai [GRI 404-2]Employees’ Competence Development and Expertise [GRI 404-2]
241 Sustainability Report 2019
PT Indonesia Power
Soci
al
Selain dengan pelatihan, program akselerasi kompetensi dan pendidikan formal diatas, Indonesia Power juga memastikan tersedianya tenaga kerja yang terampil dalam bidang ketenagalistrikan melalui program sertifikasi yang bekerjasama dengan lembaga sertifikasi. Jenis sertifikasi yang dilakukan terdiri dari:
In addition to training, competency acceleration programs, and formal education mentioned above, Indonesia Power ensures the availability of skilled workers in the electricity sector through a certification program in collaboration with certification bodies. The type of certification carried out consists of:
Sertifikasi Certification
Program Sertifikasi Tahun 2019 [GRI 404-2, EU14]Certification in 2019 [GRI 404-2, EU14]
Jenis SertifikasiType of Certification
Jumlah Total
1. Sertifikasi Kompetensi Tenaga Teknik Ketenagalistrikan meliputi Sertifikasi Baru dan Sertifikasi Perpanjangan Bidang Operasi dan Pemeliharaan
Electrical Engineering Competency Certification, covering New and Renewed Operations and Maintenance Certifications
731
2. Sertifikasi K3 & Lingkungan HSE Certification
2.1. Pelatihan Life Cycle Assessment Proper Proper Assessment Life Cycle Training 45
2.2. Pelatihan & Sertifikasi Manajemen Pengelolaan Sampah/Limbah Non B3 Non-Toxic and Hazardous Waste Management Training and Certification
35
2.3. Pelatihan & Sertifikasi Pengelolaan Limbah Bahan Berbahaya dan Beracun (B3) Toxic and Hazardous Waste Management Training and Certification
27
2.4. Pelatihan & Sertifikasi Pengendalian Pencemaran Air Water Pollution Control Training and Certification
39
2.5. Pelatihan & Sertifikasi Pengendalian Pencemaran Udara Air Pollution Control Training and Certification
35
2.6. Pelatihan & Sertifikasi Pencegahan & Penanggulangan Kebakaran Kelas A Fire Prevention and Management Training and Certification Class A
12
2.7. Pelatihan & Sertifikasi Pencegahan & Penanggulangan Kebakaran Kelas B Fire Prevention and Management Training and Certification Class B
20
2.8. Pelatihan & Sertifikasi Pencegahan & Penanggulangan Kebakaran Kelas C Fire Prevention and Management Training and Certification Class C
40
2.9. Pelatihan & Sertifikasi Pencegahan & Penanggulangan Kebakaran Kelas D Fire Prevention and Management Training and Certification Class D
142
2.10. Pelatihan & Sertifikasi Ahli K3 Umum General HSE Expert Training and Certification 25
2.11. Pelatihan & Sertifikasi Petugas P3K First Aid Officer Training and Certification 42
3. Sertifikasi Keahlian Expertise Certification
3.1. Boiler Inspector Level 1 24
3.2. Integrated Solar Photovoltaic (PV) System Designer 5
3.3. IPSCM (International Purchasing and Supply Chain Management) 9
3.4. ISO Vibration & Certification Category I 7
3.5. Sertifkasi Juru Ikat (Rigger) Rigger Certification 5
3.6. Training dan Sertifikasi Welding Inspector Welding Inspector Training and Certification 16
3.7. ISO Vibration & Certification Category II 3
3.8. Training dan Sertifikasi Machinery Lubricant Analysis Level 1 Machinery Lubricant Analysis Training and Certification Level 1
5
3.9. Certified Learning Technologist 8
3.10. Certified Supply Chain Analyst (CSCA) 3
3.11. Certified HR Manager 12
242 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Jenis SertifikasiType of Certification
Jumlah Total
3.12. Certified Trafo & Generator Diagnose 4
3.13. Setifikasi Welding Engineer Welding Engineer Certification 16
Dari pelaksanaan sertifikasi di atas, Sertifikasi Kompetensi Tenaga Teknik Ketenagalistrikan diwajibkan Perusahaan untuk setiap pegawai Operasi dan Pemeliharaan mengacu pada Peraturan Menteri ESDM Nomor 10 Tahun 2016 pasal 25 tentang Tata Cara Akreditasi dan Sertifikasi Ketenagalistrikan bahwa setiap tenaga teknik ketenagalistrikan yang bekerja pada usaha ketenagalistrikan wajib memiliki Sertifikat Kompetensi. Untuk pelaksanaan sertifikasi lainnya bersifat non mandatory. Pelaksanaan program Sertifikasi Kompetensi di tahun 2019 dapat dilihat pada tabel berikut:
Out of the above certification, the Company requires every Operation and Maintenance employee to have the Electricity Engineering Certificate of Competency with reference to the Minister of EMR Regulation No. 10 of 2016 article 25 on Procedures for the Accreditation and Certification of Electricity that stipulates every electrician working in the electricity business must have an Electricity Engineering Certificate of Competency. Other certifications are non-mandatory. The Competency Certification in 2019 can be seen in the following table:
Program Sertifikasi Kompetensi Competency Certification Program
UkuranSize
2019
Target RealisasiRealization
PencapaianAchievement
Sertifikasi BaruNew Certificate
Jumlah PegawaiNumber of Employees
725 725 100%
Jumlah Unit KompetensiTotal Competency Unit
725 725 100%
Sertifikasi PerpanjanganSertifikasi Perpanjangan
Jumlah PegawaiNumber of Employees
6 6 100%
Jumlah Unit KompetensiTotal Competency Unit
6 6 100%
Program Sertifikasi Kompetensi Tahun 2019Competency Certification Program in 2019
Sejak tahun 2018, Indonesia Power telah menginisiasi untuk membangun sebuah komunitas keahlian pembangkitan di lingkungan Perusahaan yang disebut dengan Community of Expertise (ComEt). Dengan adanya kebutuhan Perusahaan untuk terus tumbuh dan berkembang, di tengah perkembangan teknologi dan kapasitas pembangkit maka perlu didukung dengan Human Capital Excellence.
Indonesia Power meyakini bahwa dengan transformasi Human Resources menjadi Human Capital yang berfokus pada Community of Expertise (ComEt) akan mampu menjawab tantangan perkembangan teknologi kelistrikan yang sangat cepat di era VUCA (Volatility, Uncertainty, Complexity and Ambiguity), yang bisa menjadi suatu ancaman namun juga bisa menjadi sebuah peluang.
Since 2018, Indonesia Power has initiated to establish a community of generating expertise within the Company called the Community of Expertise (ComEt). As the Company needs to continue to grow and develop in the midst of technological developments and generating capacity, the Human Capital Excellence is required to support the Company.
Indonesia Power believes that the transformation of Human Resources into Human Capital with focus on Community of Expertise (ComEt) shall answer the challenges of the rapid development of electricity technology in the era of VUCA (Volatility, Uncertainty, Complexity, and Ambiguity), which can be a threat while simultaneously is an opportunity.
Community of Expertise 2.0 [GRI 404-2, EU14]Community of Expertise 2.0 [GRI 404-2, EU14]
Pengembangan Kompetensi dan Keahlian Pegawai [GRI 404-2]Employees’ Competence Development and Expertise [GRI 404-2]
243 Sustainability Report 2019
PT Indonesia Power
Soci
al
Pengembangan SDM pada Era Revolusi Industri 4.0HR Development in the 4.0 Industrial Revolution
Industri di era 4.0 menghadapkan perusahaan pada berbagai tantangan bisnis. Bergerak dinamis, mengikuti alur perubahan, adalah kunci untuk menjaga keberlanjutan bisnis perubahan. Maka, sebagai salah satu pelaku industri di sektor yang sangat strategis—yakni sektor kelistrikan, Indonesia Power pun melangkah dinamis dengan melakukan digitalisasi proses bisnis. Transformasi digital pun menjadi kendaraan yang membawa Indonesia Power lebih dekat dengan impiannya: Menjadi perusahaan pembangkit tepercaya yang menerangi hingga ke pelosok negeri.
Sejak beberapa tahun terakhir, Indonesia Power secara aktif mengembangkan berbagai inovasi, khususnya inovasi yang memanfaatkan Teknologi Informasi dan Komunikasi (TIK). Inovasi dihadirkan dalam rupa program-program aplikasi, baik web-based maupun mobile based. Salah satu tujuannya adalah menghadirkan tools yang menunjang proses bisnis perusahaan sehingga berjalan efektif dan efisien serta dapat membantu dan mempermudah insan Perusahaan dalam mencapai target.
In the midst of the 4.0 era industry, the Company is confronted with various business challenges. Moving dynamically and following the path of change are the keys to maintaining the business of change. As one of the industry players in a very strategic sector, i.e. the electricity sector, Indonesia Power is moving dynamically by digitizing business processes. Digital transformation brings Indonesia Power closer to its dream: To be a trusted generation company that illuminates the whole country.
In the last few years, Indonesia Power has actively developed various innovations, especially innovations that utilize Information and Communication Technology (ICT). The innovations are in the form of application programs, both web-based and mobile-based. One of the objectives is to present tools that support the Company’s business processes to run effectively and efficiently, and to assist and facilitate the Company’s personnel in achieving their targets.
2017 2018 2019
Sertifikasi Expertise Sertifikasi Expertise 37 122 8
- Spesialis/Ahli level 4 - Level 4 Specialist/Expert 23 90 9
- Spesialis/Ahli level 5 - Level 4 Specialist/Expert 8 11 -
- Spesialis/Ahli level 6 - Level 4 Specialist/Expert 18 1 -
- Spesialis/Ahli level 7 - Level 4 Specialist/Expert 1 - -
- Spesialis/Ahli level 8 - Level 4 Specialist/Expert 6 6 -
Community of Expertise [GRI 404-2, EU14]Community of Expertise [GRI 404-2, EU14]
244 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
1. IPKU - Indonesia Power dalam GenggamanKU
Aplikasi mobile based yang menyediakan semua layanan terintegrasi di PT Indonesia Power hanya dalam satu platform. Beberapa layanan antara lain aplikasi mobile based absensi dan informasi terkait kepegawaian.
2. INPACT (Indonesia Power ACTion) Light Up
Wadah eksistensi dan interaksi antarpegawai dalam beraktivitas sesuai nilai perusahaan.
3. Digital Learning Teknologi pembelajaran secara digital
yang diterapkan Indonesia Power Academy yang dikemas secara interaktif dengan memanfaatkan software dan hardware secara online maupun offline, antara lain Webinar, Video Conference, Virtual Learning, Video Learning, Social Learning dan Gamification.
4. IP STAR Aplikasi untuk melakukan manajemen
talent, assessment dan karir pegawai.
5. IP-Pro Inventory Aplikasi untuk mempercepat dan
mempermudah kegiatan inventori oleh bidang terkait tak terbatas ruang dan waktu.
6. IP-DIGIMONX (Digitalized Mobile on Work Execution)
Mendukung pilar Work Planning and Control (WPC) pada Asset Management, khususnya saat Work Order Execution, dimulai dari penunjukan lead, teknisi, permintaan work permit, pengisian actual WO, hingga perubahan status WO menjadi WDONE.
1. IPKU - Indonesia Power dalam GenggamanKU
A mobile-based application that provides all integrated services of PT Indonesia Power in one platform. Some services include mobile-based attendance application and information related to staffing.
2. INPACT (Indonesia Power ACTion) Light Up
Forum of existence and interaction between employees in their activities in line with the Company’s values.
3. Digital Learning Digital learning technology applied by
Indonesia Power Academy, packaged interactively by utilizing online and offline software and hardware, including Webinars, Video Conferences, Virtual Learning, Video Learning, Social Learning, and Gamification.
4. IP STAR Application to conduct talent management,
assessment, and employee career.
5. IP-Pro Inventory Application to accelerate and facilitate
inventory by related fields without being limited to space and time.
6. IP-DIGIMONX (Digitalized Mobile on Work Execution)
Supporting the Work Planning and Control (WPC) of Asset Management, especially during Work Order Execution, starting from the appointment of leads, technicians, work permit requests, actual WO, to changing the status of WO to WDONE.
Pengembangan Kompetensi dan Keahlian Pegawai [GRI 404-2]Employees’ Competence Development and Expertise [GRI 404-2]
Program berbasis TeknologiTechnology-based Program
245 Sustainability Report 2019
PT Indonesia Power
Soci
al
Pendidikan dan pelatihan yang diselenggarakan Perusahaan ditujukan untuk memenuhi kebutuhan kompetensi karyawan pada posisi tertentu. Jenis pendidikan dan pelatihan yang diselenggarakan terdiri dari:1. Diklat Seleksi Pegawai Baru, untuk membina memantau,
mengevaluasi dan menyeleksi tenaga kerja potensial yang mampu memenuhi persyaratan kompetensi minimum sebagai pegawai;
2. Diklat Pembidangan, untuk pembinaan Kompetensi Inti, Kompetensi Peran dan Kompetensi Bidang sesuai tuntutan jabatan pegawai;
3. Diklat Perjenjangan, untuk pembinaan Kompetensi Inti, Kompetensi Peran dan Kompetensi Bidang sesuai tuntutan jalur karir yang diproyeksikan bagi pegawai;
4. Diklat Penunjang, untuk meningkatkan efisiensi dan efektivitas proses kerja melalui pengkayaan dan/atau penyegaran kompetensi pegawai; dan
5. Diklat Pembekalan Masa Purna Bakti, untuk memberikan pembekalan dan persiapan bagi pegawai dalam menghadapi masa purna bakti.
The Company provides education and training to meet the competencies’ requirement of employees in certain positions. The type of education and training provided consists of:
1. New Employee’s Selection Training, to foster, monitor, evaluate, and select the potential candidates who are able to meet the minimum competency requirements as employees;
2. Job Training, to foster the Core Competencies, Role Competencies, and Field Competencies, in line with the demands of employee positions;
3. Career Path Training, to foster the Core Competencies, Role Competencies, and Field Competencies, in line with the demands of career path projected for the said employee;
4. Supporting Training, to improve the efficiency and effectiveness of work processes through enrichment and/or refreshment of employee competencies; and
5. Retirement Training, to provide briefing and preparation for employees in facing the retirement period.
Pendidikan dan PelatihanEducation and Training
7. REOC-4.0 (Reliability Efficiency OptimizationCentre)
Untuk menganalisis dan pengambilan keputusan (operasi) serta menyiapkan dan meningkatkan kapabilitas keahlian personel dalam pengembangan expert system pembangkitan.
8. Digital Procurement Aplikasi pengadaan end to end.
9. PRO-PMO (Project Management Office) Aplikasi monitoring proyek yang
terintegrasi.
10. FAST – Financial Analysis Sistem Terpadu Aplikasi visualisasi kinerja keuangan
secara real time.
7. REOC-4.0 (Reliability Efficiency OptimizationCentre)
Analyzing and making decision (operations) and preparing and improving personnel expertise capabilities personnel in developing expert generation systems.
8. Digital Procurement End-to-end procurement application
9. PRO-PMO (Project Management Office) Integrated project monitoring application.
10. FAST – Financial Analysis Sistem Terpadu Application of financial performance
visualization in real-time.
246 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Rata-rata Jam Pelatihan Berdasarkan Jenis Kelamin [GRI 404-1]Average Training Hour by Gender [GRI 404-1]
Rata-rata Jam Pelatihan Berdasarkan Kategori Pegawai Average House of Training Based on Employee Category
Jenis Program PelatihanTraining Program
Durasi (Jam) Duration (Hour)
Jumlah Peserta (Orang)Number of Participants (Person)
Rata-rata Jam Pelatihan (Durasi/Orang)Average Training Hours (Hours/Person)
Pria Male
WanitaFemale
JumlahTotal
Pria Male
WanitaFemale
JumlahTotal
Pria Male
WanitaFemale
JumlahTotal
Seleksi Pegawai BaruNew Employee’s Selection
194.432 74.648 269.080 112 43 155 1.736 1.736 1.736
Program Pendidikan FormalFormal Education Program
9.984 1.792 11.776 39 7 46 256 256 256
Diklat PenjenjanganJob Grading Training
117.120 18.880 136.000 366 59 425 320 320 320
Program Akselerasi Kompetensi Bidang Operasi dan Pemeliharaan PembangkitPower Plant Operational and Maintenance Competencies Acceleration Program
393.228 - 393.228 993 - 993 396 - 396
IP Academy 358.584 38.456 397.040 3.487 400 3.887 103 96 102
Center of Excellence 47.544 - 47.544 1.121 - 1.121 42 - 42
Diklat Pembekalan Masa Purna BaktiRetirement Preparation Training
968 960 1.928 15 10 25 65 96 77
Jumlah Total 1.120.892 133.776 1.254.668 6.118 509 6.627 183 263 189
Jenis Program PelatihanTraining Program
Durasi (Jam) Duration (Hour)
Jumlah Peserta (Orang)Number of Participants (Person)
Rata-rata Jam Pelatihan (Durasi/Orang)Average Training Hours (Hours/Person)
Pria Male
WanitaFemale
JumlahTotal
Pria Male
WanitaFemale
JumlahTotal
Pria Male
WanitaFemale
JumlahTotal
Seleksi Pegawai BaruNew Employee’s Selection
- 269.080 269.080 - 155 155 - 1.736 1.736
Program Pendidikan FormalFormal Education Program
1.024 10.752 11.776 4 42 46 256 256 256
Diklat PenjenjanganJob Grading Training
43.520 92.480 136.000 136 289 425 320 320 320
Program Akselerasi Kompetensi Bidang Operasi dan Pemeliharaan PembangkitPower Plant Operational and Maintenance Competencies Acceleration Program
- 393.228 393.228 - 993 993 - 396 396
IP Academy 45.760 351.280 397.040 286 3.601 3.887 160 98 102
Center of Excellence 7.744 39.800 47.544 170 951 1.121 46 42 42
Diklat Pembekalan Masa Purna BaktiRetirement Preparation Training
104 1.824 1.928 2 23 25 52 79 77
Jumlah Total 98.152 1.158.444 1.256.596 598 6.054 6.652 164 191 189
Pengembangan Kompetensi dan Keahlian Pegawai [GRI 404-2]Employees’ Competence Development and Expertise [GRI 404-2]
Selama tahun 2019, Indonesia Power telah menginvestasikan sebesar Rp79,10 miliar untuk seluruh kegiatan pengembangan keahlian dan kompetensi pegawai. Sebanyak 6.627 peserta dengan jumlah jam pelatihan mencapai 1.254.668 telah mengikuti program tersebut. Sehingga rata-rata jam pelatihan mencapai 189 jam per pegawai. [GRI 404-1]
During 2019, Indonesia Power has invested Rp79.10 billion in the employees’ skills and competency development activities. There were 6,627 participants who participated in 1,254,668 training hours. Thus, the average hours of training is 189 training hours per participant. [GRI 404-1]
247 Sustainability Report 2019
PT Indonesia Power
Soci
al
Seluruh pegawai Indonesia Power memiliki kesempatan yang sama dalam meningkatkan karir dan mendapatkan penilaian atas kinerjanya. Perusahaan memiliki mekanisme tertentu dalam memberikan penilaian atas kinerja pegawai. Penilaian dilakukan dengan menggunakan aplikasi Sistem Manajemen Kinerja Pegawai (SIMKP).
Penilaian atas kinerja pegawai dilakukan setiap enam bulan sekali oleh atasan langsung dengan mengevaluasi pencapaian kinerja pegawai yang bersangkutan. Selama tahun 2019, seluruh pegawai Indonesia Power (100%) baik pria maupun wanita, di seluruh level jabatan organisasi telah mendapatkan penilaian kinerja. Hasil penilaian ini kemudian digunakan sebagai bahan acuan dalam pengembangan karir dan pemberian remunerasi pegawai. [GRI 404-3]
Proses pengembangan karir pegawai, dilakukan melalui peningkatan kompetensi (pembinaan level kompetensi dan grade pegawai) dan jenjang jabatan (peningkatan tuntutan pengetahuan, kompleksitas masalah dan tanggung jawab pada suatu jabatan). Pada tahun 2019, sebanyak 38 pegawai mendapatkan promosi jabatan. Data terkait pegawai yang menerima pengembangan karir melalui kegiatan rotasi dan promosi dapat dilihat pada tabel berikut:
All Indonesia Power’s employees have equal opportunities to improve their careers and be assessed in their performance. The Company has mechanisms in assessing the employee’s performance. The employee is assessed by using the Employee Performance Management System (SIMKP).
Employee’s performance is assessed every six months by the direct supervisor. The supervisor will evaluate the achievement of the employee. During 2019, every Indonesia Power employee (100%), both men and women, at all levels of the organization, has received performance evaluations. The assessment results become a reference in career development and employee remuneration. [GRI 404-3]
The career development of employees is processed through increased competence (fostering competency levels and grade of employees) and position (increasing knowledgeability, the complexity of problems, and responsibilities in an office). In 2019, there were 38 employees promoted. The data related to employees who experienced career development through rotation and promotion activities are in the following table:
Penilaian Kinerja dan Pengembangan Karir Performance Assessment and Career Development
KeteranganDescription
Jumlah PegawaiEmployees
Pegawai yang Mendapat Pengembangan KarirEmployees with Career Development
RotasiRotation % Promosi
Promotion %
Jenis Kelamin Gender
Pria Male 3.793 203 5,35% 33 0,87%
Wanita Female 425 45 10,59% 5 1,18%
Jumlah Total 4.218 248 5,88% 38 0,90%
Kategori Pegawai Employee’s CategoryEksekutif UtamaChief Executive
8 4 50,00% 0 0,00%
Eksekutif SeniorSenior Executive
69 21 30,43% 3 4,35%
Eksekutif Executive 264 80 30,30% 8 3,03%
Penyelia Supervisor 1.863 91 4,88% 24 1,29%
Pelaksana Practitioner 2.014 52 2,58% 3 0,15%
Jumlah Total 4.218 248 5,88% 38 0,90%
Persentase Pegawai yang Menerima Pengembangan Karir [GRI 404-3]Employees Who Received Career Development [GRI 404-3]
248 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Indonesia Power meyakini bahwa kepuasan dan keterikatan pegawai merupakan modal penting bagi pertumbuhan dan keberlangsungan bisnis Perusahaan. Oleh karena itu, Indonesia Power melalui Division of Human Capital and Change Management secara berkala melakukan survei kepuasan dan keterikatan pegawai melalui survei Human Resources Satisfaction & Enggagement (HRSE) sebagai salah satu tolok ukur pengelolaan SDM yang baik.
Pelaksanaan survei HRSE di tahun 2019, dilaksanakan pada tanggal 4 hingga 8 November 2019, dengan metode survei online melalui aplikasi internal. Adapun aspek-aspek yang dinilai dalam survei HRSE adalah:
1. Kepuasan, aspek kepuasan yang diukur:a. Kepuasan Bekerjab. Penempatan/promosi pegawaic. Pendi dikan dan pelatihand. Proses Penilaian Kinerjae. Minat dan kompetensif. Bimbingan/arahan atasan langsung
2. Engagementa. Job Designb. Organizational Healthc. Managerial Excellenced. Extrinsic Rewarde. Workplace Readinessf. Other
Berdasarkan survei HRSE pada tahun 2019, diperoleh hasil indeks kepuasan pegawai pada Perusahaan mencapai 80,84%. Sementara itu, hasil indeks keterikatan pegawai pada Perusahaan mencapai 84,19%. Hasil survei tersebut kemudian dijadikan bahan untuk merancang perbaikan-perbaikan dan strategi Perusahaan dalam pengelolaan dan pengembangan SDM di masa mendatang. [GRI 103-3]
Indonesia Power understands that employee satisfaction and engagement is an important capital for the growth and sustainability of the Company’s business. Therefore, Indonesia Power, through the Division of Human Capital and Change Management, regularly conducts employee satisfaction and engagement surveys through the Human Resources Satisfaction & Engagement (HRSE) survey as one of the benchmarks of good HR management.
The HRSE survey was conducted on 4-8 November 2019, by using the online survey method in an internal application. The aspects assessed in the HRSE survey are:
1. Satisfaction, aspects measured:a. Job Satisfactionb. Employee placement/promotionc. Education and trainingd. Performance Assessment Processe. Interest and competencef. Direct supervisor guidance/direction
2. Engagementa. Job Designb. Organizational Healthc. Managerial Excellenced. Extrinsic Rewarde. Workplace Readinessf. Other
Based on the HRSE survey in 2019, the Company scored 80.84% in the employee satisfaction index. Meanwhile, the employee engagement index was 84.19%. The survey results become the material reference to design Company’s refinements and strategies in managing and developing HR in the future. [GRI 103-3]
Survei HRSE HRSE Survey
249 Sustainability Report 2019
PT Indonesia Power
Soci
al
Kebijakan penanganan pengaduan pegawai tercantum dalam PKB Bab VII Hubungan Industrial pasal 133 tentang Keluh Kesah Pegawai dan Pasal 134 tentang Penyelesaian Keluh Kesah Pegawai. Di dalam peraturan tersebut juga diatur terkait mekanisme penanganan pengaduan yang dapat digambarkan sebagai berikut:
Selama tahun 2019, Indonesia Power tidak mendapat keluhan dari pegawai terkait pelanggaran terhadap praktik ketenagakerjaan maupun pelanggaran HAM termasuk insiden diskriminasi di dalam Perusahaan. Hal tersebut membuktikan adanya hubungan dan komunikasi yang harmonis antara Perusahaan dengan seluruh pegawai.
Employee complaint handling is stipulated in CLA Chapter VII Industrial Relations Article 133 on Employee Complaints and Article 134 on the Settlement of Employee Complaints. The regulation also stipulates the mechanism for handling complaints as follows:
During 2019, Indonesia Power received no complaints from employees regarding violations of labor practices or human rights, including incidents of discrimination within the Company. This is proof of harmonious relations and communication between the Company and all employees.
Penanganan Pengaduan Pegawai [GRI 103-2, GRI 103-3] Employee Complaints Handling [GRI 103-2, GRI 103-3]
Belum SelesaiNot Finished
Belum SelesaiNot Finished
Belum SelesaiNot Finished
Belum Selesai
Not Finished
Penyampaian keluh kesah pegawai kepada Atasan LangsungEmployee submitted complaints to the Direct Supervisor
Pegawai menyampaikan keluh kesah ke atasan dari atasan langsung untuk diadakan penyelesaian secara musyawarah dan tindakannya disampaikan kepada Pengurus PP Tingkat Unit setempat.Employee submitted complaints to direct superiors to hold deliberations and their actions are conveyed to the local Unit of PP Management.
Diajukan ke Lembaga Kerjasama Bipatrit (LKB) untuk mendapatkan saran, rekomendasi atau memorandumSubmitted to the Bipartite Cooperation Institute (LKB) to obtain advice, recommendations, or memorandum
Diselesaikan sesuai dengan Undang-undang dan peraturan ketenagakerjaan yang berlakuSettled in accordance with prevailing employment Laws and regulations
Menyelesaikan bersama Majemen di Kepegawaian dan General ManagerUnit/Pejabat setingkat Eksekutif Senior yang menangani Hubungan Industrial besertaPengurus Organisasi PP-IP di unit setempat.Finishing with Management in Employment and General Manager Unit/Officer at the Senior Executive level who handles Industrial Relations and the PP-IP Management at the local unit.
Atasan Langsung mencari solusi penyelesaian masalah dan jalan keluarDirect supervisor will try to find a solution to the complaint
SelesaiFinished
Mekanisme Pengaduan PegawaiEmployee’s Grievance Mechanism
250 Laporan Keberlanjutan 2019PT Indonesia Power
251 Sustainability Report 2019PT Indonesia Power
Meningkatkan Budaya Keselamatan danKesehatan Kerja,
Wujudkan Kinerja PrimaImproving Occupational Healthand Safety Culture, Actualizing
Performance Excellence
SOSIAL SOCIAL
Indonesia Power senantiasa meningkatkan penerapan Budaya Keselamatan dan Kesehatan Kerja (Safety Culture) sebagai salah
satu pondasi bisnis Perusahaan dalam mewujudkan kinerja prima secara berkelanjutan.
Indonesia Power strives to enhance the Occupational Health and Safety Culture (Safety Culture) as one of the Company’s business foundations in
actualizing performance excellence in a sustainable manner.
252 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Pendekatan Manajemen Topik Keselamatan dan Kesehatan Kerja (K3) dan Perencanaan dan Tanggap Darurat/ Bencana [GRI 103-1, 103-2, 103-3]Approach to Management of Occupational Health and Safety (OHS) and Emergency/Disaster Planningand Response [GRI 103-1, 103-2, 103-3]
Topik Keselamatan dan Kesehatan Kerja (K3) dan Perencanaan dan Tanggap Darurat menjadi topik yang penting bagi Indonesia Power karena dalam menjalankan bisnis pembangkit tenaga listrik, Indonesia Power berkomitmen untuk bertanggung jawab mewujudkan kondisi andal dan aman bagi instalasi, kondisi aman dari bahaya bagi manusia yakni perlindungan bagi pegawai sebagai aset utama Perusahaan dan perlindungan masyarakat umum dan stakeholder di sekitar pembangkit serta mencegah terjadinya kejadian berulang yang tertuang dalam Surat Keputusan Direksi Nomor 165 tentang Kebijakan Keselamatan dan Kesehatan Kerja PLTU Batubara.
Occupational Health and Safety (OHS) and Emergency Planning and Response are important topics for Indonesia Power because in engaging in the power plant generation, Indonesia Power is committed to being responsible for creating reliable and safe conditions for the installation, safe condition for all people, i.e. protection for employees as the Company’s main assets, and protection for the general public and stakeholders surrounding the plant, and preventing any recurring events as set forth in the Board of Directors Decree No. 165 on the Occupational Health and Safety Policy at Coal-Fired Power Plant.
Kebijakan Perusahaan• Keputusan Direksi Nomor 41.K/010/ IP/2012 tentang Kebijakan
Keselamatan dan Kesehatan Kerja serta Lingkungan di PT Indonesia Power• Keputusan Direksi Nomor 165.K/010/IP/2016 tentang Kebijakan
Keselamatan dan Kesehatan Kerja PLTU Batubara• Keputusan Direksi Nomor 065.K/010/IP/2008 tentang Ketentuan
Kecelakaan Dinas/Kerja• Keputsan Direksi Nomor 23.K/010/IP/2010 tentang Penerapan
Program 5S di Seluruh Unit Kerja• Keputusan Direksi Nomor 2.K/010/IP/2017 tentang Kawasan
Dilarang Merokok• Surat Edaran Direksi Nomor 14.E/012/IP/2017 tentang Petunjuk
Warna Cat Lantai Pada Pembangkit• Surat Edaran Direksi Nomor 45.E/012/IP/2019 tentang Pedoman
Penggunaan Alat Pelindung Diri Dalam Bentuk Safety Helmet dan Wearpack di Lingkungan Unit Kerja PT Indonesia Power
• Perjanjian Kerja Bersama Tahun 2017-2018 yang diperpanjang satu tahun (2019)
Ketentuan Umum• Undang undang Dasar 1945 Pasal 27 Ayat 2• Undang-undang Nomor 1 Tahun 1970 tentang Keselamatan Kerja• Undang-undang Nomor 13 Tahun 2003 tentang Ketenagakerjaan• Undang-undang Nomor 30 Tahun 2009 tentang
Ketenagalistrikkan• Peraturan Pemerintah Nomor 50 Tahun 2012 tentang Penerapan
Sistem Manajemen Keselamatan dan Kesehatan Kerja
Company’s Policies:• Board of Directors’ Decree No. 41.K/010/IP/2012 on
Occupational Health and Safety Policy within PT Indonesia Power• Board of Directors’ Decree No. 165.K/010/IP/2016 on
Occupational Health and Safety within Coal-Fired Power Plant• Board of Directors’ Decree No. 065.K/010/IP/2008 on
Occupational Accidents Provisions• Board of Directors’ Decree No. 23.K/010/IP/2010 on 5S Program
Implementation in All Work Units• Board of Directors’ Decree No. 2.K/010/IP/2017 on Non-Smoking
Areas• Board of Directors’ Circular Letter No. 14.E/012/IP/2017 on the
Floor Color Paint Guidelines for Power Plants• Board of Directors’ Circular Letter No. 45.E/012/IP/2019 on the
Guidelines for the Personal Protective Equipment Utilization of Safety Helmet and Wearpack in the Environment of PT Indonesia Power
• Collective Labor Agreement for 2017-2018, and extended by one year (2019)
General Provisions• The 1945 Constitution Article 27 Paragraph 2• Law No. 1 of 1970 on Occupational Safety• Law No. 13 of 2003 on Employment• Law No. 30 of 2009 on Electricity • Government Regulation No. 50 of 2012 on the Implementation of
Occupational Health and Safety Management System
KebijakanPolicy
Meningkatkan Budaya Keselamatan danKesehatan Kerja, Wujudkan Kinerja PrimaImproving Occupational Health and Safety Culture,Actualizing Performance Excellence
253 Sustainability Report 2019
PT Indonesia Power
Soci
al
• Membangun budaya K3 untuk terwujudnya zero accident;
• Membangun Kesiagaan Tanggap Bencana di seluruh unit pembangkit;
• Menciptakan Unit Kerja (Pembangkit dan Non-Pembangkit) yang bersih guna mengurangi potensi kecelakaan kerja.
• Building OHS culture for the realization of zero accident;
• Building Disaster Response Preparedness in all generating units;
• Creating clean Work Units (Generators and Non-Generators) to reduce the potential for occupational accidents.
• Pelaksanaan Pelaporan unsafe action, unsafe condition dan nearmiss dalam Aplikasi Nearmiss;
• Pelaksanaan Gap Asessment dan pendampingan International Safety Rating System (ISRS) di Suralaya PGU dan Pelabuhan Ratu OMU;
• Pelaksanaan Assessment Fire Protection Review Programs di Labuan OMU dan Adipala OMU;
• Pelaksanaan Implementasi Industrial Cleaning Service di Pangkalan Susu OMU, Lontar OMU, Pelabuhan Ratu OMU, Barru OMU dan Adipala OMU.
• Reporting unsafe actions, unsafe conditions, and near miss in the Nearmiss Application;
• Implementing Gap Assessment and assisting the International Safety Rating System (ISRS) at Suralaya PGU and Pelabuhan Ratu OMU;
• Implementing Fire Protection Assessment Review Programs in Labuan OMU and Adipala OMU;
• Implementing Industrial Cleaning Service at Pangkalan Susu OMU, Lontar OMU, Pelabuhan Ratu OMU, Barru OMU, and Adipala OMU.
• Tercapainya target pelaporan unsafe action, unsafe condition dan nearmiss dalam Aplikasi Nearmiss
• Terlaksananya pendampingan ISRS selama sembilan bulan di Suralaya PGU dan Pelabuhan Ratu OMU;
• Terlaksananya Assessment Fire Protection dengan ruang lingkup: Water Base System, Gas Supression System dan Panel Alarm System di Labuan OMU dan Adipala OMU;
• Terlaksananya implementasi Industrial Cleaning Service di Pangkalan Susu OMU, Lontar OMU, Pelabuhan Ratu OMU, Barru OMU dan Adipala OMU yang melibatkan anak perusahaan PLN (PT Haleyora Power Indo) dan anak perusahaan Indonesia Power (PT Cogindo Daya Bersama) sebagai mitra kerja Industrial Cleaning Service yang merupakan salah satu praktik sinergi anak usaha PLN Group.
• Achieve target report for unsafe actions, unsafe conditions, and near miss in the Nearmiss Application
• ISRS assistance for nine months at Suralaya PGU and Pelabuhan Ratu OMU;
• Fire Protection Assessment within the scope: Water Base System, Gas Suppression System, and Panel Alarm System in Labuan OMU and Adipala OMU;
• Industrial Cleaning Service is implemented at Pangkalan Susu OMU, Lontar OMU, Pelabuhan Ratu OMU, Barru OMU, and Adipala OMU involving PLN’s subsidiary (PT Haleyora Power Indo) and Indonesia Power’s subsidiary (PT Cogindo Daya Bersama) as partners of Industrial Cleaning Service, as the synergy for PLN Group’s subsidiaries.
KomitmenCommitment
RealisasiRealization
Sasaran dan TargetGoals and Targets
• Pelaksanaan Bulan K3 Kantor Pusat• DiklatdanSertifikasiK3• Assessment fire protection review programs di Labuan OMU
dan Adipala OMU• Implementasi Industrial Cleaning Service di Pangkalan Susu
OMU, Lontar OMU, Pelabuhan Ratu OMU, Barru OMU dan Adipala OMU
• Pelaporan nearmiss dalam Aplikasi Nearmiss• Gap Asessment dan pendampingan International Safety
Rating System (ISRS) di Suralaya PGU dan Pelabuhan Ratu OMU
• Simulasi Tanggap Darurat• Memorandum of Understanding (MoU) Indonesia Power
dengan BASARNAS• Focus Group Discussion K3• Integrasi Kurikulum Silabus (Kursil) K2 & K3• Penetapan Pedoman Standardisasi Alat Pelindung Diri (APD)
Korporat• SertifikasiSistemManajemenKeselamatandanKesehatan
Kerja (SMK3)• Sayembara Kuis (SAKU K3)• Video Conference K3• Pengadaan Peralatan Tanggap Darurat Antisipasi Tsunami
• Penilaian Kebersihan Unit Pembangkit• Investigasi Kecelakaan Kerja• Review Prosedur Korporat
• OHSMonthattheHeadOffice• OHSCertificationandTraining• Fire Protection Assessment Review Programs in Labuan
OMU and Adipala OMU• Industrial Cleaning Service at Pangkalan Susu OMU, Lontar
OMU, Pelabuhan Ratu OMU, Barru OMU, and Adipala OMU
• Reporting near miss in the Nearmiss Application• Gap Assessment and International Safety Rating System
(ISRS) assistance at Suralaya PGU and Pelabuhan Ratu OMU
• Emergency Response Simulation• Memorandum of Understanding (MoU) of Indonesia Power
with BASARNAS• OHS Focus Group Discussion• Integration of K2 & K3 Syllabus • Establishment of Corporate Personal Protective Equipment
(PPE) Standardization Guidelines• Occupational Health and Safety Management System
(OHSMS)Certification• Quiz (OHS SAKU)• OHS Video Conference• Procurement of Emergency Response Equipment for
Tsunami Anticipation• Cleanliness Evaluation of Generating Units• Occupational Accident Investigation• Review of Corporate Procedures
Program/InisiatifProgram/Initiative
• Kantor Pusat: Vice President of Health, Safety and Environment
• Unit Kerja: Manager Operasi dan/atau Manager K3 Unit
• HeadOffice:VicePresidentofHealth,Safety and Environment
• Work Unit: Operations Manager and/or OHS Manager
• Melaksanakan penilaian kinerja kepatuhan K3 di akhir tahun sebagai bagian dari evaluasi penerapan K3 di tahun 2019.
• Assessing the performance of OHS compliance at the end of the year as part of the OHS evaluation in 2019.
EvaluasiEvaluation
Penanggung JawabPerson in Charge
254 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Budaya Keselamatan danKesehatan Kerja (Safety Culture)Safety Culture
Salah satu komitmen Indonesia Power dalam aspek Keselamatan dan Kesehatan Kerja (K3) adalah “Membangun Budaya K3 (Safety Culture) Untuk Terwujudnya Zero Accident”. Hal ini dikarenakan safety culture adalah dasar dalam melaksanakan kegiatan Operation, Maintenance and Engineering (OME) dan seluruh kegiatan yang berlangsung di lingkungan Perusahaan untuk menjamin keselamatan, kesehatan, keamanan dan kenyamanan seluruh pegawai, kontraktor, mitra kerja maupun masyarakat sekitar unit pembangkit Perusahaan. Terdapat tiga hal utama yang tercakup dalam safety culture, yaitu mindset, knowledge/pengetahuan tentang K3 dan kecepatan respon.
One of Indonesia Power’s commitments in the Occupational Health and Safety (OHS) aspect is “Building a Safety Culture for the Realization of Zero Accident”. This is because safety culture is the basis for carrying out Operation, Maintenance, and Engineering (OME) activities and all activities in the Company to ensure the safety, health, security, and comfort of all employees, contractors, business partners, and the community surrounding the Company’s generating units. There are three main things covered in the safety culture: mindset, OHS knowledge, and response speed.
Tiga Hal Utama yang Tercakup Dalam Budaya K3 (Safety Culture)Three Keys in Safety Culture
MindsetMindset
Mengubah pola pikir pegawai dan meningkatkan kesadaran pegawai tentang pentingnya menjaga keselamatan diri dan lingkungan kerja merupakan tanggung jawab bersama.
Changing the employees’ mindset and raising the employees’ awareness about the importance of maintaining personal safety and the work environment are a shared responsibility.
PengetahuanKnowledge
Pemahaman K3 yang harus dikuasai insan Perusahaan adalah adanya hubungan timbal balik antara safety, quality dan environment. Selain itu, setiap insan Perusahaan juga harus memiliki kemampuan dan kemauan untukmengidentifikasidanmengelolanearmiss, yakni unsafe condition (kondisifisikyangberpotensimenimbulkan bahaya/ kecelakaan) dan unsafe action (perilaku pegawai yang dapat menyebabkan terjadinya kecelakaan kerja atau bentuk pelanggaran terhadap prosedur keselamatan yang telah ditetapkan Perusahaan sehingga menimbulkan potensi bahaya/kecelakaan).
The Company’s personnel shall master the mutual relationship between safety, quality, and environment as the OHS understanding. In addition, every Company’s personnel shall have the ability and willingness to identify and manage near miss, i.e. unsafe conditions (physical conditions that have the potential to cause danger/accident) and unsafe actions (employee’ behavior that can cause work accidents or violations of safety procedures as set forth by the Company, that creates potential danger/accident).
Kecepatan ResponResponse Speed
Pembekalan skill/keterampilan pegawai terkait kecepatan dalam penanganan kondisi darurat (kebakaran, ledakan, kebocoran gas, bencana alam dan lain-lain) dan pertolongan pertama pada kecelakaan. Selain itu, menempatkan hal-hal terkait K3 menjadi prioritas pertama dalam Maximo karena sifatnya emergency seperti menyangkut kesiapan sistem fire fighting.
Employees’ skill training related to speed inhandlingemergencyconditions(fire,explosion, gas leak, natural disasters, etc.) andfirstaidskill.Inaddition,OHSbecomesthe priority in Maximo due to its emergency nature,suchasthereadinessoffirefightingsystem.
255 Sustainability Report 2019
PT Indonesia Power
Soci
al
Tantangan dan Strategi Keselamatan dan Kesehatan KerjaOccupational Health And Safety Challenges and Strategies
Untuk dapat mewujudkan kinerja prima, penerapan K3 terus menjadi tantangan bagi Indonesia Power. Atas hal tersebut, dibutuhkan berbagai strategi pengendalian K3 yang lebih efektif dan inovatif dalam mencegah terjadinya kecelakaan kerja dan penyakit akibat kerja sehingga terwujud zero accident. Berbagai tantangan yang dihadapi beserta strategi yang dilakukan Indonesia Power terkait K3 adalah sebagai berikut:
Indonesia Power considers the OHS implementation as challenge to realize performance excellence. Therefore, various effectiveandinnovativeOHScontrolstrategiesareneededtoprevent work accidents and occupational diseases in order to actualize zero accidents. Indonesia Power faced various OHS challenges and implemented strategies as follows:
TantanganChallenges
StategiStrategies
- Pengoperasian Unit Pembangkit buatan Tiongkok- Penggunaan batubara berkalori rendah pada
Pembangkit Listrik Tenaga Uap (PLTU)- Sifat swabakar untuk batu bara berkalori rendah- Dorongan dari PT PLN (Persero) terkait kesiapan
upaya pencegahan kebakaran khususnya pada PLTU batubara berkalori rendah (low rank coal)
- Penetapan Nilai Kepatuhan K3 dari PT PLN (Persero) semakin ketat yang berpengaruh pada pengurangan nilai kinerja korporat Indonesia Power
- Peraturan Pemerintah terkait K3 dan meningkatnya pengawasan dari Pemerintah dalam pelaksanaan K3
- Implementasi Industrial Cleaning- Implementasi International Sustainability Rating
System (ISRS)
- Operation of a Chinese-made Generating Unit- The use of low rank coal in the Steam Power Plant
(SPP)- Spontaneous combustion nature for low rank coal- Encouragement from PT PLN (Persero) related to thereadinessoffireprevention,especiallyinlowrank Coal-Fired Power Plant
- The OHS Compliance Value from PT PLN (Persero) is closely related to the reduction of corporate performance value of Indonesia Power
- Government Regulations related to OHS and supervision from the Government in the OHS implementation
- Industrial Cleaning Implementation- International Sustainability Rating System (ISRS)
Implementation
- Penyempurnaan Fire Protection sesuai NFPA/FM Global
- Pengembangan Safety Control Room (SCR)- Pemenuhan Struktur Organisasi K3 untuk
menjamin pengawasan K3 selama 24 jam- Penerapan Contractor Safety Management
System (CSMS)- Peningkatan budaya K3 dari compliance menjadi
commitment- Pembangunan aplikasi pelaporan nearmiss- Penerapan Industrial Cleaning untuk area
produksi PLTU
- Fire Protection improvement in line with NFPA/FM Global
- Development of Safety Control Room (SCR)- Compliance with OHS Organization Structure to
guarantee 24/7 OHS surveillance- Contractor Safety Management System (CSMS)
implementation - OHS culture changed from compliance to
commitment- Development of the near miss reporting
application- Industrial Cleaning for SPP production areas
Tantangan dan Strategi Indonesia Power Terkait K3OHS Challenges and Strategy of Indonesia Power
256 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Sistem Manajemen Keselamatandan Kesehatan KerjaOccupational Health and Safety Management System
Keselamatan dan Kesehatan Kerja Dalam Perjanjian Kerja BersamaOccupational Health and Safety in Collective Labor Agreement
Untuk meningkatkan efektifitas perlindungan K3 yangterencana, terstruktur dan terintegrasi serta mencegah dan mengurangi kecelakaan kerja dan penyakit akibat kerja di seluruh lingkungan Perusahaan, dibutuhkan penerapan Sistem Manajemen Keselamatan dan Kesehatan Kerja (SMK3). Indonesia Power telah menerapkan Sistem Manajemen K3 berdasarkan Peraturan Pemerintah Nomor 50 tahun 2012 dan telah memenuhi standar pelaksanaan K3 internasional denganmemperolehsertifikasiOccupational, Health & Safety Management System (OHSAS) 18001:2007.
Indonesia Power telah mencantumkan pembahasan K3 dalam Perjanjian Kerja Bersama (PKB) Indonesia Power Tahun 2017-2018 yang diperpanjang satu tahun (2019) yang mengikat kedua belah pihak (perusahaan dan pegawai) terkait hak dan kewajiban atas penerapan K3. Terdapat 41 pasal pembahasan terkait K3 dari 146 pasal atau 28,08% dari total pembahasan dalam PKB. [GRI 403-4]
An Occupational Health and Safety Management System (OHSMS) shall be implemented to increase the effectivenessof planned, structured, and integrated OHS protection, and to prevent and reduce occupational accidents and occupational diseases within the Company’s environment. Indonesia Power implemented an OHS Management System based on Government Regulation No. 50 of 2012 and has met the international OHS standards by obtaining the Occupational, Health & Safety Management System (OHSAS) 18001:2007 certification.
Indonesia Power has included the OHS discussion in the 2017-2018 Collective Labor Agreement (CLA), which is extended by one year (2019), that binds both parties (the company and employee) in terms of the rights and obligations for OHS implementation. There are 41 articles related to OHS out of 146 articles, or 28.08% of the CLA discussion. [GRI 403-4]
Bab VII tentang PerlindunganBagian Kedua: Pemeliharaan Kesehatan
Chapter VII on ProtectionPart Two: Health Care
Bab VII tentang PerlindunganBagian Ketiga: Keselamatan dan Kesehatan Kerja
Chapter VII on ProtectionPart Three: Occupational Health and Safety
Terdiri dari 32 Pasal yaitu Pasal 89 - Pasal 121, yang berisi topik terkait:- Fasilitas Pemeliharaan Kesehatan- Macam Pemeliharaan Kesehatan- Sarana Pelayanan Kesehatan- Perawatan Kesehatan- Pemeriksaan Penunjang bagi Pegawai dengan
Tugas-tugas Khusus
Consists of 32 Articles, Articles 89-121,which contains:- Health Care Facilities- Health Care Types- Health Services Facilities- Health Care- Supporting Examination for Employees with
Special Assignment
Terdiri dari 9 Pasal yaitu Pasal 122 - Pasal 130, yang berisi topik terkait:- Kriteria Kecelakaan Kerja- Alat Keselamatan Kerja- Perlengkapan Alat Keselamatan
dan Kesehatan Kerja- Keamanan dalam Hubungan Kerja- Sakit Karena Kecelakaan Kerja- Kompensasi Rehabilitasi- Santunan Cacat Tetap- Santunan Tewas- Bantuan Meninggal Dunia
Consists of 9 Articles, Articles 122-130, which contains:- Occupational Accident Criteria- Personal Protective Equipment- Occupational Safety and Health
Equipment - Security in Employment Relations- Sick Leave Due to Work Accident- Rehabilitation Compensation- Compensation for Permanent Disability-DeathBenefits- Death Assistance
Topik K3 dalam PKB [GRI 403-4]OHS in CLA [GRI 403-4]
257 Sustainability Report 2019
PT Indonesia Power
Soci
al
Panitia Pembina Keselamatandan Kesehatan KerjaOccupational Health and Safety Committee
Dalam rangka mencapai keberhasilan program K3, diperlukan pola manajemen partisipatif yaitu dengan membentuk Panitia Pembina Keselamatan dan Kesehatan Kerja (P2K3) di masing-masing unit Perusahaan. Pembentukan P2K3 Indonesia Power berdasarkan Keputusan Direksi Nomor 41.K/010/IP/2012 tentang Kebijakan Keselamatan dan Kesehatan Kerja serta Lingkungan di PT Indonesia Power. Tugas dan fungsi P2K3 adalah sebagai berikut:1. Membantu memberikan penyuluhan kepada pegawai
mengenai pencegahan kecelakaan kerja dan pencemaran lingkungan di tempat kerja;
2. Sebagai pengawas terhadap pelaksanaan pekerjaan dengan memperhatikan ketentuan dan perundangan yang berlaku;
3. Memberi saran dan pertimbangan kepada Manajemen mengenai masalah K3L;
4. Menghimpun dan mengolah data atau permasalahan K3L;5. Melaksakanakan rapat P2K3 sekurang-kurangnya diadakan
satu kali setiap bulan, yang dipimpin langsung oleh Ketua; dan6. Berwenang mengambil tindakan terhadap pelanggaran yang
terjadi dengan melaporkan atau memberikan rekomendasi kepada Manajemen mengenai potensi pelanggaran K3, pencemaran/limbah dan adanya kasus pelanggaran yang dilakukan oleh Pegawai atau Mitra kerja.
A Committee as a participatory management pattern for Occupational Health and Safety (P2K3) in each Company’s unit is established to achieve the success of the OHS program. Indonesia Power’s P2K3 is established based on the Board of Directors’ Decree No. 41.K/010/IP/2012 on Occupational Health and Safety Policy within PT Indonesia Power. Duties and functions of P2K3 are as follow:
1. Providing counseling to employees regarding the prevention of workplace accidents and environmental pollution in the workplace;
2. As a supervisor of the work implementation, by taking into account the prevailing laws and regulations;
3. Providing recommendations and considerations to Management in relation to K3L issues;
4. Collecting and processing data or K3L issues;5. Holding P2K3’s meetings at least once a month, chaired by
the Chairperson; and6. Authorized to take action against violations that occur by
reporting or providing recommendations to Management regarding potential OHS violations, pollution/waste, and the cases of violations committed by Employees or Partners.
Struktur Organisasi P2K3 Indonesia Power [GRI 403-1]Indonesia Power’s P2K3 Organizational Structure [GRI 403-1]
Struktur Organisasi P2K3 KorporatCorporate’s P2K3 Organizational Structure
Struktur Organisasi P2K3 Unit PembangkitGenerating Units’ P2K3 Organizational Structure
Ketua Chairman
Vice President of Health, Safety and EnvironmentVice President of Health, Safety and Environment
Anggota Member
Manajer di Kantor Pusat dan Ketua Persatuan Pegawai Kantor PusatManagerintheHeadOfficeandtheChairmanoftheUnionatHeadOffice
Sekretaris Secretary
Manager of Health,Safety and Security
(Ahli K3 Umum/AK3U Certified)Manager of Health, Safety and Security (General OHS Expert/
AK3U)
Ketua Chairman
General Manager/ Manager UnitGeneral Manager/ Manager Unit
Anggota Member
Supervisor Senior seluruh bidangSeniorSupervisorsinallfields
Sekretaris Secretary
Supervisor Senior K3 (AK3U Certified)
OHS Senior Supervisor (AK3UCertified)
258 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Pada tahun 2019, struktur formal keanggotaan P2K3 memiliki 849 anggota (19,65% dari total pegawai Perusahaan) yang berasal dari perwakilan manajemen sebanyak 161 orang dan perwakilan pegawai sebanyak 688 orang.
In 2019, the P2K3 formally has 849 members (19.65% of the Company’s total employees) consisting of 161 management representatives and 688 employee representatives.
Persentase Pegawai Indonesia Power yang Diwakili dalam P2K3 [GRI 403-1]Indonesia Power’s Employees represented in P2K3 [GRI 403-1]
Tahun Year
Jumlah Pegawai Employees
Jumlah Anggota Members %
Perwakilan Manajemen Management Representatives
Perwakilan Pegawai Employee Representatives
Jumlah Total % Jumlah Total %
2017 4.209 800 19,01 208 26,00 592 74,00
2018 4.294 762 17,75 126 16,54 636 83,46
2019 4.320 849 19,65 161 18,96 688 81,04
Identifikasi Jenis Pekerjaan Berisiko TinggiHigh-Risk Work Identification
Aktivitas yang dilakukan pegawai Indonesia Power dalam bidang pembangkitan yakni aktivitas operasi dan pemeliharaan pembangkit di unit bisnis Perusahaan, tak terlepas dari berbagai risiko di dalamnya, baik risiko kecelakaan kerja maupun risiko penyakit akibat kerja. Sebagai langkah antisipasi dan mitigasi, Indonesia Power telah menyusun risk mapping area pembangkit beserta program pencegahan dan penanganan dalam menghadapi risiko tersebut. Berikut pemetaan jenis pekerjaan dan unit bisnis yang berisiko tinggi terhadap aspek K3 di Indonesia Power:
Indonesia Power’s activities in the electricity generation, i.e. the operation and maintenance of power plants in the Company’s business units, are inseparable from the various risks for employees, both the risk of work accidents and occupational diseases. Indonesia Power prepared a risk mapping of the power plant area with prevention and treatment programs in facing these risks as an anticipation and mitigation measure. The following is the mapping of the types of work and business units that are at high risk of OHS aspects in Indonesia Power:
Panitia Pembina Keselamatan dan Kesehatan KerjaOccupational Health and Safety Committee
259 Sustainability Report 2019
PT Indonesia Power
Soci
al
Jenis Pekerjaan Berisiko Tinggi Berdasarkan Jenis Unit Bisnis [GRI 102-15, 403-3]High-Risk Jobs by Type of Business Unit [[GRI 102-15, 403-3]
Unit Bisnis Business
Unit
Jenis Pekerjaan Berisiko Tinggi
High-Risk Works
Cara Pencegahan/ Penanganan Khusus Special Prevention/Handling Methods
Cara Pencegahan/ Penanganan Umum Prevention/General Management
PLTU SPP - Pemeliharaan Coal Crusher
- Pengoperasian Pulverizer Mill
- Pengambilan Sampel batubara di Coal Feeder
- Pengoperasian Purging Line Hydrogen
- Coal Crusher Maintenance
- Pulverizer Mill Operation
- Coal Sampling at Coal Feeder
- Hydrogen Purging Line Operation
- Peningkatan pengawasan confined space;- Kesiapan instalasi fire fighting system;- Pembuatan rambu terkait hazard; dan- Ketersediaan APD sesuai potensi bahaya.-ConfinedSpaceSurveillanceEnhancement;-Firefightingsysteminstallationreadiness;- Making hazard related signs; and- PPE availability based on the potential hazard.
Ijin Kerja Khusus:- Menyusun Job Safety Analysis;- Lock out tag out (jika diperlukan);- Checklist pemenuhan tool dan alat
kerja;- Melengkapi Instruksi Kerja (IK) dan
Standar Operasional Prosedur (SOP);- Ijin Kerja dibuat sebelum melakukan
pekerjaan hingga pekerjaan selesai dan disetujui oleh SPS K3L atau yang setara;
- Wajib menyediakan supervisor/pengawas K3 yang bertanggung-jawab atas pemenuhan aspek K3 atas pekerjaan yang dilakukan;
- Ijin kerja di luar jam kerja/kerja lembur dengan melampirkan nama Perusahaan/mitra kerja, nama/jenis pekerjaan, nama pekerja, lama/durasi pekerjaan dan disetujui oleh SPS K3L atau setara; dan
- Penutupan ijin kerja oleh leader mitra, pengawas pekerjaan internal (SPS user), pengawas lapangan (pelaksana K3L) dan validasi oleh SPS K3L apabila pekerjaan dinyatakan selesai.
Special Work Permit:- Compiling Job Safety Analysis;- Lock out tag out (if needed);- Checklist for tool and equipment fulfillment;
- Completing Work Order (WO) and Standard Operating Procedure (SOP);
- Work Permit is requested prior to carrying out work, up to the work is completed and approved by K3L Supervisor or equivalent;
- Provision of OHS supervisors who are responsibleforfulfillingOHSaspectsof the work performed;
- Work permit outside working hours/overtime shall attach the name of the company/partner, the name/type of work, the name of the employee, the length/duration of work, and approved by K3L Supervisor or equivalent; and
- Closing work permits by partner’s leader, internal work supervision (SPSuser),fieldsupervisors(K3Limplementers), and validation by K3L Supervisor when the work is declared complete.
PLTAHydro Power Plant (PLTA)
- Inspeksi tunnel/pipa penstock
- Pemeliharaan Trafo- Pemeliharaan
cubicle listrik- Tunnel/pipe
penstock inspection - Transformer
Maintenance - Electric cubicle
maintenance
- Peningkatan pengawasan confined space; dan- Pemeliharaan rutin panel listrik.-Confinedspacesurveillanceenhancement;
and - Electrical panels routine maintenance.
PLTPGeothermal Power Plant (PLTP)
- Pekerjaan di Area Turbin
- Pekerjaan di Area Vent Valve
- Working in the Turbine Area
- Working in the Vent Valve Area
- Ketersediaan APD sesuai potensi bahaya; dan- Pembuatan rambu terkait hazard.- PPE availability based on the potential hazard;
and - Making hazard related signs.
PLTG/ PLTGU GTPP/CCPP
- Pengoperasian Hydrogen Plant
- Pengoperasian GT- Pengurasan
Condensate Gas- Hydrogen Plant
Operation- GT operation- Gas Condensate
Drainage
- Review Material Safety Data Sheet (MSDS), Piping and Instrumentation Diagram (P&ID) H2, dan wiring diagram;
- Tes rutin fire alarm;- Kesiapan instalasi fire fighting system; dan- Kelengkapan APD sesuai potensi bahaya.- Material Safety Data Sheets (MSDS) Review,
Piping and Instrumentation Diagrams (P&ID) H2, and wiring diagrams;
-Routinefirealarmtest;-Firefightingsysteminstallationreadiness;and- PPE completeness based on the potential
hazard.
260 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Jenis Pekerjaan dengan Risiko Penyakit Akibat Kerja Berdasarkan Unit Bisnis [GRI 102-15, 403-3]Occupations with Occupational Disease Risk -by Business Unit [GRI 102-15, 403-3]
Unit Bisnis Business
Unit
Jenis Pekerjaan Berisiko Tinggi High-Risk Works
Cara Pencegahan/ Penanganan [EU16]Prevention/Treatment [EU16]
PLTU, PLTP, PLTG/PLTGU, PLTASPP, GPP, GTPP/CCPP, HPP
Bekerja di KebisinganBerisiko mengalami penurunan atau kerusakan fungsi pendengaranWorking in NoiseRisk of hearing loss or damage
- Engineering control;- Pemeliharaan rutin peralatan;- Ketersediaan Alat Pelindung Diri (APD) yaitu Eaf Muff, Ear Plug
dan APD Standar;- Pemeriksaan kesehatan berkala (audiometri);- Pemberian extra fooding;- Adanya pemasangan rambu-rambu peringatan K3; dan- Sosialisasi terkait Penyakit Akibat Kerja.- Engineering control;- Routine equipment maintenance;-PersonalProtectiveEquipment(PPE)availability:EarMuff,Ear
Plug, and Standard PPE;- Periodical medical check-up (audiometry);- Extra fooding provisions;- OHS warning signs installation; and- Dissemination related to Occupational Diseases.
Bekerja di Area yang Memiliki Vibrasi atau Getaran TinggiBerisiko mengganggu kelainan pada saraf, otot, tulang dan sendiWorking in High Vibration AreasRisk of disorders of the nerves, muscles, bones, and joints
- Ketersediaan APD Standar;- Pemeriksaan kesehatan berkala (audiometri);- Pemberian extra fooding;- Adanya pemasangan rambu-rambu peringatan K3; dan- Sosialisasi terkait Penyakit Akibat Kerja.- Availability of PPE Standard;- Periodical medical check-up (audiometry);- Extra fooding provisions;- OHS warning signs installation; and- Dissemination related to Occupational Diseases.
PLTU, PLTP, PLTG/PLTGUSPP, GPP, GTPP/CCPP
Bekerja di Area Paparan Bahan KimiaBerisiko mengganggu saluran pernapasan, kulit dan pencernaanWorking in Chemical Exposure AreasRisk of disrupting the respiratory tract, skin, and digestion system
- Ketersediaan APD (Masker, Respirator, Safety Glasses, Latex Gloves, Lab Coat dan APD Standar).
- Ketersediaan MSDS;- Pemeriksaan kesehatan berkala ;- Pemberian extra fooding;- Adanya pemasangan rambu-rambu peringatan K3; dan- Sosialisasi terkait Penyakit Akibat Kerja.- PPE Availability (Mask, Respirator, Safety Glasses, Latex
Gloves, Lab Coat, and Standard PPE).- MSDS availability;- Periodic medical check-up;- Extra fooding provisions;- OHS warning signs installation; and- Dissemination related to Occupational Diseases.
Identifikasi Jenis Pekerjaan Berisiko TinggiHigh-RiskWorkIdentification
261 Sustainability Report 2019
PT Indonesia Power
Soci
al
Unit Bisnis Business
Unit
Jenis Pekerjaan Berisiko Tinggi High-Risk Works
Cara Pencegahan/ Penanganan [EU16]Prevention/Treatment [EU16]
PLTU SPP Bekerja di Area Paparan Abu dan Batubara (Ash and Coal)Berisiko mengganggu saluran pernapasanWorking in Ash and Coal Exposure AreasRisk of disrupting the respiratory tract
- Ketersediaan APD (Masker Kabon Aktif, Respirator, Safety Glasses dan APD Standar);
- Pemeriksaan kesehatan berkala (spirometri);- Pemberian extra fooding;- Adanya pemasangan rambu-rambu peringatan K3; dan- Sosialisasi terkait Penyakit Akibat Kerja.- PPE Availability (Active Carbon Mask, Respirator, Safety
Glasses, and Standard PPE);- Periodic medical check-up (spirometry);- Extra fooding provisions;- OHS warning signs installation; and- Dissemination related to Occupational Diseases.
Bekerja di Area Paparan RadiasiBerisiko menyebabkan kanker, permasalahan reproduksi dan kematianWorking in Radiation Exposure AreaRisk of causing cancer, reproductive issues, and death
- Ketersediaan APD (Apron Proteksi Tubuh, Safety Glove dan APD Standar);
- Pemeriksaan kesehatan berkala ;- Pemberian extra fooding;- Adanya pemasangan rambu-rambu peringatan K3; dan- Sosialisasi terkait Penyakit Akibat Kerja.- PPE Availability (Body Protection Apron, Safety Glove, and
Standard PPE);- Periodic medical check-up;- Extra fooding provisions;- OHS warning signs installation; and- Dissemination related to Occupational Diseases.
262 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Program Pengelolaan Keselamatandan Kesehatan KerjaOccupational Health and Safety Management Program
Selama tahun 2019, Indonesia Power melaksanakan program pengelolaan K3 sebagai berikut:
During 2019, Indonesia Power has organized the OHS program as follows:
Program Pengelolaan K3 Indonesia Power Tahun 2019Indonesia Power OHS Management Program in 2019
Waktu Pelaksanaan: 12 Januari - 12 Februari 2019Kegiatan: Apel K3, Aksi Sosial, Lomba Foto, Lomba Poster, Lomba Safety Control Center Terbaik, Lomba Video Tanggap Darurat Gempa Bumi dan Lomba Foto Instagram.Time: 12 January-12 February 2019Activities: OHS Socialization, Social Assistance, Photo Contest, Poster Contest, Best Safety Control Center Contest, Earthquake Emergency Response Video Contest, and Instagram Photo Contest.
Waktu Pelaksanaan: 25 September - 5 Desember 2020Kegiatan: Pemetaan kesiapan dan keandalan Fire Protection System Labuan OMU dan Adipala OMU mengacu pada regulasi internasional.Time: 25 September-5 December 2020Activities: Mapping the readiness and reliability of the Labuan OMU and Adipala OMU Fire Protection System with reference to the international regulations.
Waktu Pelaksanaan: 12 bulanKegiatan: Implementasi Industrial Cleaning Service di Pangkalan Susu OMU, Lontar OMU, Pelabuhan Ratu OMU, Barru OMU, dan Adipala OMU.Time: 12 monthsActivities: Industrial Cleaning Service at Pangkalan Susu OMU, Lontar OMU, Pelabuhan Ratu OMU, Barru OMU, and Adipala OMU
Waktu Pelaksanaan: Setiap triwulanKegiatan: Membuat pelaporan unsafe action dan unsafe condition dalam Aplikasi Nearmiss dan memonitor jumlah serta tindak lanjutnya dalam aplikasi dan Maximo.Time: QuarterlyActivities: Reporting any unsafe action and unsafe condition in the Nearmiss Application and monitoring the number of events and follow-up in the application and Maximo.
Pelaksanaan Bulan K3 Kantor PusatOHSMonthattheHeadOffice
Assessment Fire Protection Review ProgramsFire Protection Review Assessment Programs
Implementasi Industrial Cleaning ServiceIndustrial Cleaning Service Implementation
Pelaporan Nearmiss dalam Aplikasi NearmissReporting near miss in the Nearmiss Application
Waktu Pelaksanaan: Sesuai jadwal rendiklatKegiatan:TrainingdansertifikasiK3bagipegawaiIPsesuaidengan kebutuhan kompetensi bidangnya.Time: As per the training and education planning scheduleActivities:OHScertificationandtrainingforIP’semployeesinlinewiththeneedsoftheirfieldcompetencies.
Diklat dan Sertifikasi K3OHSCertificationandTraining
Waktu Pelaksanaan: April - DesemberKegiatan: Pemetaan gap dan deviasi penerapan K3 berdasarkan kriteria ISRS level 7 di Suralaya PGU dan Pelabuhan Ratu OMU.Time: April-DecemberActivities: Gap mapping and deviation of OHS application based on ISRS level 7 criteria at Suralaya PGU and Pelabuhan Ratu OMU.
Gap Asessment dan Pendampingan International Safety Rating System (ISRS)Gap Assessment and Assistance of the International Safety Rating System (ISRS)
Waktu Pelaksanaan: 2 - 3 September 2019Kegiatan: Melaksanakan refreshment P3K dan simulasi bagi pegawai bekerjasama dengan Building Management dan tenant lain di Centennial Tower.Time: 2-3 September 2019Activities: First Aid refreshments and simulations for employees in collaboration with Building Management and other tenants at Centennial Tower.
Waktu Pelaksanaan: 28 Februari 2019Kegiatan: Kerjasama untuk peningkatan kompetensi pegawai Indonesia Power yaitu pelatihan kemampuan SAR serta quick accessTime: 28 February 2019Activities: Collaboration to increase the competence of Indonesia Power’s employees: SAR skills training and quick access.
Waktu Pelaksanaan: 6-7 November 2019Kegiatan: Focus Group Discussion K3 dengan Tema “Standarisasi Pengelolaan K3 guna Mendukung Pencapaian Kinerja Korporat” yang diikuti oleh seluruh pengelola K3 seluruh unit.Time: 6-7 November 2019Activities: OHS Focus Group Discussion with the theme “Standardization of OHS Management to Support the Achievement of Corporate Performance”, attendend by all OHS managers in all units.
Simulasi Tanggap DaruratEmergency Response Simulation
MOU IP dengan BASARNASMOU of IP with BASARNAS
Focus Group Discussion K3OHS Focus Group Discussion
263 Sustainability Report 2019
PT Indonesia Power
Soci
al
Waktu Pelaksanaan: 29 April 2019Kegiatan: Mengintegrasikan Kurikulum Silabus (Kursil) training K3 dengan ruang lingkup Keselamatan Kelistrikan (K2) sehingga materi lebih sesuai untuk diimplementasikan di sektor kelistrikan.Time: 29 April 2019Activities: Integrating the OHS Syllabus training curriculum with the scope of Electricity Safety (K2) to be more suitable for the implementation in the electricity sector.
Integrasi Kursil K2 & K3Integration of K2 & K3 Syllabus
Waktu Pelaksanaan: 27 Agustus 2019Kegiatan: Membuat Surat Edaran Direksi dengan Nomor: 45.E/012/IP/2019untukkeseragamanspesifikasialatpelindungdiri(khususnyawearpack dan helmet) di seluruh unit pembangkit.Time: 27 August 2019Activities: Issued a Board of Directors’ Circular No. 45.E/012/IP/2019 foruniformspecificationsofpersonalprotectiveequipment(especiallywearpack and helmets) in all generating units.
Penetapan Pedoman Standardisasi APD KorporatEstablishment of Corporate PPE Standardization Guidelines
Waktu Pelaksanaan: 9-11 Oktober 2019 (Barru OMU) dan 18-20 November 2019 (Pangkalan Susu OMU)Kegiatan: Implementasi pengelolaan K3 secara terstruktur dan sistematis di unit pembangkit luar Jawa (Barru OMU dan Pangkalan Susu OMU).Time: 9-11 October 2019 (Barru OMU) and 18-20 November 2019 (Pangkalan Susu OMU)Activities: OHS management in a structured and systematic manner in the power plants outside Java (Barru OMU and Pangkalan Susu OMU).
Sertifikasi SMK3OHSMSCertification
Waktu Pelaksanaan: Setiap bulanKegiatan: Membuat kuis K3 yang dikirimkan ke seluruh email pegawai korporat sebagai media sosialisasi dan peningkatan pengetahuan pegawai terhadap informasi K3.Time: MonthlyActivities: OHS quiz is sent to all corporate employee e-mails as a medium of socialization and to increase employees’ knowledge of OHS.
Waktu Pelaksanaan: 11x dalam setahunKegiatan: Peningkatan koordinasi melalui komunikasi jarak jauh terkait pembinaan dan evaluasi kinerja K3 unit.Time: 11 times a yearActivities: Improved coordination through long distance communication related to coaching and evaluating OHS unit performance.
Sayembara Kuis (SAKU K3)Quiz (OHS SAKU)
Waktu Pelaksanaan: April dan September 2019Kegiatan: Pengadaan peralatan Tanggap Darurat Tsunami yang terdiri dari Senter, Life Jacket dan Perahu Karet yang didistribusikan ke beberapa unit yang berpotensi terkena tsunami.Time: April and September 2019Activities: Procurement of Emergency Tsunami Response equipment consistingofaFlashlight,LifeJacket,andInflatableBoat,distributedtoseveralunitsthatmaybepotentiallyaffectedbythetsunami.
Pengadaan Peralatan Tanggap Darurat Antisipasi TsunamiProcurement of Emergency Response Equipment for Tsunami Anticipation
Waktu Pelaksanaan: Juli dan Desember 2019Kegiatan: Melakukan penilaian kebersihan di unit pembangkit dengan kriteria yang telah ditetapkan sebagai upaya tercapainya unit pembangkit yang bersih, sehat dan aman.Time: July and December 2019Activities: Assessed the cleanliness at generating units with established criteriaasanefforttoachieveclean,healthy,andsafegeneratingunits.
Penilaian Kebersihan Unit PembangkitCleanliness Evaluation of Generating Units
Waktu Pelaksanaan: InsidentilKegiatan: Melakukan investigasi apabila terjadi kecelakaan kerja di unit pembangkit.Time: IncidentalActivities: Conducted investigation in the event there is a work accident at the generating unit.
Investigasi Kecelakaan KerjaOccupational Accident Investigation
Waktu Pelaksanaan: Setiap semesterKegiatan: Melakukan review prosedur - prosedur K3 sesuai dengan Proses Bisnis Perusahaan yang ter-update.Time: Every semesterActivities: Reviewed OHS procedures in accordance with the updated Company’s Business Process.
Review Prosedur KorporatReview of Corporate Procedures
Video Conference K3OHS Video Conference
264 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Program Peningkatan Keselamatan KerjaOccupational Safety Improvement Program
- Safety Briefing- Safety Patrol- Management Walktrough- Review Prosedur dan Instruksi Kerja-Sosialisasi,PelatihandanSertifikasiK3- Inspeksi Rutin Peralatan- Penyediaan dan Pemeliharaan Perlengkapan Fire Fighting dan
Alat Pelindung Diri (APD)- IdentifikasiRisikoyangTimbulbesertaMitigasinya- Awareness dan Kampanye Budaya K3 dan Sadar Safety kepada
Seluruh Pegawai- Implementasi ISRS 7- Implementasi Contractor Safety Management System (CSMS)- Implementasi Industrial Cleaning- Pembangunan Safety Control Center- Upgrade Infrastruktur K3- Assessment Kebersihan- Pelaporan unsafe action, unsafe condition dan nearmiss
melalui Aplikasi Nearmiss yang dapat diakses oleh seluruh pegawai
-SafetyBriefing- Safety Patrol- Management Walktrough- Review of Work Procedures and Orders-OHSSocialization,Training,andCertification- Routine Equipment Inspection- Provision and Maintenance of Fire Fighting Equipment and
Personal Protective (PPE) Equipment- IdentificationofRisksandTheirMitigation- OHS Culture Awareness and Campaign, and Safety Awareness
to All Employees- Implementation of ISRS 7- Contractor Safety Management System (CSMS)
Implementation- Industrial Cleaning Implementation- Safety Control Center Construction- OHS Infrastructure Upgrade- Cleanliness Assessment- Reporting unsafe actions, unsafe conditions, and near miss
through the Nearmiss Application that can be accessed by all employees
Perlengkapan Fire FightingEquipment Fire Fighting
Jumlah APAR (Buah)Fire Extinguishers (Unit)
7.700Mobil Damkar (Unit)
Fire Trucks (Unit)
15Mobil Ambulance (Unit)
Ambulance (Unit)
21
Program Peningkatan Kesehatan KerjaOccupational Health Improvement Program
- Medical Check Up secara berkala- Melakukan Health Risk Assessment di masing-masing area
kerja sesuai potensi bahayanya terhadap kesehatan- Memastikan ketersediaan dan penggunaan APD yang benar
dan standar- Monitoring dan pengukuran Lingkungan kerja-Sertifikasihygiene kantin- Adanya himbauan kepada seluruh unit dalam penempatan pegawaimempertimbangkanfaktorfisikdanmentalpegawaiyang dinyatakan sehat dalam bekerja berdasarkan riwayat kesehatan pegawai
- Memberikan extra fooding- Memberikan sosialisasi/penyuluhan kesehatan kerja- Kunjungan dokter Perusahaan ke pegawai dan konsultasi- Program olahraga setiap jumat, Zumba/Yoga/Pilates- Menyediakan fitness center- Regular Medical Check-up- Conducting Health Risk Assessment in each working area
according to the potential danger to health- Ensuring the availability and use of appropriate and standard
PPE - Monitoring and Assessment of work environment-Canteenhygienecertification- Appeal to all units to place employees by taking into account
the employees’ physical and mental factors who are declared healthy at work based on the employees’ health history
- Extra fooding provisions- Providing dissemination/outreach related to occupational
health- Visits of the Company’s doctors to employees and for
consultations- Sports program conducted on Friday: Zumba/Yoga/Pilates-Providingafitnesscenter
Program Pengelolaan Keselamatan dan Kesehatan KerjaOccupational Health and Safety Management Program
265 Sustainability Report 2019
PT Indonesia Power
Soci
al
Untuk meningkatkan pengetahuan, pemahaman dan keahlian insan pembangkitan terkait aspek K3, Indonesia Power telah mendirikan sebuah center of excellence berupa Fire Safety Academy. Lembaga pendidikan dan pelatihan yang berlokasi di Pandean Lamper, Semarang, Jawa Tengah ini menjadi pusat pelayanan beragam kebutuhan pelatihan, assessment dan konsultasi di bidang operasi pembangkit listrik yang mengedepankan aspek K3.
Dalam PKB Bab IV tentang Pembinaan dan Pengembangan Pegawai Pasal 22 tentang Pendidikan dan Pelatihan, Indonesia Power telah mengidentifikasi pelatihan K3 yang disediakanterdiri dari dua bentuk, yaitu Pendidikan Formal (D1/D3/S1/S2) dan Pendidikan Non Formal yang meliputi kursus, workshop, magang dan bentuk pelatihan lainnya. Selanjutnya, dalammengidentifikasiklasifikasipegawaiyangakandiberikansertifikasi dan pelatihan, Indonesia Power telah memilikikebijakan yang tertuang dalam Surat Keputusan Direksi Nomor 50.K/010/IP/2011 tentang Sistem Pembelajaran Pegawai dan Surat Keputusan Direksi Nomor 186.K/010/IP/2012 tentang Perubahan atas Keputusan Direksi No.38.K/010/IP/2009 tentang Sistem Manajemen Sumber Daya Manusia berbasis Kompetensi. Berdasarkan sifatnya, Indonesia Power telah membagiduajenissertifikasi,yaitusertifikasimandatory dan non mandatory. Sertifikasimandatory merupakan sertifikasiyang diwajibkan Perusahaan untuk setiap pegawai sebagai ketaatan terhadap peraturan yang berlaku. [EU16]
Pada tahun 2019, Indonesia Power telahmengklasifikasikanpegawai yang diberikan sertifikasi mandatory bidang K3 sesuai peraturan pemerintah yang berlaku di Indonesia dan persyaratan lainnya yaitu sebagai berikut:
Indonesia Power has established a center of excellence in the form of Fire Safety Academy to increase the knowledge, understanding, and expertise of the electricity generation’s personnel related to OHS. This education and training institution, located in Pandean Lamper, Semarang, Central Java, is a service center for various training, assessment, and consultation needs in the field of electricity generationoperations that prioritizes OHS aspects.
In CLA Chapter IV on Employee Training and Development Article22onEducationandTraining,IndonesiaPoweridentifiedthat the OHS training provided consists of two forms: Formal Education (Young Bachelor Degree, i.e. D1/D3; Bachelor’s Degree, and Master’s Degree), and Non-Formal Education, i.e. courses, workshops, internships, and other forms of training. Further, in identifying the employee classification who willbe provided with certification and training, Indonesia Powerhas a policy stipulated in the Board of Directors’ Decree No. 50.K/010/IP/2011 on the Employees’ Learning Systems, and the Board of Directors’ Decree No. 186.K/010/IP/2012 on the Amendment to the Board of Directors’ Decree No. 38.K/010/IP/2009 on the Competency-Based Human Resources Management Systems. Based on the nature, Indonesia Power classifiedtwodifferenttypesofcertification:mandatoryand-nonmandatory.Mandatorycertification isacertificationthatis required by the Company for every employee to comply with the prevailing regulations. [EU16]
In2019,IndonesiaPowerhasclassifiedemployeeswhohavebeengrantedmandatoryOHScertificationinaccordancewithapplicable government regulations in Indonesia and other requirements, as follows:
266 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Klasifikasi Pegawai yang Diberikan Sertifikasi dan Pelatihan K3 [EU16]Employees’ Classification by OHS Certification and Training [EU16]
No Dasar PerundanganLegal Basis
Judul Sertifikasi Certification
Akreditasi Accreditation
Jabatan Position
1 Peraturan Pemerintah R.I. Nomor 50 Tahun 2012 tentang Penerapan Sistem Manajemen Keselamatan dan Kesehatan KerjaGovernment Regulation of the Republic of Indonesia No. 50 of 2012 on the Implementation of the Occupational Health and Safety Management System
Auditor SMK3OHSMS Auditors
Kementerian KetenagakerjaanMinistry of Manpower
Supervisor Senior K3, Manajer yang membawahi bidang K3OHS Senior Supervisor, Manager in charge of OHS
2 Peraturan Menteri Tenaga Kerja R.I. Nomor Per-04/MEN/1987 tentang Panitia Pembina Keselamatan dan Kesehatan Kerja serta Tata Cara Penunjukan Ahli Keselamatan KerjaRegulation of the Minister of Manpower of the Republic of Indonesia No. Per-04/MEN/1987 on the Committee for Occupational Health and Safety, and Procedures for Appointing Work Safety Experts
Ahli K3 UmumGeneral OHS Expert
Kementerian KetenagakerjaanMinistry of Manpower
Supervisor/Supervisor Senior bidang K3OHS Supervisor/Senior Supervisor
3 Keputusan Menteri Tenaga Kerja R.I. Nomor KEP-186/MEN/1999 tentang Unit Penanggulangan Kebakaran di Tempat KerjaDecree of the Minister of Manpower of the Republic of Indonesia No. KEP-186/MEN/1999 on the Fire Fighting Units in the Workplace
Petugas Peran Kebakaran (Damkar D)FireOfficer(DamkarD)
Kementerian KetenagakerjaanMinistry of Manpower
- Operator Shift A/B/C/D- Pelaksana K3- Operators Shift A/B/C/D- OHS Implementors
Regu Penanggulangan Kebakaran (Damkar C)Fire Fighting Team (Damkar C)
Kementerian KetenagakerjaanMinistry of Manpower
- Operator Senior Shift A/B/C/D
- Pelaksana Senior K3- Senior Operators Shift
A/B/C/D- OHS Senior Executive
Kordinator Unit Penanggulangan Kebakaran (Damkar B)Fire Fighting Unit Coordinator (Damkar B)
Kementerian KetenagakerjaanMinistry of Manpower
- SP Operasi- Penyelia Dasar bidang K3- SP Operations- OHS Basic Supervisor
Ahli K3 Spesialis Penanggulangan Kebakaran (Damkar A)OHS Expert Fire Fighting Specialist (Damkar A)
Kementerian KetenagakerjaanMinistry of Manpower
Supervisor/Supervisor Senior K3OHS Supervisor/Senior Supervisor
4 Peraturan Menteri Tenaga Kerja R.I. Nomor Per.15/MEN/VIII/2008 tentang Pertolongan Pertama Pada Kecelakaan di Tempat KerjaRegulation of the Minister of Manpower of the Republic of Indonesia No. Per.15/MEN/VIII/2008 on the First Aid for Workplace Accidents
Petugas P3KFirstAidOfficer
Kementerian KetenagakerjaanMinistry of Manpower
- Pelaksana Senior K3- Perwakilan Operator Shift
A/B/C/D- Perwakilan bidang
Administrasi- Perwakilan Teknisi
Listrik/Mesin/Kontrol Instrumen.
- OHS Senior Executive- Operator Representatives
Shift A/B/C/D- Administration
Representatives - Representatives of
Electrical/Mechanical/Instrument Control Technicians.
Program Pengelolaan Keselamatan dan Kesehatan KerjaOccupational Health and Safety Management Program
267 Sustainability Report 2019
PT Indonesia Power
Soci
al
No Dasar PerundanganLegal Basis
Judul Sertifikasi Certification
Akreditasi Accreditation
Jabatan Position
5 Peraturan Menteri Tenaga Kerja R.I. Nomor 5 Tahun 2018 tentang K3 Lingkungan KerjaRegulation of the Minister of Manpower of the Republic of Indonesia No. 5 of 2018 on OHS in the Working Environment.
Ahli Hygiene Industri MudaYoung Hygiene Industry Expert
Kementerian KetenagakerjaanMinistry of Manpower
- Penyelia Dasar bidang K3- OHS Basic Supervisor
6 Peraturan Menteri Tenaga Kerja R.I. Nomor 5 Tahun 2018 tentang K3 Lingkungan KerjaRegulation of the Minister of Manpower of the Republic of Indonesia No. 5 of 2018 on OHS in the Working Environment.
Ahli Hygiene Industri MadyaMid Hygiene Industry Expert
Kementerian KetenagakerjaanMinistry of Manpower
- Penyelia Atas bidang K3- OHS Supervisor
7 International Sustainability Rating SystemInternational Sustainability Rating System
Auditor ISRSISRS Auditor
DNVGLDNVGL
- Penyelia Atas bidang K3- Supervisor for the OHS field
8 - National Examination Board in Occupational Safety and Health (NEBOSH)
BiroKlasifikasiIndonesiaIndonesian ClassificationBureau
- Manajer bidang K3, Penyelia Atas bidang K3
- OHS Manager, OHS Supervisor
Selama tahun 2019 Indonesia Power telah melakukan sertifikasiK3 kepada375personel danpelatihanK3 kepada466 personel dengan rincian sebagai berikut:
During2019,IndonesiaPowerhascarriedoutOHScertificationto 375 personnel and OHS training to 466 personnel with the following details:
Sertifikasi K3 Tahun 2019 [EU16]OHS Certification in 2019 [EU16]
Sertifikasi Ahli K3 Umum Level MudaYoungGeneralOHSExpertCertification
25 Personel Personnel
Sertifikasi Auditor SMK3OHSMSAuditorCertification
22 Personel Personnel
Sertifikasi Ahli K3 UmumGeneralOHSExpertCertification
25 Personel Personnel
Asesor ISRSISRS Assessor
25 Personel Personnel
Sertifikasi Petugas P3KFirstAidOfficerCertification
38 Personel Personnel
Sertifikasi Pemadam Kebakaran Tingkat A
LevelAFireFightingCertification
22 Personel Personnel
Sertifikasi Pemadam Kebakaran Tingkat C
LevelCFireFightingCertification
53 Personel Personnel
Sertifikasi Pemadam Kebakaran Tingkat B
LevelBFireFightingCertification
22 Personel Person nel
Sertifikasi Pemadam Kebakaran Tingkat D
LevelDFireFightingCertification
143 Personel Personnel
268 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Keselamatan dan Kesehatan Kerja KontraktorContractors’ Occupational Health and Safety
Untuk mendukung pelaksanaan bisnis pembangkitan yakni pada kegiatan konstruksi, operasi dan pemeliharaan, Indonesia Power melakukan kerjasama dengan berbagai kontraktor. Jenis pekerjaan yang dilakukan oleh kontraktor adalah repair dan installation (jasa operation & maintenance), kontruksi bangunan, pengadaan barang, jasa keamanan, jasa kebersihan dan landscape dengan rincian jumlah hari kerja kontraktor sebagai berikut: [EU17]
Indonesia Power cooperates with various contractors to support the electricity generation business, i.e. in the construction, operation, and maintenance activities. The contractors perform various types of work: repair and installation (operation & maintenance services), building construction, procurement of goods, security services, cleaning and landscape services, with details of the number of contractors working days as follows: [EU17]
Jumlah Hari Kerja Kontraktor Berdasarkan Jenis Pekerjaan [EU17]Number of Contractor Working Days by Type of Work [EU17]
No Unit
Jumlah Hari Kerja Kontraktor Number of Contractor Working Days
Konstruksi GedungBuilding Construction
Security Security
Jasa Operation & MaintenanceOperation & Maintenance Services
CleaningCleaning
Lainnya Others
1 Suralaya - 240 240 240 363
2 Priok 1.266 365 8.812 495 -
3 Kamojang - 823 494 494 576
4 Gunung Salak 260 365 822 224 102
5 Semarang 178 365 365 365 -
Pelatihan K3 Tahun 2019 [EU16, EU21]2019 OHS Training [EU16, EU21]
Training dan Workshop CSMSCSMS Training and Workshop
62 Personel Personnel
Refreshment Pertolongan Pertama Pada Kecelakaan (P3K) Kantor Pusat
First Aid to Accident Refreshment in the HeadOffice
107 Personel Personnel
Training Safety LeadershipSafety Leadership Training
22 Personel Personnel
Sosialisasi Kedaruratan Gempa BumiDissemination of Earthquake Emergency
200 Personel Personnel
Tanggap Darurat Kantor PusatHeadOfficeEmergencyResponse
50 Personel Personnel
In House Training (IHT) Hazard Identification, Risk Assessment and
Determine Control (HIRADC)In House Training (IHT) of Hazard Identification,RiskAssessment,and
Determine Control (HIRADC)
53 Personel Personnel
Program Pengelolaan Keselamatan dan Kesehatan KerjaOccupational Health and Safety Management Program
269 Sustainability Report 2019
PT Indonesia Power
Soci
al
Di tahun 2019, Indonesia Power baru memulai mengimplementasikan Contractor Safety Management System (CSMS) atau Sistem Manajemen Keselamatan Kerja Kontraktor di PLTU Banten 3 Lontar OMU. Hal ini bertujuan untuk memastikan kontraktor yang akan bekerja di lingkungan Perusahaan telah memiliki sistem manajemen K3 dan memenuhi persyaratan K3 pada setiap pelaksanaan aktivitas pekerjaan.
Implementasi CSMS di PLTU Lontar saat ini sampai tahap administratif yaitu seleksi danmengeluarkan sertifikatCSMSdimanasetelahdilakukanpenilaianprakualifikasi,makamitrakerjaakandiberikansertifikatberdasarkannilaiyangdidapat(masuk dalam mitra risiko rendah, tengah atau tinggi).
Mengingat bahwa tenaga kerja kontraktor terlibat dalam kegiatan berisiko tinggi, Indonesia Power memastikan bahwa seluruh kontraktor yang digunakan Perusahaan telah tersertifikasi sesuai dengan peraturan yang berlaku. Selainitu, sebelum memulai pelaksaan pekerjaan, Indonesia Power memberikan safety briefing kepada seluruh tenaga kerja kontraktor (100%) yaitu sebanyak 7.691 orang. [EU18]
In 2019, Indonesia Power has just started implementing a Contractor Safety Management System (CSMS) at SPP Banten 3 Lontar OMU. The implementation has the objective to ensure that the contractor who works in the Company’s environment has an OHS management system and meets the OHS requirements in every work activity.
The current CSMS at Lontar SPP has reached the administrative stage, i.e. selection, and issuance of CSMS certificate afterapre-qualificationassessment, inwhich thepartnerswill beawardedacertificatebasedonthevalueassessed(low,middle,or high-risk partners).
Indonesia Power ensures that all contractors of the Company are certified in accordance with the prevailing regulations,considering that the contractor’s workforce is involved in high-risk activities. In addition, before the contractor commenced the work, Indonesia Power provided a safety briefing to allcontractors’ workers (100%), i.e. 7,691 people. [EU18]
No Unit
Jumlah Hari Kerja Kontraktor Number of Contractor Working Days
Konstruksi GedungBuilding Construction
Security Security
Jasa Operation & MaintenanceOperation & Maintenance Services
CleaningCleaning
Lainnya Others
6 Grati 671 - 21.927 2.614 -
7 Saguling 176 365 1.208 247 53
8 Mrica 304 365 394 1.088 -
9 Bali - 242 1.507 239 687
10 Cilegon 523 365 6.610 1.182 582
11 Banten 1 Suralaya 119 247 5.417 247 -
12 Banten 2 Labuan - 247 247 5.928 -
13 Banten 3 Lontar - 244 315 244 -
14 Pelabuhan Ratu - 208 755 253 -
15 Adipala 1.229 356 12.993 1.095 -
16 Pangkalan Susu 247 364 247 295 -
17 Barru - 365 4.132 249 -
18 Jeranjang - 365 4.634 365 100
19 Sanggau 296 240 108 240 -
20 Sintang 10.912 8.432 28.521 13.888 -
21 Holtekamp - 161 276 276 276
270 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Perlindungan Keselamatan danKesehatan Bagi Masyarakat Sekitar [EU21]Safety and Health Protection forThe Surrounding Community [EU21]
Selain memberikan perlindungan K3 kepada pegawai dan kontraktor, Indonesia Power juga memberikan upaya perlindungan keselamatan dan kesehatan kepada masyarakat sekitar pembangkit yang tercantum dalam Surat Keputusan Direksi Nomor 41.K/010/IP/2012 tentang Kebijakan Keselamatan dan Kesehatan Kerja serta Lingkungan di PT Indonesia Power Bab V Pasal 8 tentang Perlindungan Masyarakat Umum. Hal ini merupakan kepatuhan Indonesia Power terhadap Undang-undang Ketenagalistrikan Nomor 30 Tahun 2009 Pasal 44 yang mengungkapkan bahwa setiap kegiatan usaha ketenagalistrikan wajib memenuhi ketentuan keselamatan ketenagalistrikan salah satunya bertujuan untuk mewujudkan kondisi aman dari bahaya bagi manusia dan makhluk hidup lainnya.
Indonesia Power telah membuat jadwal pengukuran lingkungan secara berkala untuk mencegah dampak pengoperasian pembangkit terhadap pekerja maupun masyarakat, seperti pengukuran kebisingan, udara ambient dan sumur pantai di masyarakat sekitar pembangkit. Selain itu pada tanggal 14 Agustus 2019, Indonesia Power juga melakukan sosialisasi K3 di PLTU Banten 2 Labuan bekerjasama dengan Badan Nasional Penanggulangan Bencana (BNPB), Badan Penanggulangan Bencana Daerah (BPBD) dan Pemerintah Kabupaten (Pemkab) Pandeglang dalam program Desa Tanggap Bencana Tsunami.
In addition to providing OHS protection to employees and contractors, Indonesia Power provides safety and health protection efforts to the community around the plant asstipulated in the Board of Directors’ Decree No. 41.K/010/IP/2012 on Occupational Health and Safety Policy within PT Indonesia Power Chapter V Article 8 regarding the Protection of the General Public. This is in compliance of Indonesia Power with Law No. 30 of 2009 Article 44 on Electricity, that regulates thateveryelectricitybusinessactivityshallfulfilltheelectricitysafety provisions, one of the objectives is to create a safe condition from danger to humans and other living things.
Indonesia Power compiled a schedule of regular environmental measurements to prevent the impact of plant operations on employees and the community, such as assessing the noise, air ambient, and coastal wells in the communities surrounding the plant. In addition, on 14 August 2019, Indonesia Power also conducted OHS dissemination at SPP Banten 2 in collaboration with the National Disaster Management Agency (BNPB), the Regional Disaster Management Agency (BPBD), and the Pandeglang Local Government (Pemkab) in the Village Tsunami Disaster Response program.
271 Sustainability Report 2019
PT Indonesia Power
Soci
al
Jika terjadi keadaan darurat, General Manager di unit akan memerintahkan koordinator tanggap darurat untuk segera mempersiapkan penanganan kondisi darurat serta mengkordinasikan dengan Badan Penanggulangan Bencana untuk mendapatkan informasi kondisi di sekitar unit, atau dengan Badan Nasional Pencarian dan Pertolongan (BASARNAS) apabila membutuhkan pertolongan pencarian korban.
Dalam kebijakan K3, Indonesia Power melakukan langkah pencegahan terhadap kecelakaan dan penyakit akibat kondisi tempat kerja yang tidak aman dan nyaman kepada masyarakat umum sekitar instalasi, pelanggan dan tamu yang berkaitan tempat kerja melalui sosialisasi, komunikasi dan kerjasama dengan baik. Dengan upaya tersebut, selama tahun 2019, tidak terdapat insiden terkait keselamatan dan kesehatan masyarakat akibat aktivitas operasi Perusahasan.
In the event of an emergency, the General Manager in the unit will instruct the emergency response coordinator to prepare the handling of emergency conditions and coordinate with the Disaster Management Agency to obtain information on the conditions surrounding the unit, or with the National Search andRescueAgency(BASARNAS)intheeventtheyneedtofindvictims.
In the OHS policy, Indonesia Power takes steps to prevent accidents and diseases due to unsafe and uncomfortable workplace conditions to the general public surrounding the installation, and to customers and guests in the workplace through good socialization, communication, and cooperation. During 2019, with these measures, there were no incidents related to public safety and health due to the Company’s operational activities.
272 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Kinerja Dan Evaluasi Keselamatandan Kesehatan KerjaPerformance and Evaluation of Occupational Health and Safety
Selama tahun 2019, terdapat dua kejadian kecelakaan kerja di unit kerja Indonesia Power yaitu pada tanggal 18 Oktober 2019 di PLTU Banten 2 Labuan OMU yang mengakibatkan satu orang mitra kerja mengalami luka bakar tingkat II A dan pada tanggal 23 Juli 2019 di PLTU Barru OMU yang mengakibatkan satu orang mitra kerja mengalami luka bakar tingkat I. Dari dua kejadian tersebut, tidak ada pihak yang meninggal akibat kecelakaan kerja.
Berikut data kecelakaan kerja yang terjadi pada tahun 2019 di lingkungan Indonesia Power. Perhitungan ini mengacu pada Keputusan Direksi Nomor 065.K/010/IP/2008 tentang Ketentuan Kecelakaan Dinas/Kerja.
During 2019, there were two occupational accidents at Indonesia Power’s work units. On 18 October 2019, one partner at SPP Banten 2 experienced a grade II A burn, and on23July2019,onepartnerattheSPPBarruOMUsufferedagrade I burn. Of the two accidents, no one died.
The following data is the work accident that occurred in 2019 in Indonesia Power’s environment. The calculation refers to the Board of Directors’ Decree No. 065.K/010/IP/2008 on Occupational Accidents Provisions.
Kinerja K3 Indonesia Power Tahun 2019 [GRI 403-2]Indonesia Power’s OHS Performance in 2019 [GRI 403-2]
Unit Bisnis Business Unit
FrequencyRate (FR) Severity Rate (SR) Occupational Desease
Rate (ODR) Absenteeism
Rate (AR)Work-Related
Fatality
PriaMale
Wanita Female
PriaMale
Wanita Female
PriaMale
Wanita Female
PriaMale
Wanita Female
PriaMale
Wanita Female
Suralaya PGU - - - - - - - - - -
Priok POMU - - - - - - - - - -
Kamojang POMU - - - - - - - - - -
Saguling POMU - - - - - - - - - -
Semarang PGU - - - - - - - - - -
Grati POMU - - - - - - - - - -
Mrica PGU - - - - - - - - - -
Bali PGU - - - - - - - - - -
Ulumbu - - - - - - - - - -PLTGU Cilegon OMUCCPP Cilegon OMU - - - - - - - - - -
PLTU Banten 1 Suralaya OMUSPP Banten 1 Suralaya OMU
- - - - - - - - - -
PLTU Banten 2 Labuan OMUSPP Banten 2 Labuan OMU
0,62 - 10 - - - - - - -
PLTU Banten 3 Lontar OMUSPP Banten 3 Lontar OMU
- - - - - - - - - -
PLTU Jawa Barat 2 Pelabuhan Ratu OMUSPP West Java 2 Pelabuhan Ratu OMU
- - - - - - - - - -
273 Sustainability Report 2019
PT Indonesia Power
Soci
al
Sebagai bentuk tanggung jawab Perusahaan terhadap kejadian kecelakaan kerja yang terjadi di tahun 2019 tersebut, Indonesia Power melakukan tindakan sebagai berikut:1. Melakukan pertolongan pertama pada korban oleh tim
tanggap darurat;2. Membawa korban ke Rumah Sakit untuk mendapatkan
pertolongan medis; dan3. Memberikan fasilitas perawatan kesehatan kepada pegawai
hingga penyembuhan.
Selanjutnya, Indonesia Power membentuk Tim Investigasi untuk melakukan investigasi lebih lanjut terkait penyebab kecelakaan kemudian membuat rekomendasi perbaikan terhadap kecelakaan tersebut dan memonitor tindak lanjutnya. Indonesia Power juga melakukan evaluasi menyeluruh dan menyusun tindakan corrective sebagai berikut:
As a form of Corporate responsibility for workplace accidents that occurred in 2019, Indonesia Power conducted the following actions:1. Providedfirstaidtothevictimbytheemergencyresponse
team;2. Brought the victim to the Hospital to get medical assistance;
and3. Provided health care facilities to employees up to recovery.
Further, Indonesia Power formed an Investigation Team to conduct investigations related to the cause of the accident, then make recommendations for improvement and monitor its follow-up. Indonesia Power also conducts a thorough evaluation and arranges corrective actions as follows:
Unit Bisnis Business Unit
FrequencyRate (FR) Severity Rate (SR) Occupational Desease
Rate (ODR) Absenteeism
Rate (AR)Work-Related
Fatality
PriaMale
Wanita Female
PriaMale
Wanita Female
PriaMale
Wanita Female
PriaMale
Wanita Female
PriaMale
Wanita Female
PLTU Adipala OMUSPP Adipala OMU - - - - - - - - - -
PLTU Pangkalan Susu OMUSPP Pangkalan Susu OMU
- - - - - - - - - -
PLTU Barru OMUSPP Barru OMU 1,57 - 63 - - - - - - -
PLTU Jeranjang OMUSPP Jeranjang OMU
- - - - - - - - - -
PLTU Sanggau OMUSPP Sanggau OMU - - - - - - - - - -
PLTU Holtekamp OMUSPP Holtekamp OMU
- - - - - - - - - -
Total 2,19 - 73 - - - - - - -
Keterangan Remark:Frequency Rate (FR) = Rasio Kekerapan Cidera = (Jumlah Kecelakaan*1.000.000)/Jumlah Jam KerjaSeverity Rate (SR) = Rasio Keparahan Cidera = (Jumlah hari kerja hilang*1.000.000)/Jumlah Jam Kerja OrangOccupational Desease Rate (ODR) = Tingkat Penyakit Akibat KerjaAbsenteeism Rate (AR) = Tingkat Ketidakhadiran = Total Hari Kerja yang Hilang karena Pegawai yang Mangkir/Total Hari KerjaWork-Related Fatality = Kematian terkait Pekerjaan = Jumlah yang Meninggal akibat PekerjaanFrequency Rate (FR) = (Number of Accidents*1,000,000)/Number of Working HoursSeverity Rate (SR) = (Number of lost working days*1,000,000)/Number of Employee’s Working Hours Occupational Disease Rate (ODR) = Rate of Occupational DiseaseAbsenteeism Rate (AR) Total Missing Working Days Due to Absent Employees/Total Working DaysWork-Related Fatality = Number of Deaths due to Work
274 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Tindakan Corrective atas Evaluasi Kinerja K3 [GRI 103-3]Corrective Actions on OHS Performance Evaluation [GRI 103-3]
Performance System Jangka Pendek
Short-Term Performance System
People SystemJangka Pendek
Short-TermPeople System
Process SystemJangka Pendek
Short-TermProcess System
Performance System Jangka Panjang
Long-TermPerformance System
People SystemJangka Panjang
Long-termPeople System
- Penggantian peralatan yang terindikasi rusak/upnormal;
- Melakukan pemeriksaan peralatan dan memastikan dalam kondisi baik; dan
- Memasang simbol-simbol safety/safety sign.
- Sosialisasi prosedur ke pegawai terkait dengan pekerjaan di bidangnya;
- Penyiapan petugas pengawas K3 internal yang tersertifikasiAK3U;
- Penyiapan petugas pengawas K3 yang tersertifikasiAK3Upadamitrakerja;
- Melakukan refreshment kepada semua Operator khususnya terhadap pemahaman sistem Breaker Aktif maupun Spare (Cara Rack-in, Rack-Out, Lock Out Tag Out (LOTO)); dan
- Melakukan refreshment P3K kepada seluruh pegawai terhadap pemahaman penanganan pertama pada kecelakaan terutama penanganan luka bakar.
- Melakukan review Standar Operasional Prosedur (SOP)/Instruksi Kerja (IK);
- Me-review Job Safety Analysis (JSA) pekerjaan;- Melakukan addendum dokumen pengadaan
mengacu kepada pedoman pembuatan kontrak yang memasukan aspek K3 yang diterbitkan oleh DIVHSSE PT PLN (Persero) Kantor Pusat;
- Melaksanakan manajemen Walkthrough/Safety Talk oleh Mananajemen kepada para Mitra Kerja;
- Melakukan Review Job Plan dan membuat checklist pemeriksaan Breaker; dan
- Menempatan Instruksi Kerja (IK) di ruang kerja atau peralatan.
- Replacement of equipment that is damaged/upnormal;
- Checking the equipment and ensuring that they are in good condition; and
- Installing safety symbols/signs.
- Dissemination of procedures to employees relatedtotheirworkingfields;
- Preparation of internal OHS supervisor who are AK3Ucertified;
- Preparation of partner’s OHS supervisor who is AK3Ucertified;
- Conducting refreshment to all Operators, especially the understanding of Active and Spare Breaker systems (How to Rack-in, Rack-Out, Lock Out Tag Out (LOTO)); and
- Conducting First Aid refreshment for all employeesontheunderstandingofthefirsthandling of accidents, especially burns.
- Reviewing Standard Operating Procedure (SOP)/Work Order (WO);
- Reviewing Job Safety Analysis (JSA);- Addendum on procurement documents referring to
guidelines for making contracts that include OHS aspects issued by DIVHSSE of PT PLN (Persero)’s HeadOffice;
- Conducting Walkthrough/Safety Talk by Management to Business Partners;
- Conducting Job Plan Review and compiling Breaker checklist; and
- Placing Work Order (WO) in the workspace or equipment.
-Membuatmodifikasiatauinovasiperalatan;- Menghindari masuknya debu batubara yang
berpotensi merusak peralatan; dan- Melakukan pemeriksaan secara rutin
khususnya saat pekerjaan Overhaul.
- Modifying or innovating equipment;- Avoiding the entry of coal dust which has the
potential to damage equipment; and- Conducting routine checks, especially during
Overhaul work.
- Memastikan Kompetensi Operator dalam melakukan pekerjaan dengan melakukan Training/ Workshop; dan
- Memastikan seluruh pegawai memahami penanganan pertama pada kecelakaan terutama penanganan luka bakar.
- Ensuring Operator Competence in carrying out work by conducting Training/Workshop; and
-Ensuringallemployeesunderstandthefirstaid of accidents, especially burns treatment.
Kinerja Dan Evaluasi Keselamatan dan Kesehatan KerjaPerformance and Evaluation of Occupational Health and Safety
275 Sustainability Report 2019
PT Indonesia Power
Soci
al
PLTU Banten 3 Lontar OMU:Pelopor ISRS Pembangkitan Listrik di IndonesiaSPP Banten 3 Lontar OMU:Pioneer of Electricity Generation ISRS in Indonesia
Indonesia Power PLTU Banten 3 Lontar OMU bukukan prestasi di awal tahun 2019. Melalui raihan Sertifikat International Sustainability Rating System (ISRS) pada 11 Januari, Lontar OMU menjadi Pelopor ISRS Pembangkitan Listrik di Indonesia sekaligus mendapat mandat dari PT PLN (Persero) sebagai PLTU Percontohan dalam penerapan aspek-aspek Keselamatan, Kesehatan Kerja dan Lingkungan (K3L) secara berkualitas dan berkesinambungan. PLTU Percontohan Lontar OMU adalah unit Indonesia Power yang mengelola PLTU Lontar yang merupakan salah satu proyek percepatan pasokan listrik 10.000 MW di pulau Jawa.
Dalam penugasannya, Lontar OMU senantiasa berupaya mengimplementasikan dan melakukan perbaikan di bidang K3L secara berkesinambungan. Prestasi ini adalah sebuah kesuksesan bersama Indonesia Power sebagai langkah yang baik untuk menjadikan Indonesia Power sebagai perusahaan yang lebih baik lagi. Ini merupakan hasil kerja keras, ikhlas dan cerdas dari seluruh insan PLTU Banten 3 Lontar OMU, dukungan dari Manajemen dan jajaran Direksi yang selalu terus menerus berkomitmen dalam bidang K3L, baik pada infrastruktur maupun budayanya.
ISRS merupakan sistem terdepan di dunia untuk mengukur dan memperbaiki kualitas sistem manajemen pada perusahaan agar dapat berjalan secara berkesinambungan, khususnya pada aspek K3L. Berawal dari penunjukan sebagai PLTU Percontohan, kemudian membangun serta meluncurkan program budaya Safety and Environment Culture (SECURE), akhirnya melalui serangkaian asessment ISRS yang dilakukan oleh DNV-GL, PLTU Banten 3 Lontar OMU dinyatakan sebagai perusahaan yang memenuhi persyaratan ISRS Level 4 dan berhak menerima sertifikat dariDNV-GL. ISRS merupakan metode yang tepat untuk menyinergikan antara perusahaan yang sustain, dengan kombinasi safety, environment dan quality. Indonesia Power yakin, Lontar OMU akan sukses menerapkan standar ISRS. Begitu pula dengan Indonesia Power secara korporat dan PLN yang akan sukses melaksanakan manajemen ISRS. Hingga akhirnya, PLN dan Indonesia Power memiliki kinerja yang unggul, menjadi perusahaan kelas dunia dan leading di industri pembangkitan.
Indonesia Power SPP Banten 3 Lontar OMU recorded achievement in early 2019. The SPP obtained the International Sustainability RatingSystem(ISRS)Certificateon11January.Thus,LontarOMUbecame the ISRS Pioneer of Electricity Generation in Indonesia and simultaneously received a mandate from PT PLN (Persero) as a Pilot Power Plant in the Occupational Health, Safety, and Environment (K3L) in high quality and in a sustainable manner. The Lontar OMU Pilot Power Plant is an Indonesia Power unit that manages the Lontar Power Plant which is one of the 10,000-MW electricity supply acceleration projects on Java island.
In his assignment, Lontar OMU strives to continuously implement andimprovetheHSEfield.ThisachievementisIndonesiaPower’ssuccess, which is a good step to make Indonesia Power a better company. This is the result of hard work, sincerity, and smartness of all employees at SPP Banten 3 Lontar OMU, as well as the support from Management and the Board of Directors who are always committed to the K3L field, both in infrastructure andculture.
ISRS is the world-leading system to assess and improve the quality of the management system in a company to run sustainably, specifically in the K3L aspect. SPP Banten 3 Lontar OMU isdeclared as a company that meets Level 4 ISRS requirements andreceived thecertificate fromDNV-GL.Thisstarted fromtheappointment as an SPP Pilot Project, building and launching the Safety and Environment Culture (SECURE) program, and a series of ISRS assessments conducted by DNV-GL. ISRS is the right method to synergize between sustainable companies, with a combination of safety, environment, and quality. Indonesia Power isconfidentthatLontarOMUwillsuccessfullyimplementtheISRSstandard. Likewise, Indonesia Power will be succeeded in carrying out the ISRS management at corporate level and PLN level. Finally, PLN and Indonesia Power shall have superior performance, be the world-class company, and the leading company in the generation industry.
General Manager Lontar OMU, Rahmat Lubis, menerima sertifikat ISRS saat Forum Leader Indonesia Power (11/1)The General Manager of Lontar OMU, Rahmat Lubis, received the ISRS certificate during the Indonesia Power Leaders Forum (11/1)
276 Laporan Keberlanjutan 2019PT Indonesia Power
Membina Kemitraan, Mendorong Kemandirian
Masyarakat Fostering Partnerships, Encouraging
Community Independence
SOSIAL SOCIAL
277 Sustainability Report 2019PT Indonesia Power
Indonesia Power ikut bertanggung jawab dan bersemangat untuk melakukan berbagai kegiatan pengembangan masyarakat
yang bertujuan untuk mendorong kemandirian masyarakat dalam jangka panjang. Upaya-upaya tersebut sebagai bentuk
komitmen Kami untuk senantiasa menjadi Perusahaan terdepan dalam pelaksanaan tanggung jawab sosal sehingga dampak
memberikan dampak positif yang signifikan kepada masyarakat di sekitar wilayah kerja Perusahaan.
Indonesia Power is responsible for and passionate to carry out various community development activities to encourage long-term community
independence. These efforts are a form of our commitment to always be the foremost Company in carrying out social responsibility to
provide significant positive impact on the communities surrounding the Company’s working areas.
278 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Pendekatan Manajemen Topik Masyarakat Lokal[GRI 103-1, 103-2, 103-3]Management Approach to Local Community [GRI 103-1, 103-2, 103-3]
Topik Masyarakat Lokal menjadi topik yang penting karena Indonesia Power percaya pertumbuhan kinerja Perusahaan harus seiring dengan pertumbuhan kualitas hidup dan kesejahteraan masyarakat sekitar. Bisnis Perusahaan yang sedang berkembang akan memberikan dampak langsung dan tidak langsung baik positif maupun negatif. Untuk itu, menjaga hubungan harmonis dan konstruktif dengan masyarakat lokal menjadi hal yang sangat penting.
Local Community is an important topic because Indonesia Power believes the growth of the Company’s performance shall be in line with the growth of the quality of life and welfare of the surrounding community. The Company’s developing business will have direct and indirect impacts, both positive and negative. Therefore, maintaining a harmonious and constructive relationship with the local community is crucial.
Kebijakan Perusahaan- Keputusan Direksi Nomor 25.K/010/IP/2015 tentang Pedoman
Tanggung Jawab Sosial dan Lingkungan Perusahaan tanggal 11 Februari 2015
- Keputusan Direksi Nomor 26.K/010/IP/2014 tentang Pedoman Pelaksanaan InPower CARE di Lingkungan PT Indonesia Power tanggal 11 Februari 2014
- Keputusan Direksi Nomor 51.K/010/IP/2014 tentang Pedoman Penilaian Kinerja Unit Bisnis untuk Kriteria Penilaian Pelaksanaan Community Development
- Keputusan Direksi No No 180.K/010/IP/2018 tentang Komitmen Community Development melalui Program Inspirasi Perempuan, tanggal 22 November 2018
- Keputusan Direksi 56.K/010/IP/2019 tentang Pengelolaan Program Unggulan Community Development di Lingkungan PT Indonesia Power, tanggal 28 Mei 2019
- Edaran Direksi Nomor 07.E/012/IP/2014 tentang Petunjuk Pelaksanaan Pemberian Bantuan Sosial Perusahaan tanggal 10 Maret 2014
Ketentuan Umum- Peraturan Pemerintah Nomor 47 Tahun 2012 tentang Tanggung
Jawab Sosial dan Lingkungan Perseroan Terbatas- Peraturan Pemerintah Nomor 47 tahun 2012 tentang Tanggung
Jawab Sosial dan Lingkungan Perseroan Terbatas- Peraturan Menteri Badan Usaha Milik Negara Nomor PER-09/
MBU/07/2016 tentang Program Kemitraan dan Bina Lingkungan Badan Usaha Milik Negara
Company’s Policies- Board of Directors’ Decree No. 25.K/010/IP/2015 on Guidelines
on Corporate Social and Environmental Responsibilities dated 11 February 2015
- Board of Directors’ Decree No. 26.K/010/IP/2014 on Guidelines on the Implementation of InPower CARE within PT Indonesia Power dated 11 February 2014
- Board of Directors’ Decree No. 51.K/010/IP/2014 on Guidelines on Business Unit Performance Assessment for Community Development Criteria Assessment
- Board of Directors’ Decree No. 180.K/010/IP/2018 on the Community Development Commitments through the Women’s Inspiration Program, dated 22 November 2018
- Board of Directors’ Decree No. 56.K/010/IP/2019 on Community Development Flagship Program Management within PT Indonesia Power, dated 28 May 2019
- Board of Directors’ Circular No. 07.E/012/IP/2014 on Guidelines for Corporate Social Assistance Implementation dated 10 March 2014.
General Provisions- Government Regulation No. 47 of 2012 on the Corporate Social
and Environmental Responsibility of Limited Liability Company- Government Regulation No. 47 of 2012 on the Corporate Social
and Environmental Responsibility of Limited Liability Company- Minister for State-Owned Enterprises Regulation No. PER-09/
MBU/07/2016 on the Partnership Program and the Community Development Program for State-Owned Enterprises
KebijakanPolicy
Membina Kemitraan, MendorongKemandirian Masyarakat Fostering Partnerships, Encouraging Community Independence
279 Sustainability Report 2019
PT Indonesia Power
Soci
al
- Meningkatkan efektivitas program pelibatan dan pengembangan komunitas untuk mendukung pencapaian kemandirian masyarakat; dan
- Meningkatkan pendapatan dan peluang usaha masyarakat.
- Increasingtheeffectivenessof community engagement and development programs to support the realization of community independence; and
- Improving community income and business opportunities.
- Merumuskan kegiatan dan program Community Involvement Development (CID);
- Menyesuaikan kebijakan-kebijakan CSR yang ada, sehingga menggunakan terminologi yang tepat sesuai ISO 26000 dan SDGs;
- Menentukan bersama target kontribusi per departemen kepada keberlanjutan bisnis dan SDGs serta sistem monitoring dan penghargaan/acknowledgement;
- Melakukan mapping atas dampak negatif lingkungan hidup (LH) dan merumuskan inovasi LH agar mencapai PROPER EMAS;
- Melakukan mapping atas risiko project baru, kebutuhan masyarakat dan mapping lainnnya; dan
- Membangun kesamaan persepsi tentang SDGs dan CSR holistik sesuai ISO 26000.
- Formulating Community Involvement Development (CID) activities and programs;
- Adjusting existing CSR policies to use the correct terminology in accordance with ISO 26000 and SDGs;
- Determining the contribution target of each department to business sustainability and SDGs, as well as monitoring and acknowledgment system;
- Mapping the negative environmental impacts (LH) and formulating LH innovations to achieve GOLD PROPER;
- Mapping the risks of new projects, community needs, etc.; and
- Cultivating common perceptions about SDGs and holistic CSR in accordance with ISO 26000.
- Terlaksananya kegiatan dan program Community Involvement Development (CID)
- Implementation of Community Involvement Development (CID) activities and programs
KomitmenCommitment
RealisasiRealization
Sasaran dan TargetGoals and Targets
Program Community Involvement Development (CID) melalui InPower CARE (Indonesia Power – Community Assistance, Relation and Empowerment) yang mencakup tiga pilar utama, yaitu:- Pelayanan Masyarakat (Community Assistance)- Pembinaan Hubungan (Community Relation)- Pemberdayaan Masyarakat (Community
Empowerment)
The Community Involvement Development (CID) program, through InPower CARE (Indonesia Power - Community Assistance, Relation, and Empowerment), covers three main pillars:- Community Assistance- Community Relation- Community Empowerment
Program/InisiatifProgram/Initiative
- Pengukuran Indeks Kepuasan Masyarakat
- Social Return on Investment Analysis
- Penanganan Keluhan Masyarakat
- Assessment of Community Satisfaction Index
- Social Return on Investment Analysis
- Handling Public Complaints
EvaluasiEvaluation
Kantor PusatBidang Komunikasi yang berada dibawah Sekretaris PerusahaanUnit KerjaManajer Administrasi, Manajer Keuangan dan Administrasi, Manajer SDM & Humas
Head OfficeHead of Communication Department, which is under the Corporate SecretariatsWork UnitAdministration Manager, Finance and Administration Manager, HR & Public Relations Manager
Penanggung JawabPerson in Charge
280 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Visi dan Misi CSR PerusahaanCompany’s CSR Vision and Mission
Program dan Perencanaan Program CSR [GRI 413-1]CSR Program and Program Planning [GRI 413-1]
Keterlibatan Pemangku KepentinganStakeholders’ Involvement
Pada setiap perencanaan dan pelaksanaan kegiatan CSR, Indonesia Power melibatkan masyarakat, pemerintah daerah setempat dan bahkan perusahaan lain di sekitar wilayah kerja Perusahaan. Ketiga elemen tersebut dilibatkan sejak dalam proses inisiasi, perencanaan (penyusunan rencana strategis dan rencana kerja) serta dalam proses monitoring dan evaluasi program, sehingga seluruh pihak memiliki andil terhadap keberhasilan progam yang dilaksanakan. Indonesia Power percaya banyak hal yang dapat dilakukan oleh Perusahaan dengan dukungan penuh dari pemangku kepentingan Perusahaan, khususnya masyarakat lokal di mana kami beroperasi.
Agar program CSR tersebut memberikan dampak yang signifikan terhadap masyarakat dan tepat sasaran, langkahawal dalam mengidentifikasi wilayah yang terdampaklangsung dengan kegiatan operasional Perusahaan melalui Analisis Mengenai Dampak Lingkungan (AMDAL). Hasil dari analisis tersebut, Perusahaan melakukan pemetaan sosial
In every CSR planning and implementation, Indonesia Power engages the community, local government, and other companies in the vicinity of the Company’s working area. These three elements have been involved since the initiation, planning (strategic plans and work plans), monitoring, and evaluation process. Thus, all parties participate in the success of the program implementation. Indonesia Power believes that the Company can achieve many things with the full support of the Company’s stakeholders, especially the local communities where we operate.
ToensurethattheCSRprogramhasasignificantimpactonthecommunity and on target, the initial step is to identify areas that are directly affected by theCompany’s operational activitiesthrough an Environmental Impact Assessment (AMDAL). From the analysis, the Company conducted a social mapping. In general, social mapping is conducted once a year to design
VisiVision
MisiMission
Bersahabat dengan lingkungan dan menjadikan tanggung jawab sosial Perusahaan sebagai bagian dari tata kelola Perusahaan yang baikTo be Environmentally Friendly and make corporate social responsibility as part of good corporate governance
1. Meningkatakan reputasi Perusahaan di kalangan pemangku kepentingan
2. Membangun sinergi Perusahaan dengan pemangku kepentingan untuk keberlanjutan operasional Perusahaan
3. Berkontribusi dalam meningkatkan kualitas pendidikan tingkat menengah
4. Meningkatkan kualitas hidup masyarakat melalui potensi yang dimiliki sesuai kemampuan Perusahaan
5. Berkontribusi dalam pencapaian Tujuan Pembangunan Berkelanjutan
1. Increasing the Company’s reputation among stakeholders
2. Building synergy of the Company with stakeholders for the Company’s operation sustainability
3. Contributing to improving the quality of secondary education
4. Improving the quality of life of the community through its potential in line with the Company’s capabilities
5. Contributing to the achievement of Sustainable Development Goals
281 Sustainability Report 2019
PT Indonesia Power
Soci
al
(social mapping). Biasanya pemetaan sosial dilakukan setiap satu tahun sekali guna mendesain strategi, pola dan rencana aksi pembinaan hubungan dengan masyarakat dan program CSR apa yang dibutuhkan oleh mereka. Program ini dicirikan sebagai sebuah pemberdayaan yang berkelanjutan yang dapat mengusung budaya dan kearifan lokal, yakni daerah-daerah yang menjadi lokasi unit Perusahaan guna mendorong kemandirian jangka panjang bagi masyarakat tersebut.
Pada tahun 2019, Indonesia Power melakukan pemetaan sosial di enam lokasi unit kerja yaitu PLTU Jeranjang OMU, PLTU Suralaya PGU, PLTU Adipala OMU, PLTD Senayan, PLTU Pelabuhan Ratu OMU dan Main Services Unit (MSU). Data wilayah pemetaan sosial secara lengkap dapat dilihat pada tabel berikut:
strategies, patterns, and action plans for public relations with the community and CSR programs that are necessary for the community. The program is characterized as continuous empowerment that upholds local culture and wisdom, i.e. the areas where the Company’s units are located to encourage long-term independence for the community.
In 2019, Indonesia Power carried out social mapping in six work units: SPP Jeranjang OMU, Suralaya PGU, SPP Adipala OMU, Senayan DPP, SPP Pelabuhan Ratu OMU, and the Main Services Unit (MSU). Complete social mapping data can be referred to in the following table:
Metode Pelaksanaan Program CSR Indonesia PowerIndonesia Power CSR Program Implementation Method
Kebijakan CSRCSR Policies
Social Mapping/
Baseline Study
Perencanaan Program CSRCSR Program
Planning
ImplementasiProgram CSRCSR Program
Implementation
Monitoring ProgramProgram
Monitoring
EvaluasiProgramProgram
Evaluation
KeberlanjutanProgramProgram
Sustainability
1 2 3 4 5 6 7
Unit KerjaWork Unit
Jumlah Desa/KelurahanNumber of Villages/Urban
Villages
Nama Desa/KelurahanVillages/Urban Villages
Suralaya PGU & PLTU Banten 1 Suralaya OMU
4 Kelurahan 4 Urban Villages Pulo Merak, Suralaya, Lebak Gede, Salira
Priok POMU 3 Kelurahan 3 Urban Villages Warakas, Tanjung Priok, AncolSaguling POMU 10 Desa 10 Villages Cikande, Rajamandala Kulon, Saguling, Jati, Cipangeran, Girimukti,
Bojong Haleuang, Cihampelas, Mekar Jaya, Tanjung JayaMrica PGU 8 Desa 8 Villages Binorong, Blambangan, Bawang, Tapen, Wanadadi, Karang Kemiri,
Bandingan, LengkongSemarang PGU 4 kelurahan 4 Urban Villages Tanjung Mas, Kemijen, Tugurejo, Gunung PatiGrati POMU 11 Desa 11 Villages Jatirejo, Rowo Gempol, Pasinan, Wates, Balunganyar, Gejugjati,
Tambak Lekok, Branang, Alastlogo, Tampung, SemedusariBali PGU – PLTGU Pemaron 2 Desa 2 Villages Pemaron, Tukad MunggaBali PGU – PLTG Gilimanuk 1 Desa 1 Village GilimanukBali PGU – PLTD Pesanggaran
1 Kelurahan, 3 Desa 1 Urban Village, 3 Villages
Pedungan, Gunaksa, Saba, Taro
MSU 1 Kelurahan 1 Village Kota Bambu SelatanKantor Pusat HeadOffice 3 Kelurahan 3 Urban Village Tegal Parang, Kuningan Timur, SetiabudiKamojang POMU 4 desa 4 Villages Cibunian, Purbawakti, Kabandungan, PulosariKamojang Darajat POMU 6 desa 6 Villages Karyamekar, Padaawas, Ibun, Sukakarya, Mekarwangi
Pelaksanaan Pemetaan Sosial Tahun 2019 [GRI 413-1]Social Mapping in 2019 [GRI 413-1]
282 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Dari hasil pemetaan sosial tersebut, terungkap adanya 19 Kelurahan dan 82 desa yang menjadi fokus pembinaan program CSR Perusahaan. Seluruh Kelurahan dan Desa tersebut dibina oleh masing-masing 29 Unit Kerja Perusahaan. Selanjutnya Indonesia Power melibatkan diri bersama-sama masyarakat untuk menyusun program CSR sesuai dengan sumber daya yang tersedia dan kondisi sosial dan budaya masyarakat di masing-masing wilayah.
Pada tahun 2019, sebanyak 86% unit di wilayah kerja perusahaan telah melaksanakan program CSR.
The social mapping result revealed that there were 19 Urban Villages and 82 Villages as the focus of the Company’s CSR program development. All of the Urban Villages and Villages are fostered by 29 Company’s Work Units. Further, Indonesia Power involves the community to arrange CSR programs in accordance with available resources and the social and cultural conditions of the community in each region.
In 2019, 86% of units in the Company’s working area have implemented CSR programs.
Persentase Wilayah Kerja yang Melaksanakan Program CSR [GRI 413-1] Percentage of Working Areas that Implement CSR Programs [GRI 413-1]
Unit KerjaWork Unit
Jumlah Unit KerjaNumber of Work Units
Jumlah Wilayah Kerja yang Melaksanakan Program Pengembangan Masyarakat
Number of Working Areas Implementing Community Development Programs
% Wilayah Kerja yang Melaksanakan Program Pengembangan Masyarakat
% Working Areas Implementing Community Development Programs
Kantor Pusat HeadOffice 1 1 100%
PGU 4 4 100%
POMU 4 4 100%
OMU 12 3 75%
MSU 1 1 100%
Total 22 19 86%
Unit KerjaWork Unit
Jumlah Desa/KelurahanNumber of Villages/Urban
Villages
Nama Desa/KelurahanVillages/Urban Villages
PLTGU Cilegon OMU 3 Desa 3 Villages Margasari, Argawana, BanyuwangiPLTU Jeranjang OMU 1 Desa 1 Villages Taman AyuPLTU Barru OMU 1 Desa 1 Villages LampokoHoltekamp POMU 2 Kelurahan 2 Urban Villages Koya Barat, Koya TimurPLTU Pangkalan Susu OMU 3 Desa 3 Villages Pulau Sembilan, Tanjung Pasir, Pintu AirPLTU Jawa Tengah 2 Adipala OMU
4 Desa 4 Villages Bunton, Wlahar, Penggalang, Adipala
PLTU Jawa Barat 2 Pelabuhan Ratu OMU
4 Desa 4 Villages Cidadap, Loji, Jayanti, Citarik
PLTU Banten 2 Labuan OMU
5 Desa 5 Villages Cigondang, Sukamaju, Margagiri, Margawana, Teluk
PLTD Karimunjawa 4 Desa 4 Villages Parang, Kemojan, Nyamuk, KarimunjawaPLTP Ulumbu 1 Desa 1 Villages ManggaraiPLTU Sanggau OMU 1 Desa 1 Villages Sei BatuPLTU Banten 3 Lontar OMU 2 Desa 2 Villages Lontar, KaranganyarPLTU Sintang OMU 3 Desa 3 Villages Sungai Ringin, Anggah Jaya, KedabahPLTM Harjosari 3 Desa 3 Villages Bojongkoneng, Notogiwang, WerdiPLTM Lambur 2 Desa 2 Villages Kandang Serang, LamburPLTD Senayan 1 Kelurahan 1 Urban Villages Grogol Utara
Program dan Perencanaan Program CSR [GRI 413-1]CSR Program and Program Planning [GRI 413-1]
283 Sustainability Report 2019
PT Indonesia Power
Soci
al
Pelaksanaan program tanggung jawab sosial dan lingkungan Indonesia Power didasari oleh komitmen untuk membina dan mengembangkan potensi masyarakat guna mendorong kemandirian jangka panjang. Kegiatan dan program yang dilaksanakan juga disesuaikan dengan upaya Indonesia Power dalam rangka mendukung pencapaian Tujuan Pembangunan Berkelanjutan (Sustainable Development Goals – SDGs).
Komitmen ini kemudian diejawantahkan melalui program InPower Care. Sesuai dengan namanya, InPower CARE (Indonesia Power – Community Assistance, Relation and Empowerment) mencakup tiga pilar utama, yaitu (1) Pelayanan Masyarakat (Community Assistance), (2) Pembinaan Hubungan (Community Relation) dan (3) Pemberdayaan Masyarakat (Community Empowerment). Melalui ketiga pilar tersebut, Indonesia Power berperan aktif dalam mengembangkan potensi-potensi ekonomi masyarakat seraya mendorong masyarakat untuk mandiri demi peningkatan kualitas hidup dan kesejahteraan masyarakat.
Indonesia Power implements the social and environmental responsibility program with reference to the commitment to fostering and developing the potential of the community to encourage long-term independence. The activities and programs carried out are also adjusted to Indonesia Power’s efforts to support the achievement of the SustainableDevelopment Goals (SDGs).
This commitment is then manifested in the InPower Care program. InPower CARE (Indonesia Power - Community Assistance, Relation, and Empowerment) covers three main pillars: (1) Community Assistance, (2) Community Relations, and (3) Community Empowerment. Through these three pillars, Indonesia Power plays an active role in developing the economic potential of the community, while simultaneously encouraging community independence to improve the community’s quality of life and welfare.
Program CSR 2019 [GRI 413-1]2019 CSR Program [GRI 413-1]
Tiga Pilar Utama Program InPower CARE Three Main Pillars of the InPower CARE Program
1. Bantuan Sarana dan Prasarana Infrastructure Support2. Bantuan Pelayanan Kesehatan Medical Care Support3. Bantuan Pelayanan Pendidikan Education Support4. Bantuan Bencana Alam Disaster Relief
1. Komunikasi Sosial Social Communication2. Partisipasi Peringatan Hari Besar Participating in Feast Day Celebration3. Partisipasi Kegiatan Masyarakat Participating in Community Activity
1. Bantuan Pengembangan dan Modal Usaha Development and Venture Capital
Support2. Bantuan Peningkatan Keterampilan Improvement Skills Support3. Bantuan Pemasaran Produk Marketing Product Support4. Riset dan Pengembangan Research and Development
Bakti Pembinaan HubunganCommunity Relations
Bakti Pelayanan MasyarakatCommunity Assistance
Bakti Pemberdayaan MasyarakatCommunity Empowerment
284 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Bakti Pembinaan Hubungan [GRI 413-1]Community Relations [GRI 413-1]
Bakti pembinaan hubungan merupakan kegiatan komunikasi dua arah yang dilakukan untuk memfasilitasi tumbuhnya pemahaman bersama dan mewujudkan komitmen bersama diantara para pemangku kepentingan untuk mencapai tujuan bersama, mendorong lahirnya sikap positif komunitas terhadap Perusahaan serta memperbaiki dan mendorong lahirnya kebijakan publik yang kondusif terhadap keberlangsungan bisnis Perusahaan. Program ini salah satunya direpresentasikan melalui program IP Pintar.
Community relations is an activity to conduct two-way communication to cultivate the growth of shared understanding and realize joint commitment among stakeholders to achieve common goals, encourage positive community attitudes towards the Company, and improve and encourage the conducive public policies to the sustainability of the Company’s business. One of the programs is IP Pintar (Smart IP) program.
SEHAT-IP merupakan program kegiatan inovasi Perusahaan dalam rangka meningkatkan kualitas kesehatan masyarakat yang terintegrasi dengan pendidikan, lingkungan dan ekonomi. Program ini direalisasikan melalui kegiatan: Pelayanan kesehatan melalui Klinik Bakti Indonesia Power, pusat layanan bagi orang dengan gangguan jiwa, pemberian makanan tambahan bagi balita dengan berat di bawah garis merah, pemeriksaan kesehatan dan pengobatan gratis, pembangunan dan perbaikan sarana sanitasi, renovasi rumah menjadi layak huni, kegiatan donor darah, khitan massal, peningkatan skill bagi tenaga medis melalui program Jumpa Bakti Desa Siaga (Jambadega) dan lain-lain.
SEHAT-IP is the Company’s innovation activity to improve the quality of public health, integrated with education, the environment, and the economy. This program is implemented through several activities: Health services, through the Bakti Indonesia Power Clinic, a service center for people with mental disorders, supplementary feeding for children under the weight of the red line, free medical check-up and medication, construction and repair of sanitation facilities, house renovation to be livable decent housing, blood donor activities, mass circumcision, skill enhancement for medical personnel through the Jumpa Bakti Desa Siaga (Jambadega) program, etc.
Program dan Perencanaan Program CSR [GRI 413-1]CSR Program and Program Planning [GRI 413-1]
Bakti Pelayanan Masyarakat [GRI 413-1] Community Assistance [GRI 413-1]
Bakti pelayanan masyarakat merupakan program yang dilakukan untuk memperbaiki kualitas lingkungan, memberikan dukungan terhadap pembangunan yang dilakukan oleh masyarakat dan pemerintah setempat di sekitar wilayah operasi Perusahaan. Program ini diimplementasikan melalui program SehatIP dan Hijaunesia Power.
Community assistance is a program to improve the quality of the environment, provide support for the community development and local government surrounding the Company’s operational areas. This program is implemented through the SehatIP and Hijaunesia Power programs.
285 Sustainability Report 2019
PT Indonesia Power
Soci
al
Program IP-PINTAR merupakan program lintas sektoral dalam pelaksanaannya melibatkan stakeholder utama IP-Group. Implementasi IP PINTAR telah dilakukan di Pulau Jawa, Sulawesi dan Kalimantan yang seiring dengan penambahan lokasi unit kerja IP Group. Melalui program ini diharapkan ke depannya penyerapan tenaga kerja lokal akan meningkat.
IP-PINTAR program is a cross-sectoral program that involves the key stakeholder, IP-Group, in its implementation. IP PINTAR has been carried out in Java, Sulawesi, and Kalimantan, along with the addition of IP Group work unit locations. This program is expected to increase the local manpower absorption in the upcoming years.
Program Perusahaan1. Kesiapan penyediaan SDM untuk pengembangan
usaha dan sustainability Perusahaan2. Program Pemberdayaan Masyarakat melalui
PendidikanCompany’s Programs1. HR provision readiness for business development
and corporate sustainability2. Community Empowerment Program through
Education
Manfaat Bagi Siswa1. Mendapatkansertifikasiprofesi2. Memperoleh peluang besar rekrutmen IP GroupBenefits For Students1. Obtainingaprofessionalcertification2. Having the great opportunity to be recruited to
IP Group
Manfaat Bagi Sekolah1. Link & Match sekolah dengan industri2. Pengkayaan kurikulum berbasis industriBenefits For Schools1. Link & Match the schools with the industry2. Enrichment of industry-based curriculum
Manfaat Bagi Perusahaan1. Man power planning, rekrutmen, on boarding training yang terintegrasi2. Integrated CSR with businessBenefits For The Company1. Integrated manpower planning, recruitment, on boarding training2. Integrated CSR with business
Program Pemerintah1. Pembangunan sektor ketenagalistrikan 35GW2. Tantangan SDM menghadapi MEA, melalui kebijakan:
a. StandarisasidanSertifikasiProfesib. Program peningkatan SDM, khususnya di
Sekolah Kejuruan dan VokasiGovernment Programs1. Development of the 35GW electricity 2. HR challenges facing MEA, through policies:
a. Professional Standardization and Certification
b. HR improvement programs, especially in Vocational Schools
Bakti Pemberdayaan Masyarakat [GRI 413-1]Community Empowerment [GRI 413-1]
Bakti pemberdayaan masyarakat merupakan program yang berkaitan dengan usaha memberikan akses yang lebih luas kepada masyarakat setempat untuk menunjang kemandiriannya.
Community empowerment is a program related to efforts inproviding wider access to local communities to support their independence.
286 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
No. Unit Kerja Work Unit Program
1 Kantor PusatHeadOffice
- IP Pintar- Employee Voluntary Program (EVP)
2 Suralaya PGU - Omah Kreteg Omah Kreteg- Pemberdayaan Orang Dengan Gangguang Jiwa (ODGJ) Empowerment of People with Mental Disorders (ODGJ)- Pelita FABA Pelita FABA - Pelangi (Penghijauan Lahan Gersang Kritis) Suralaya Pelangi (Critical Dry Land Greening) Suralaya
3 Priok POMU - PAUD Inklusi ECED Inclusions- Taman Hatinya Sunter Sunter’s Heart Park (Taman Hatinya Sunter)- Kampung Sehat HIjaunesiaPower HIjaunesiaPower Health Village - Rumah Kreatif & Inovasi Anak Muda Creative Home & Youth Innovation- Rojali di Ancol Rojali in Ancol
4 Kamojang Darajat POMU - Pengembangan Kopi Pelag DevelopmentofPelagCoffee- Pelagio Café Pelagio Café - Budidaya dan pengolahan makanan Jamur Tiram Oyster Mushroom cultivation and food processing- Program Citarum Harum melalui Sabilulungan Tanam Pohon Kesayangan (SATAPOK) Citarum Harum Program through Sabilulungan Tanam Pohon Kesayangan (SATAPOK/Planting your
Favourite Trees)- Kampung Camilan Kamojang Kamojang Snack Village- Olahan Ikan Situ Bagendit “Laux Leutix” Processed Situ Bagendit Fish “Laux Leutix”
5 PLTP Gunung Salak - Program pengembangan biogas dan bioslurry Biogas and bioslurry development programs- Program agribisnis penggemukan domba Sheep fattening agribusiness program- Program agribisnis budidaya ikan mas dan ikan nila Carp and tilapia farming agribusiness program - Pengelolaan Taman Nasional Gunung Halimun – Salak Management of Guung Halimun - Salak National Park
6 Pangkalan Susu OMU Budidaya Ikan Kerapu Grouper Cultivation
7 Banten 1 Suralaya OMU - Bank Sampah Waste Bank - Taman Hutan Kota Cilegon Cilegon Forest Park
8 Banten 2 Labuan OMU - Bank Sampah KPPST Lestari Lestari KPPST Waste Bank- Pengembangan Wisata Pantai Laser Laser Beach Tourism Development
9 Banten 3 Lontar OMU - Sekolah Adiwiyata Adiwiyata School- Budidaya Pepaya California California Papaya Cultivation- Bank Sampah Waste Bank
10 Saguling POMU - Ternak Itik Sawargi 1 & 2 Sawargi Duck 1 & 2- Ternak Domba Sheep Livestock- Pemanfaatan Limbah Eceng Gondok Utilization of water hyacinth waste- Kerajian Bambu Bambaray Bambaray Bamboo Craft
11 Mrica POMU - Konservasi Kopi Desa Pegundungan ConservationofCoffeefromPegundunganVillage- Industri Makanan Ringan “Selaras” The “Selaras” Snack Industry- Mrica Corner Mrica Corner
12 Semarang POMU - Batik Mangrove Mangrove Batik- KUB Prima Indo Sutera KUB Prima Indo Sutera- UKM Olahan Ikan Laut Processed Sea Fish SME- Pokdarwis Kampung Alam Malon Alam Malon Village Group
13 Perak Grati POMU - Rumah kompos Desa Ranuklindungan Ranuklindungan Village compost house- Sentra Bahari Jati Rejo Sentra Bahari Jati Rejo - Rumah kerajinan batik “Bungkoh Batik Listyo” Desa Rowogempol Batik craft house “Bungkoh Batik Listyo” at Rowogempol Village- Pengembangan Ekowisata Taman KEHATI Jombang Development of Jombang KEHATI Park Ecotourism- Desa Mandiri Energi Desa Balunganyar Balunganyar Energy Independent Village
14 Bali POMU - Tempat Olah Sampah Setempat (TOSS) Local Trash Can (TOSS)- Srati Banten Srati Banten- Pelestarian Tukik Hatchling Conservation- Pelestarian Lembu Putih Taro White Taro Ox Conservation- KOS LISA KOS LISA
Program Unggulan Bakti Pemberdayaan Masyarakat Tahun 2019 [GRI 413-1]Flagship Community Empowerment Program in 2019 [GRI 413-1]
Program dan Perencanaan Program CSR [GRI 413-1]CSR Program and Program Planning [GRI 413-1]
287 Sustainability Report 2019
PT Indonesia Power
Soci
al
No. Unit Kerja Work Unit Program
15 Barru OMU Pengolahan Makanan berbahan Ikan Fish-to-Food Processing
16 Jeranjang OMU Budidaya Jamur Tiram Oyster Mushroom Cultivation
17 Palabuhan Ratu OMU - Bank Sampah Cipta Madani Cipta Madani Waste Bank- Rumah Abon Ikan Marlin Marlin Fish Floss House- Handcraft Mahabbaturrosul Handcraft Mahabbaturrosul- Konservasi Talanca Beach Menjadi Destinasi Wisata Surfing TalancaBeachConservationtobeSurfing
Destination18 Adipala OMU - KWTPI Sidamegar KWTPI Sidamegar
- Batik Seloka Seloka Batik- Batik Praja Praja Batik- Bank Sampah Bumdes Putra Kusuma Putra Kusuma Waste Bank Village-Owned Enterprise
19 Cilegon OMU - Bank Sampah Resik Jeliger Resik Jeliger Waste Bank- Ternak Kambing Komunal Communal Goat Cattle
Program Unggulan Tahun 2019Flagship Programs in 2019
Program CSR Indonesia Power dirancang agar sesuai dengan daerahnya, tepat guna, padat karya tetapi tidak padat modal. Program didesain agar sejalan dengan upaya pelestarian lingkungan, meskipun tujuan utamanya adalah untuk memberdayakan dan memandirikan masyarakat. Di antara sejumlah kegiatan tanggung jawab sosialnya, Indonesia Power memiliki program-program yang diunggulkan karena bersifat inovatif serta memiliki dampak positif yang signifikan bagikesejahteraan masyarakat.
Indonesia Power’s CSR program is designed to suit the region,effective,andlabor-intensive,butnotcapitalintensive.The program is designed to be in line with environmental conservationefforts,with themainpurposetoempowerandensure the community’s independence. Indonesia Power has flagshipprogramsamongseveralsocialresponsibilityactivitiesthat are considered superior as the programs are innovative andhaveasignificantpositiveimpactonpeople’swelfare.
288 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Employee Voluntary Program (EVP): Mendorong Peran Aktif Pegawai dalam Kegiatan CSREmployee Voluntary Program (EVP): Encouraging the Active Role of Employees in CSR Activities
No. Tanggal Date
Sekolah/ KomunitasSchool/Community
Materi Material
Jumlah Volunteer
Total Volunteers
Jumlah SiswaTotal
Students1 4 Agustus
4 August Komunitas PAY Lebah PAY Lebah Community
Pengenalan jenis pembangkit dan cooking classIntroduction to type of power plant and cooking class
2 40
2 16 Agustus16 August
SD Negeri Kuningan Timur 01State Elementary School Kuningan Timur 01
Keterampilan kerajinan tangan, fun games soft skill penyelesaian masalah, kerja sama tim dan kecepatan anak-anakCraft skills, fun games for problem solving soft skills, teamwork, and speed
15 98
3 30 Agustus30 August
Karang Taruna Sub Unit 006/09 Kebayoran BaruKarang Taruna Sub Unit 006/09 Kebayoran Baru
Fun games soft skill penyelesaian masalah, kerja sama tim dan kecepatan anak-anakFun games for problem solving soft skills, teamwork, and speed
2 40
4 30 Agustus30 August
SD Negeri Pondok Pinang 01State Elementary School Pondok Pinang 01
Rangkaian listrik sederhanaSimple electrical circuit
2 40
5 15 September15 September
Komunitas Save Street Child Pondok RanjiSave Street Child Pondok Ranji Community
Cita-cita dan kesehatan gigi dan mulutAspirations and oral health
2 40
6 18 September18 September
SD Islam Terpadu YPI 45 BekasiIntegrated Islamic Elementary School YPI 45 Bekasi
Gaya hidup greenGreen lifestyle
2 80
7 25 September25 September
TK TPA Al-Quran Al-Hikmah RawalumbuKindergarten TPA Al-Quran Al-Hikmah Rawalumbu
Pengenalan jenis dan operasi pembangkit Introduction to power plant types and operations
1 40
Total 378
Data Kegiatan EVP selama Tahun 2019EVP Activities in 2019
Program dan Perencanaan Program CSR [GRI 413-1]CSR Program and Program Planning [GRI 413-1]
Dibawah payung besar IP Pintar, Indonesia Power kembali meluncurkan sebuah program CSR di bidang Pendidikan yakni Employee Voluntary Program (EVP). EVP merupakan inisiasi program sosial untuk membagikan semangat, pengetahuan, wawasan dan keterampilan volunteer kepada masyarakat.
Adapun tujuan dari kegiatan ini adalah untuk mengimplementasikan CSR dengan pelibatan dan pengem bangan komunitas, mendukung tercapainya SDGs dalam penyelenggaraan pendidikan yang berkualitas dan menyalurkan keterampilan pegawai sesuai minat dan bakat, serta memberikan kontribusi langsung dalam memberdayakan masyarakat. Pada tahap awal, program ini dilakukan oleh 26 pegawai di Kantor Pusat, ke depannya akan dilakukan di seluruh unit kerja.
Under the IP Pintar, Indonesia Power launched a CSR programinthefieldofEducation,i.e.theEmployeeVoluntaryProgram (EVP). EVP is a social program initiation to share the spirit, knowledge, insights, and skills of volunteers with the community.
The activity has the objective to implement CSR that involves and develops the community, supports the achievement of SDGs by providing quality education, and channel employee skills according to their interests and talents, as well as, contribute directly to empowering the community. In its initial stage, the program was conducted by 26 employees attheHeadOffice.Inthefuture,theprogramwillbecarriedout in all work units.
289 Sustainability Report 2019
PT Indonesia Power
Soci
al
Satya Gawa: Akses Layanan Kesehatan bagi ODGJSatya Gawa: Access to Healthcare Services for ODGJ
Satya Gawa merupakan program pelayanan kesehatan mental dan pemberdayaan bagi para Orang Dengan Gangguan Jiwa (ODGJ) yang diinisiasi oleh PLTU Suralaya PGU di kawasan Pulo Merak – Suralaya. Layanan kesehatan tersebut diberikan secara gratis dan dilaksanakan dua kali dalam sebulan di Pos Jiwa Terpadu (POS JITU) yang berada di kawasan Babakan Turi, Kelurahan Taman Sari. Selain pelayanan kesehatan, Satya Gawa juga melakukan program pemberdayaan ODGJ melalui kegiatan produktif yakni produksi telur asin.
Beragam kegiatan yang digulirkan melalui Program Satya Gawa akan berujung pada tujuan akhir yang ingin dicapai, yakni terwujudnya kemandirian ODGJ sehingga mampu mencapai kondisi stabil, baik dari sisi kesehatan maupun sosialnya. Dengan demikian, ODGJ mampu beradaptasi dan menjalankan kehidupannya kembali di tengah masyarakat. Untuk itu, Suralaya PGU, UPTD Puskesmas DTP Pulomerak dan seluruh pihak yang terlibat telah merancang kelanjutan dari Program Satya Gawa. Ke depannya, akan dilaksanakan program pemberdayaan ODGJ berbasis ekonomi inklusif. Dalam hal ini, kegiatan produktif akan berjalan sesuai potensi dan minat ODGJ sehingga mampu meningkatkan ekonomi anggota Satya Gawa maupun masyarakat sekitarnya.
Satya Gawa is a mental health and empowerment service program for People with Mental Disorders (ODGJ), initiated by the SPP Suralaya PGU at Pulo Merak - Suralaya. The health service is provided free of charge and is carried out twice a month at the Integrated Mental Post (POS JITU) located in the Babakan Turi, Taman Sari Village. In addition to health services, Satya Gawa also conducts ODGJ empowerment programs through productive activity, i.e. salted egg production.
The various activities implemented as part of Satya Gawa Programhaveafinalgoalinmind,theactualizationofODGJindependence to achieve stable conditions, both in terms of health and social aspects. Thus, ODGJ is able to adapt and live amongst society. Thus, Suralaya PGU, Community Health Centers UPTD DTP Pulomerak, and all parties involved have designed the continuation of the Satya Gawa Program. Going forward, an inclusive economic-based ODGJ empowerment program will be implemented. In this case, the productive activities will be adapted to the potential and interests of ODGJ to be able to improve the economy of Satya Gawa group members and the surrounding community.
LingkunganEnvironmet
- 44 kg/tahun limbah padat produksi menjadi media tanam
- 240 gr/tahun cangkang telur bebek bermanfaat 63,64% bagi kesuburan tanah
- Serapan emisi sebesar 0,0038 ton CO2e/Tahun
- 44 kg/year solid waste generated became planting media
- 240 gr/year duck eggshells has 63.64%benefitsforsoilfertility
- Emission absorption of 0.0038 ton CO2e/year
- Omzet penjualan sebesar Rp40,13 juta/tahun
- Sales turnover of Rp40.13 million/year
- Renovasi POS JITU sebagai tempat pengobatan gratis
- 15 keluarga tidak melakukan pembatasan ruang gerak
- 127 siswa mengetahui pentingnya kesehatan jiwa
- 8 guru teredukasi kesehatan jiwa- Renovation of POS JITU as a place of
free treatment- 15 families did not conduct space
restriction- 127 students know the importance of
mental health- 8 teachers with knowledge of mental
health
- 15 pasien ikuti pengobatan rutin
- 9 pasien berstatus remisi- 15 patients took routine
medication- 9 patients were in
remission
EkonomiEconomy
KesejahteraanWellfare
MasyarakatSociety
Dampak dan Keberhasilan Program Tahun 2019Program’s Impact and Success in 2019
Selain pengobatan diberikan juga pelatihan agar saat mereka sembuh, mereka dapat beraktivitas kembali di tengah masyarakatIn addition to treatment, training is also provided so that when they recover, they can be active amongst the society
290 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Inspirasi Perempuan Indonesia PowerWomen’s Inspiration of Indonesia Power
Di balik kelembutan hatinya, setiap perempuan menyimpan potensi yang sangat besar. Potensi yang jika digali dan senantiasa dikembangkan, akan menghadirkan sosok perempuan tangguh yang mandiri dalam berbagai aspek kehidupan. Bukan hanya itu, dengan potensi yang diasah melalui beragam kegiatan pemberdayaan, kaum perempuan pun dapat berkontribusi aktif dalam pembangunan. Bahkan, menjadi inspirasi bagi keluarga dan masyarakat.
Inspirasi Perempuan adalah kegiatan pengembangan masyarakat untuk mencapai kondisi sosial-ekonomi-budaya yang lebih baik untuk mencapai kesetaraan dan keadilan gender dalam kehidupan keluarga dan masyarakat. Ruang lingkup kegiatan ini meliputi kegiatan-kegiatan yang berhubungan dengan:a. Pemberdayaan ekonomi untuk kaum wanita di
lingkungan area pembangkit;b. Kesehatan ibu dan anak di lingkungan area
pembangkit; danc. Program keterampilan untuk perempuan mandiri.
Hingga tahun 2019, tercatat ada 97 program pemberdayaan masyarakat berbasis Inspirasi Perempuan dengan jumlah anggota 580 orang perempuan dan perputaran ekonomi hingga senilai Rp2,5 miliar.
Behind the softness, every woman has enormous potential. If explored and constantly developed, the potential will be resulted in strong independent women in various aspects of life. In addition, with the potential honed through various empowerment activities, women shall contribute actively in the development. In fact, the women become inspiration for family and society.
Women’s Inspiration is a community development activity to achieve better socio-economic-cultural conditions to achieve gender equality and fairness in family and society. The scope of this activity includes activities related to:
a. Economic empowerment for women in the power plant area;
b. Mother and child health in the power plant area; and
c. Skills program for independent women.
Until 2019, there were 97 community empowerment programs based on Women’s Inspiration with a total of 580 women, and economic turnover of up to Rp2.5 billion.
Program dan Perencanaan Program CSR [GRI 413-1]CSR Program and Program Planning [GRI 413-1]
Program Pemberdayaan Perempuan
Women’s Empowerment Program
Perempuan Penerima Manfaat
WomenBeneficiaries
Unit PenyelenggaraOrganizing Unit
34 483 14
291 Sustainability Report 2019
PT Indonesia Power
Soci
al
Menuju Masyarakat Mandiri melalui Pengembangan UKMTowards Independent Community through SMEs Development
Tempat Olah Sampah Setempat (TOSS), Membuang Sampah ke Kawat ListrikLocal Trash Can (TOSS), Disposing Trash at the Electric Wire
Program IPRENEUR merupakan program CSR berbasis kegiatan ekonomi kerakyatan yang menjadi ajang bagi masyarakat binaan Indonesia Power untuk berpartisipasi dalam pembangunan ekonomi berkelanjutan, menggali pengetahuan dan keahlian sekaligus mengentaskan kemiskinan.IPRENEUR program is a CSR program based on people’s economy, a forum for Indonesia Power’s fostered partner to participate in developing a sustainable economy, exploring knowledge and expertise, and alleviating poverty.
Seorang pekerja menuangkan sampah ke dalam mesin penghancurA worker pours rubbish into the shredder
Perusahaan bersama Pemkab Klungkung berkomitmen untuk terus mengembangkan metode TOSS di Kabupaten Klungkung. Salah satu inovasi yang dilakukan adalah dengan memperkenalkan metode TOSS sejak dini kepada masyarakat Desa Gunaksa melalui modul kurikulum ekstrakurikuler TOSS di sekolah. Hal ini dilakukan dengan harapan masyarakat dapat memahami permasalahan mengenai sampah dan mengetahui cara mengatasi persoalan sampah dengan metode TOSS sejak dini.
Selain itu, dengan adanya modul kurikulum ekstrakurikuler TOSS di sekolah, siswa diharapkan mampu ikut serta mengimplementasikan metode TOSS, yaitu dengan cara melakukan pemilahan sampah berdasarkan jenisnya. Modul kurikulum ekstrakurikuler TOSS dilaksanakan di tingkat SD dan SMP di wilayah Desa Gunaksa. Setiap minggunya, 70 siswa SD dan 240 siswa SMP di Gunaksa mengikuti ekstrakurikuler TOSS.
Selain pengembangan melalui modul pembelajaran, replikasi program telah dilakukan di desa lainnya di Kabupaten Klungkung, yaitu Desa Paksebali. Program diimplementasikan melalui kolaborasi dengan Bank Sampah yang telah terbentuk di desa tersebut, sehingga pellet yang dihasilkan merupakan produk pellet organik murni dengan kualitas baik.
The Company, in collaboration with Klungkung Regency Government, is committed to continuing developing the TOSS method at Klungkung Regency. One of the innovations is by introducing the TOSS method early on to the Gunaksa Village community through the TOSS extracurricular curriculum at schools. The effortis conducted with the objective that the public shall understand the waste problem and know how to mitigate the waste problem with the early TOSS method.
In addition, students are expected to participate in implementing the TOSS method by sorting waste by type through the TOSS extracurricular curriculum in schools. TOSS extracurricular curriculum is implemented at the elementary and junior high schools at Gunaksa Village. Every week, 70 elementary students and 240 junior high school students in Gunaksa join the TOSS extracurricular.
In addition to developing through the learning module, this program has been replicated to other villages at Klungkung Regency, i.e. Paksebali Village. The program is implemented in collaboration with the Waste Bank that has been established in the village. Therefore, the village produces pellets that are pure organic with good quality.
292 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
AdIPertiwi adalalah program CSR berbasis Kebudayaan dari Indonesia Power yang baru diluncurkan pada tahun 2019. Nama program AdIPertiwi, mengacu pada kegiatan seni-budaya yang berkarakteristik keindahan asli Nusantara. AdIPertiwi merepresentasi segala sesuatu yang diciptakan atau dilestarikan oleh komunitas binaan CSR Indonesia Power berkenaan cara hidup yang berkembang pada suatu komunitas, yang memiliki unsur keindahan secara turun temurun, dari generasi ke generasi. Dalam implementasinya, tidak hanya untuk melestarikan budaya lokal namun juga meningkatkan ekonomi para pelakunya, diantaranya melalui program:
Sekehe Srati Yadnya Santhi, salah satu program Inspirasi Perempuan yang berupaya melestarikan adat istiadat dan kearifan lokal dengan pelatihan membuat Banten untuk upacara keagamaan. Dimana, seiring perkembangan zaman, keberadaan Banten alami mulai tergeser dengan adanya Banten yang terbuat dari bahan sintetis.
AdIPertiwi is a Culture-based CSR program from Indonesia Power which was newly launched in 2019. The name, AdIPertiwi, refers to arts and culture activities that are characterized by the genuine beauty of the Archipelago. AdIPertiwi represents everything created or preserved by the Indonesia Power’s CSR fostered community in terms of the way of life within a community, which inherits elements of beauty from generation to generation. In its implementation, the objective is not only to preserve local culture but also to improve the community. The programs are:
Sekehe Srati Yadnya Santhi, one of the Women’s Inspiration programs that strives to preserve local customs and wisdom with training for Banten’s religious ceremonies. As time goes by, the existence of natural Banten began to be shifted by Banten made of synthetic materials.
Dampak dan Keberhasilan Program Tahun 2019Program’s Impact and Success in 2019
- Kabupaten Klungkung 0 (nol) bencana banjir
- Mereduksi timbulan sampah sebesar 6 ton/hari di Kecamatan Dawan
- Adanya pemilahan dan pengelolaan sampah 1 ton/hari di Sekolah
- Klungkung Regency zero (0)flooddisaster
- Reducing waste generation by 6 tons/day at Dawan Sub-District
- Segregation and management of 1 ton/day of waste in Schools
- 2 kelompok masyarakat sadar lingkungan (Werdhi Guna & Nangun Resik)
- 33 orang pioneer pengelolaan sampah
- 70 siswa SD & 240 siswa SMP mengimplementasikan pendidikan berbasis lingkungan
- 2 environmentally conscious community groups (Werdhi Guna & Nangun Resik)
- 33 pioneers in waste management
- 70 elementary students & 240 junior high students implement environmental-based education
- Menambah pendapatan ekonomi anggota kelompok sebesar Rp1,1 juta/bulan
- Penghematan pengeluaran sebesar Rp14 ribu/hari/KK untuk membeli kayu bakar
- Pendapatan kelompok sebesar Rp1,9 juta/bulan dari penjualan produk
- Increased members’ income to Rp1.1 million/month
- Cost savings of Rp14 thousand/day/household tobuyfirewood
- Group revenue of Rp1.9 million/month from product sales
- 34 jiwa dari 79 warga miskin telah berpenghasilan
- 7.890 warga menjadi supplier sampah TOSS
- 310 KK sudah melakukan pemilahan sampah di tingkat rumah tangga
- 34 people from 79 poor people have earned income
- 7,890 residents become TOSS waste suppliers
- 310 Households have sorted waste at the household level
LingkunganEnvironmet
Sosial & MasyarakatSocial & Human
EkonomiEconomy
KesejahteraanWellfare
Program dan Perencanaan Program CSR [GRI 413-1]CSR Program and Program Planning [GRI 413-1]
AdIPertiwi: Lestarikan Budaya Keindahan Asli NusantaraAdIPertiwi: Preserving the Beautiful Natural Culture of Archipelago
293 Sustainability Report 2019
PT Indonesia Power
Soci
al
Pelestarian & Ekowisata Lembu Putih Taro, Lembu Putih merupakan hewan sakral yang diperlukan dalam upacara keagamaan umat Hindu di Bali, seperti upacara mapada, mamukur dan lainnya. Dalam upacara tersebut yang diambil dari lembu putih adalah air susunya, air liurnya, air seninya dan juga kotorannya. Sebelumnya lembu putih hidup bebas, mencari makan sendiri. Hal ini disebabkan karena lembu putih merupakan hewan sakral sehingga tidak ada yang berani memelihara secara pribadi. Sehingga banyak Lembu Putih yang mati dan kekurangan makanan. Indonesia Power bekerja sama dengan Yayasan Lembu Putih Taro berupaya melestarikan hewan sakral ini agar meningkat populasinya.
Conservation & Ecotourism of the White Taro Ox, White Ox is a sacred animal that is needed in Hindu religious ceremonies in Bali, such as mapada, mamukur, etc. In the ceremony, the milk, saliva, urine, and feces of the white oxweretaken.Previously,thewhiteoxlivedfreely,findingits food. This is because the white ox is a sacred animal so that no one dares to make it their pet. However, many White Ox died due to lack of food. Indonesia Power, in collaboration with the White Taro Foundation, strives to preserve this sacred animal to increase its population.
Manfaat Benefits 2019
Lingkungan Nature - 100% bunga kemitir untuk kelengkapan banten dari taman hasil pemanfaatan lahan- 100% sampah produksi dapat diolah menjadi pelet-100%kemitirflowerforbantencompletenessfromtheuseofland- 100% of generated waste can be processed into pellets
Ekonomi Economy Perputaran ekonomi kelompok Rp92,3 juta per Januari-September 2019 (Pendapatan Kotor) Group economic turnover of Rp92.3 million as of January-September 2019 (Gross Income)
Kesejahteraan Wellbeing - 42 orang anggota kelompok terdiri dari, 18 orang pioneer pelestarian banten dan 24 orang kader srati banten (Sekehe Teruni)
- Anggota mampu membuat berbagai jenis banten dan membuat banten dalam skala besar- 650 jiwa pengguna banten - 42 members, consisted of 18 pioneers of Banten preservation and 24 cadres of srati banten (Sekehe
Teruni)- Members are able to make various types of banten and make banten on a large scale- 650 souls of banten users
Masyarakat Society - Terbentuk 1 kelompok srati banten- Terbentuk 1 Kelompok baru dari Sekehe Teruni Banjar Ambengan - 1 srati banten group is formed- 1 new group established from Sekehe Teruni Banjar Ambengan
Dampak dan Keberhasilan Program tahun 2019Program’s Impact and Success in 2019
Manfaat Benefits 2019
Lingkungan Nature - Populasi Lembu putih bertambah menjadi 55 ekor - 100% kotoran lembu putih untuk kompos dan bahan bakar agnihortra untuk upacara- White Ox population increased by 55 oxes - 100% white ox feces are utilized as compost and agnihotra fuel for ceremonies
Ekonomi Economy - Meningkatnya pendapatan anggota kelompok sebesar Rp900.000/bulan- Menambah penghasilan kelompok sebesar Rp1,2 juta dari kegiatan wisata- Hasil Penjualan Kompos dan bahan bakar agnihortra Rp3,89 juta (Januari-Agustus 2019)- Increased member’s income of Rp900,000/month- Increased group’s income by Rp1.2 million from tourism - Proceeds from the sale of compost and agnihotra fuel of Rp3.89 million (January-August 2019)
Kesejahteraan Wellbeing - 8 orang menjadi pengelola 8 people became managers - 8 anggota kelompok mampu menjadi pemandu wisata 8 members become tour guides - Tidak ditemukan matinya lembu putih karena penyakit White oxes were not found death due to disease- 8.320 pengunjung (Januari-Oktober 2019) 8,320 visitors (January-October 2019)
Masyarakat Society - Terbentuknya 1 kelompok masyarakat lestarikan budaya Bali- Keterlibatan stakeholder: Indonesia Power, Pemerintah dan masyarakat Desa Taro, serta Bank BJB- The establishment of 1 community group preserving Balinese culture- Stakeholders’ involvement: Indonesia Power, the Government, the Taro villagers, and Bank BJB
Dampak dan Keberhasilan Program tahun 2019Program’s Impact and Success in 2019
294 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Program dan Perencanaan Program CSR [GRI 413-1]CSR Program and Program Planning [GRI 413-1]
Seni Budaya Bandrong merupakan seni bela diri berjenis silat yang dikenal di masyarakat sekitar Cilegon, semakin hari keberadaannya semakin tersingkirkan dengan masuknya budaya baru dari berbagai daerah. Untuk itu, Indonesia Power bekerjasama dengan Paguyuban Bandrong Sri Royom, mengenalkan kesenian ini melalui institusi Pendidikan, ke depannya akan menjadi pilihan ekstrakurikuler di tingkat Pendidikan dasar dan menengah.
Kesenian Bandrong memiliki nilai jual apabila dilestarikan dan dikembangkan oleh masyarakat lokalnya. Nilai jual tersebut dapat diperoleh melalui popularitas. Bukti nyata peluang popularitas kesenian Bandrong ialah banyaknya undangan untuk penampilan kesenian Bandrong di banyak tempat dan acara di Kota Cilegon sendiri. Apabila kesenian Bandrong ini terus dikembangkan dan dipromosikan, maka akan menjadi kesenian lokal yang memiliki nilai jual di kancah nasional maupun internasional.
Selain Bandrong, terdapat pula program pemberdayaan masyarakat berbasis lingkungan yang terletak di Ecopark Suralaya. Indonesia Power mengajak pedagang yang berjualan di area Ecopark untuk saling menjaga, merawat serta melestarikan lingkungan Ecopark sebagai bentuk tanggung jawab dan rasa memiliki. Pedagang ini dilatih untuk mengelola kewirausahaan dan keuangan dalam program ini oleh Pusat Inkubator Wirausaha dan Klinik UMKM (PIWKU) Kota Cilegon.
Bandrong Art and Culture is a martial art well-known in Cilegon. The existence is increasingly diminishing by the entry of new cultures from various regions. Thus, Indonesia Power, in collaboration with the Sri Royom Bandrong Society, introduces this art to Educational institutions. In the future, it will be an extracurricular choice at the elementary and secondary Education.
Bandrong’s art has values if it is preserved and developed by the local community. The value is in the form of popularity. The evidence of Bandrong art popularity is the number of invitations to the appearance of Bandrong art in many places and events in Cilegon City. If this Bandrong art continues to be developed and promoted, it will become a local art that has a selling value in the national and international arena.
Besides Bandrong, there is also an environment-based community empowerment program located in Ecopark Suralaya. Indonesia Power invites traders who sell in the Ecopark area to look after each other, care for and preserve the Ecopark environment as a form of responsibility and ownership. These traders are trained to manage entrepreneurship and financeinthisprogrambytheEntrepreneurshipIncubatorCenterandtheUMKM Clinic (PIWKU) Cilegon City.
Dewasa ini, silat Bandrong semakin kaya dengan jurus dan gerak karena menyerap dari berbagai aliran silat dan seni bela diri lainnya,
seperti Cimande, Merpati Putih, Silat Beksi dan KungfuToday, the Bandrong silat is increasingly rich in style and motion because it
absorbs various silat styles and other martial arts, such as Cimande, Merpati Putih, Silat Beksi, and Kungfu
295 Sustainability Report 2019
PT Indonesia Power
Soci
al
Dampak dan Keberhasilan Program Tahun 2019 Program’s Impact and Success in 2019
- 2.961 m2 lahan kosong termanfaatkan untuk taman kehati
- 3.439 pohon di area ecopark seluas 7,11 hektar mampu menyerap CO2 sebanyak 148,68 ton CO2/tahun
- 2,961 m2 of vacant land is utilized for parks
- 3,439 trees in the 7.11-hectare ecopark area absorb 148.68 tons of CO2/year
- Rp1 juta/tampil – Kelompok Bandrong
- Rp100 ribu/hari/orang – Kelompok Kamboja
- Rp1 million/performance - Bandrong group
- Rp100,000/day/person - Kamboja group
- 1 pioneer paguyuban Bandrong
- 6 paguyuban Bandrong Suralaya saling bersinergi
- Kuliner corner dan 8 gerobak dagang sebagai sarana pemberdayaan
- 7,11 hektar sebagai ruang publik bagi 2.672 KK
- 1 pioneer of Bandrong group
- Synergy of 6 Bandrong group in Suralaya
- Culinary corner and 8 trade carts as a means of empowerment
- 7.11 hectares as public space for 2,672 households
- 1 kebudayaan lokal terevitalisasi
- 15 orang pegiat Bandrong sebagai penerima manfaat
- 8 orang pedagang meningkat kapasitas wirausahanya
- 1 revitalized local culture- 15 Bandrong activists as beneficiaries
- 8 traders increased their entrepreneurial capacity
LingkunganEnvironmet
EkonomiEconomy
KesejahteraanWellfare
Sosial & MasyarakatSocial & Human
296 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Aroma Ekonomi dan Konservasi dalam Secangkir KopiThe Aroma of Economy and Conservation in a Cup of Coffee
Program konservasi tanaman kopi merupakan pengembangan dari program Sekolah Lapangan yang telah dilaksanakan sejak tahun 2009. Awal mulanya program ini diinisiasi untuk mengurangi erosi yang berdampak pada sedimentasi di Waduk PB Soedirman, sehingga Daerah Aliran Sungai (DAS) yang berada di hulu Sungai Serayu perlu ditanami tanaman keras.
Melihatadanyapotensisumberdayaalam,letakgeografisserta sumberdaya manusia di Desa Pegundungan yang bercirikan rasional, religius dan mempunyai motivasi yang tinggi, maka pada tahun 2019 Perusahaan bekerjasama dengan Bina Desa Foundation mendukung masyarakat untuk melaksanakan Program Desa Kopi Konservasi. Peningkatan keterampilan bagi petani, keterampilan bagi barista, pembangunan infrastruktur dilakukan untuk tercapainya tujuan Kelompok Tani “Bangkit”. Saat ini, petani kopi arabika di Desa Pegundungan sudah mencapai 78 orang, 20 petani kopi di antaranya telah menghasilkan lebih dari 8 ton kopi basah atau sekitar 1,3 ton green bean.
The coffee plant conservation is an expansion of theField School program initiated in 2009. Initially, this program was initiated to reduce erosion that has an impact on sedimentation in the PB Soedirman Reservoir, so that the Watersheds (DAS) located upstream of the Serayu River need to be planted with perennials.
Seeing the potential of natural resources, geographical location, and human resources in Pegundungan Village which is characterized by rational, religious, and highly motivated, then in 2019 the Company in collaboration with the Bina Desa Foundation supports the community to implement theCoffeeConservationVillageProgram.Increased skills for farmers, skills for baristas, infrastructure development is carried out to achieve the objectives of the “Revive” Farmer Group. At present, Arabica coffee farmers in Pegundungan Village havereached 78 people, 20 of whom have produced more than 8tonsofwetcoffeeoraround1.3tonsofgreenbeans.
Dampak dan Keberhasilan Program Tahun 2019 Program’s Impact and Success in 2019
- 23 HA, luasan tanah berubah pola tanam dari sayur menjadi kopi
- 46 ribu batang tanaman kopi telah ditanam
- Memperpanjang masa umur lahan waduk menjadi 21 tahun dari tahun 2018
- 23 HA, the size of the land changes the planting pattern from vegetables tocoffee
-46thousandcoffeeplantshave been planted
- Extend the life span of the reservoir area to 21 years from 2018
- Produksi kopi 10 ton/tahun
- Rp739 juta/tahun omzet kopi
- Peningkatan pendapatan warga rata-rata Rp1,8 juta/tahun
-Coffeeproductionof10tons/year
- Rp739 million/year of coffeeturnover
- Increased income of citizens an average of Rp1, 8 million / year
- 8 penghargaan dari instansi terkait
- 10 kali partisipasi dalam kegiatan stand nasional
- 20 kali peliputan oleh media nasional
- 8 awards from related institutions
- 10 participations in national stand
- 20 times national media coverage
- 401 warga terlibat kegiatan- 401 warga penerima
manfaat kegiatan- 12 kelompok tani terbentuk,
dengan 63 orang anggota- 401 residents involved in
the activity-401residentsbenefited
from the activity- 12 farmer groups were
established with 63 members
LingkunganEnvironmet
EkonomiEconomy
KesejahteraanWellfare
Sosial & MasyarakatSocial & Human
Program dan Perencanaan Program CSR [GRI 413-1]CSR Program and Program Planning [GRI 413-1]
297 Sustainability Report 2019
PT Indonesia Power
Soci
al
Pengelolaan Dampak Operasi Terhadap Masyarakat Lokal Secara Berkelanjutan [GRI 413-2]Continuous Management of Operational Impact on Local Community [GRI 413-2]
Indonesia Power bergerak dalam bisnis energi yang memiliki risiko tinggi terhadap perubahan lingkungan alam dan sosial. Karena itu, Indonesia Power berkomitmen untuk senantiasa mempertimbangkan, mencegah, mengurangi dan mengelola dampak dari operasi dan bisnisnya. Selain memberikan manfaat positif terhadap peningkatan ekonomi, peningkatan kesejahteraan masyarakat dan kelestarian lingkungan, kegiatan operasional tidak dapat dipungkiri dapat juga memberikan dampak negatif terhadap masyarakat lokal. Untuk itu, Indonesia Power telah menganalisis dampak dari kegiatan-kegiatan Perusahaan yang dapat memberikan dampak negatif penting terhadap masyarakat lokal, baik pada tahap perencanaan hingga pembangunan dan pengoperasian. Kegiatan ini dikelompokkan menjadi tahap pra-konstruksi, konstruksi dan operasi.Identifikasidanevaluasipengelolaandampakdiuraikandi bawah ini:
Indonesia Power is engaged in the energy business which has a high risk of changes in the natural and social environment. Therefore, Indonesia Power is committed to always considering, preventing, reducing, and managing the impacts of its operations and business. In addition to providing positive benefits toeconomic improvement, increasing community welfare, and environmental sustainability, the operational activities undeniably cause negative impact on local communities. Therefore, Indonesia Power has analyzed the impact of the Company’s activities that could significantly impact thelocal community, starting from the planning stage up to the development and operation. These activities are categorized into pre-construction, construction, and operation phases. The identification and evaluation of impact management aredescribed below:
Identifikasi dan Evaluasi Dampak Potensial [GRI 413-2]Identification and Evaluation of Potential Impacts [GRI 413-2]
No TahapanPhase
Dampak PotensialPotential Impact
EvaluasiEvaluation
Tahap Pra Konstruksi Pre-Construction Phase1 Pengurusan perizinan
Licensing Sikap dan persepsi masyarakat tentang rencana kegiatanCommunity behavior and perceptions about the activities planned
Sosialisasi dan penyampaian informasi terkait upaya pengelolaan dan pemantauan lingkungan yang akan dilakukan termasuk prosedur tanggap darurat yang akan dilakukan selama proses kegiatan. Information dissemination and information related to environmentalmanagementandmonitoringeffortsthat will be conducted include emergency response procedures that will be carried out during the activity process.
2 Pembebasan lahanLand exemption
Sikap dan persepsi masyarakatCommunity behavior and perceptions
Melakukan musyawarah dan pendekatan kepada warga untuk mencapai kesepakatan atas penggantian tanah yang akan dibebaskan. Conduct deliberations and approaches citizens to reach an agreement on the replacement of the land to be acquired.
Tahap Konstruksi Construction Phase1 Penerimaan tenaga kerja
Manpower reception- Tersedianya kesempatan kerja - Terbukanya peluang usaha- Availability of employment opportunity - Opening up business opportunities
Membuka kesempatan kepada penduduk setempat untuk meningkatkan pendapatan melalui proses penerimaan tenaga kerja lokal dan peluang usaha dengan menyediakan kebutuhan (warung, tempat makan, toko dan sebagainya) bagi pekerja proyek.Providing opportunities for locals to increase income through the process of hiring local employees and business opportunities by providing necessities (food stalls, eating places, shops, etc.) for project workers.
298 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
No TahapanPhase
Dampak PotensialPotential Impact
EvaluasiEvaluation
2 Mobilisasi peralatan dan material konstruksi Mobilization of construction equipment and materials
Kemacetan jalur akses transportasi darat dan kerusakan jalan selama proses kegiatan Trafficonthegroundtransportationaccessand road damage during the process
- Melakukan pengaturan lalu lintas di jalur mobilisasi sehingga tidak menimbulkan kemacetan yang tidak terkontrol;
- Melakukan peningkatan dan kapasitas jalan dan pemasangan fasilitas perlengkapan Lalu Lintas dan Angkutan Jalan (LLAJ) lainnya yang dikoordinasi oleh Dinas terkait; dan
- Melakukan berbagai upaya pengelolaan kerusakan seperti berpartisipasi dalam kegiatan rehabilitasi jalan, membatasi jumlah dan beban kendaraan pengangkut, dan sebagainya.
-Managingtrafficonthemobilizationlanetoavoiduncontrolledtrafficjams;
- Improving road capacity and installing Indonesian TrafficLaw(LLAJ)equipmentfacilities,coordinatedby the relevant Agency; and
- Conducting various damage management, such as participating in road rehabilitation activities, limiting the number and load of transport vehicles, etc.
3 Penyiapan dan pematangan lahan sertaPembangunan Fisik Land preparation and maturation, and Physical
- Kebisingan akibat proses kegiatan- Polusi udara, khususnya partikulat (debu)
akibat proses kegiatan- Peningkatan debit air larian (run off)- Penurunan kuantitas dan kualitas air
permukaan - Noise due to the activity - Air pollution, especially particulate (dust)
due to the activity -Increasedrun-off- Decreased groundwater quality and
quantity
- Melakukan pengukuran parameter kebisingan agar tidak melebihi 70 dB(A) sesuai dengan Keputusan Menteri Lingkungan Hidup Nomor 48 tahun 1996 tentang Baku Tingkat Kebisingan;
- Melakukan pemantauan kualitas udara ambien selama 24 jam berdasarkan literatur terkait dan data teknis perencanaan untuk membandingkan dengan baku mutu kualitas udara sesuai dengan peraturan yang berlaku;
- Membuat saluran drainase darurat yang terintegrasi dengan saluran drainase/badan air penerima, menanam dan memelihara tanaman yang memiliki daya resap air tinggi dan membuat sumur resapan air hujan; dan
- Melakukan pemantauan terhadap penurunan kualitas air pada badan air dan melakukan pengelolaan air limbah dengan IPAL sesuai karakteristik limbah sebelum dibuang ke badan air.
- Measuring noise parameters so as not to exceed 70 dB(A) in accordance with the Minister of the Environment Decree No. 48 of 1996 on Noise Level Standards;
- Monitoring ambient air quality for 24 hours based on relevant literature and planning technical data to compare with air quality standards in accordance with prevailing regulations;
- Constructing emergency drainage channels integrated with drainage channels/receiving water bodies, planting and maintaining plants with high water absorption capacity, and constructing rainwater infiltrationwells;and
- Monitoring the decline in water quality in water bodies and managing wastewater with WWTP according to the waste characteristics before discharging it into the water body.
Program dan Perencanaan Program CSR [GRI 413-1]CSR Program and Program Planning [GRI 413-1]
299 Sustainability Report 2019
PT Indonesia Power
Soci
al
No TahapanPhase
Dampak PotensialPotential Impact
EvaluasiEvaluation
Tahap Operasi Operation Phase1 Penerimaan tenaga kerja
Manpower reception- Tersedianya kesempatan kerja- Terbukanya peluang usaha- Availability of employment opportunity- Opening of business opportunities
Memprioritaskan penerimaan tenaga kerja yang berasal dari penduduk setempat sesuai persyaratan secara transparan dan membuka peluang usaha bagi penduduk dengan menyediakan kebutuhan bagi pekerja proyek. Prioritizingrecruitmentoflocalworkerswhofulfilltherequirements transparently and opening up business opportunities for residents by providing needs for project workers.
2 Pengoperasian dan pemeliharaan pembangkit Operation and maintenance of the plant
- Peningkatan tingkat kebisingan akibat proses operasi
- Penurunan kualitas udara akibat gas buang dari proses operasi
- Penurunan kualitas air akibat timbulan air limbah domestik
- Penurunan sanitasi lingkungan akibat timbulan sampah domestik
- Gangguan estetika dan kebersihan akibat timbulan sampah domestik
- Increased noise level due to operations- Decreased air quality due to exhaust gases
from the operations- Declining water quality due to domestic
wastewater generation- Declining environmental sanitation due to
domestic waste generation- Aesthetic and hygiene problems due to
domestic waste generation
- Melakukan pengukuran parameter kebisingan agar tidak melebihi 70 dB(A) sesuai dengan Keputusan Menteri Lingkungan Hidup Nomor 48 tahun 1996 tentang Baku Tingkat Kebisingan;
- Melakukan pemeliharaan peralatan pembangkit secara rutin;
- Melakukan pemantauan kualitas udara ambien selama 24 jam berdasarkan literatur terkait dan data teknis perencanaan untuk membandingkan dengan baku mutu kualitas udara sesuai dengan peraturan yang berlaku;
- Melakukan pemantauan kualitas air sehingga memenuhi baku mutu peraturan Pemerintah RI Nomor 82 tahun 2001 tentang Pengendalian Pencemaran Air; dan
- Melakukan pendekatan sosial dan budaya kepada masyarakat sekitar.
- Measuring noise parameters so as not to exceed 70 dB(A) in accordance with the Minister of the Environment Decree No. 48 of 1996 on Noise Level Standards;
- Performing routine maintenance of generating equipment;
- Monitoring ambient air quality for 24 hours based on relevant literature and planning technical data to compare with air quality standards in accordance with prevailing regulations;
- Monitoring water quality to meet the quality standards of the Government Regulation of the Republic of Indonesia No. 82 of 2001 on Water Pollution Control; and
- Carrying out social and cultural approaches to the surrounding community.
Dalam setiap pembangunan infrastruktur pembangkitan, Indonesia Power mencatat tidak ada proyek Perusahaan yang mengakibatkan perpindahan atau pemukiman kembali penduduk. Sehingga tidak terdapat data pengelolaan dampak displacement (pemukiman kembali) dan jumlah orang yang terkena dampak hingga pemberian kompensasi akibat kegiatan displacement yang dapat disajikan di tahun 2019. [EU20, EU22]
Indonesia Power menyadari keberadaan Perusahaan di tengah-tengah masyarakat memiliki konsekuensi sosial yang harus dikelola baik positif maupun negatif. Namun demikian, kami berkomitmen untuk terus memfokuskan diri pada upaya menyebarluaskan nilai-nilai keseimbangan kehidupan ekonomi, sosial dan lingkungan. Di masa datang kami akan menggunakan pendekatan praktik terbaik dan perbaikan strategi pelaksanaan program dan pengelolaan dampak, agar dapat memberikan manfaat yang lebih besar kepada masyarakat sekitar.
In each construction of the generating infrastructure, Indonesia Power recorded that there were no Company’s projects that resulted in the resettlement of residents. Thus, there is no data on the management of the resettlement impact and the number of people affected, or the provision of compensationdue to displacement activities that can be disclosed in 2019. [EU20, EU22]
Indonesia Power realizes the Company’s presence in the midst of society has social consequences that must be managed, both positively and negatively. However, we are committed to focusing oneffortstodistributethevaluesofthebalanceofeconomic,social, and environmental life. In the future, we will use a best practice approach and improve program strategies and impact management, to provide greater benefits to the surroundingcommunity.
300 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Dalam hal penilaian terhadap dampak kegiatan CSR Perusahaan, Indonesia Power melakukan pengukuran Indeks Kepuasan Masyarakat (IKM). IKM merupakan gambaran persepsi atas kinerja sosial Perusahaan akibat pelaksanaan kegiatan CSR yang diberikan kepada masyarakat terutama yang menerima langsung manfaat program tersebut.
Pengukuran dilakukan dengan menggunakan metode survei dengan pendekatan penelitian deskriptif kuantitatif. Pelaksanaan IKM bekerja sama dengan lembaga independen yang ditunjuk oleh Perusahaan untuk melakukan studi IKM di lima program pemberdayaan di empat lokasi unit kerja dengan hasil sebagai berikut:
Berdasarkan hasil tersebut, dapat disimpulkan bahwa kinerja program CSR Perusahaan dalam kondisi baik dan memuaskan. Untuk ke depannya, Indonesia Power berkomitmen untuk meningkatkan kinerja program CSR agar terjadi peningkatan nilai dan program yang dijalankan dapat memenuhi harapan dan kondisi masyarakat.
In terms of evaluating the impact of the Company’s CSR activities, Indonesia Power assesses the Community Satisfaction Index (IKM). IKM demonstrates the perception of the Company’s social performance in the form of CSR activities provided to the public,especiallythosewhoreceivethebenefitsoftheprogramdirectly.
The assessment is carried out through a survey, with a quantitative approach to the descriptive research. IKM is implemented in collaboration with an independent institution appointedbytheCompanytoconductIKMstudy,coveringfiveempowerment programs in four work unit locations, with the following results:
Based on these results, it is concluded that the Company performed good and satisfactory CSR programs. In the future, Indonesia Power is committed to improving the performance of CSR programs to provide added-value and meet the expectations and conditions of the community.
Indeks Kepuasan Masyarakat [GRI 413-1]Community Satisfaction Index [GRI 413-1]
Indeks Kepuasan MasyarakatCommunity Satisfaction Index
No Unit Nilai IndeksIndeks Value
KategoriCategory
1 Priok POMU: Program PAUD Inklusi ECED Inclusion Program 3,31 Sangat Baik Excellent
2Bali PGU:- Program TOSS TOSS program- Program Srati Banten Srati Banten program
2,513,04
Baik GoodBaik Good
3Suralaya PGU:Program Rumah TerampilHousing Skills program
2,60 Baik Good
4Kamojang POMU:Program Kampung Pelag MandiriKampung Pelag Mandiri program
3,11 Baik Good
Program dan Perencanaan Program CSR [GRI 413-1]CSR Program and Program Planning [GRI 413-1]
301 Sustainability Report 2019
PT Indonesia Power
Soci
al
Pada salah satu program yang dijalankan, Indonesia Power telah melakukan analisis Social Return On Investment (SROI). Analisis SROI merupakan pendekatan untuk mengukur dampak sosial yang dapat dihasilkan di masa mendatang oleh Perusahaan. Hasil dari analisis SROI ini berupa rasio yang menunjukkan hubungan antara biaya investasi yang dikeluarkan Perusahaan dengan dampak yang dihasilkan oleh masyarakat.
Pada tahun 2019, Indonesia Power melaksanakan analisis SROI secara internal yang dilakukan dengan menganalisa program TOSS di Pesanggaran dan program Kampung Pelag Mandiri di Kamojang. Dari analisis yang dilakukan dengan membandingkan input yang Perusahaan berikan dengan outcome yang dihasilkan didapat rasio hasil pengukuran SROI sebesar 3,40 untuk program TOSS dan sebesar 4,81 untuk Kampung Pelag Mandiri. Hasil ini mengindikasikan bahwa untuk setiap Rp1 investasi yang diberikan Perusahaan, maka senilai Rp3,40 nilai sosial (social value) tercipta di masyarakat kelompok program TOSS dan Rp4,81 tercipta untuk masyarakat Kampung Pelag Mandiri.
On one of the programs carried out, Indonesia Power conducted a Social Return on Investment (SROI). SROI analysis is an approach to measure the social impact generated in the future by the Company. The result of SROI analysis is in the form of ratio that shows the relationship between investment cost incurred by the Company and the resulting impact on the community.
In 2019, Indonesia Power conducted an internal SROI analysis by analyzing the TOSS program in Pesanggaran and the Kampung Pelag Mandiri program in Kamojang. By comparing the Company’s investment with the generated outcome, the ratio of SROI assessment for TOSS program and Kampung Pelag Mandiri are 3.40 and 4.81 respectively. These results indicate that for every Rp1 of investment by the Company, Rp3.40 of social value is created in the TOSS program community, and Rp4.81 of social value is created in the Kampung Pelag Mandiri community.
Social Return On InvestmentSocial Return On Investment
Indonesia Power telah menyediakan sarana pengaduan masyarakat yang dapat diakses khususnya bagi masyarakat yang terkena dampak kegiatan operasional Perusahaan secara langsung. Masyarakat yang ingin menyampaikan pengaduan atau keluhan terkait kegiatan operasi Perusahaan dapat mengirimkan surat resmi yang ditujukan kepada Perusahaan atau Unit kerja terkait. Berikut mekanisme yang dilakukan oleh Perusahaan terkait penanganan keluhan ini:
Indonesia Power has provided a public complaints facility that canbeaccessed,specificallyforpeopledirectlyaffectedbytheCompany’s operational activities. People who want to submit complaints or grievance related to the Company’s operations cansendanofficialletteraddressedtotheCompanyorrelatedwork units. The Company utilizes the following mechanism to handling complaints:
Penanganan Pengaduan Masyarakat [GRI 103-2, 103-3, 413-1]Public Complaints Handling [GRI 103-2, 103-3, 413-1]
302 Laporan Keberlanjutan 2019PT Indonesia Power
Sosi
al
Selama tahun 2019, Indonesia Power tidak menerima pengaduan keluhan masyarakat terkait kegiatan operasional ataupun permasalahan lainnya. Perusahaan menghormati budaya dan hak-hak adat masyarakat di sekitar wilayah kerja perusahaan. Untuk itu pada setiap pelaksanaan kegiatan operasi, Perusahaan senantiasa melakukan kajian mendalam atas potensi dampak positif dan negatif terkait kondisi sosial dan lingkungan yang timbul akibat keberadaan Perusahaan. [GRI 413-1]
During 2019, Indonesia Power did not receive any complaints from the public in terms of operational activities or other problems. The Company respects the culture and customary rights of communities surrounding the Company’s working area. Therefore, in every operation, the Company conducts in-depth studies of the potential positive and negative impacts related to social and environmental conditions arising from the Company’s existence. [GRI 413-1]
Mekanisme Penanganan Pengaduan MasyarakatCommunity Complaints Handling Mechanism
SPS Humas atau Ahli Madya CSR menerima keluhan
masyarakatPublic Relations SPS or CSR
Associate Expert accepts public complaints
Pendataan keluhanRegistering the
complaints
Penyampaian jawaban kepada Masyarakat
Submission of answers to the
Community
MADM atau Manajer CSR melakukanverifikasimasalah
dengan pihak terkaitMADMorCSRManagerverifies
the problem with related parties
Senior Leader atau BPO melakukan penanganan masalah dan
penyusunan jawabanSenior Leader or BPO handles the problem and answer preparation
eksternal
Program dan Perencanaan Program CSR [GRI 413-1]CSR Program and Program Planning [GRI 413-1]
303 Sustainability Report 2019
PT Indonesia Power
Soci
al
Total nilai kontribusi yang diberikan oleh Indonesia Power melalui berbagai program pengembangan masyarakat pada tahun 2019 adalah sebesar Rp41.241 juta, meningkat 13,07% dari tahun 2018 yaitu sebesar Rp36.474 juta
In 2019, Indonesia Power’s contribution amounted to a total of Rp41,241 million through various community development program, increased by 13.07% from 2018, which was Rp36,474 million.
Investasi bagi MasyarakatInvestment for the Community
Investasi Program INPOWER CARE (Rp Juta)INPOWER CARE Program Investment (Rp Million)
Program 2017 2018 2019
Bakti Pelayanan Masyarakat Community Assistance 6.413 7.849 8.208
Bakti Pembinaan Hubungan Community Relations 9.085 10.264 10.632
Bakti Pemberdayaan MasyarakatCommunity Empowerment 12.886 18.361 22.40
Total 28.384 36.474 41.241
Grafik Realisasi Investasi Program INPOWER CARE (Rp Juta)Graph: INPOWER CARE Program Investment Realization (Rp Million)
28.3
84 36.4
74
41.2
41
2017
2018
2019
304 Laporan Keberlanjutan 2019PT Indonesia Power
LampiranAppendix
305 Sustainability Report 2019PT Indonesia Power
Indeks Isi GRI Standards “Opsi Komprehensif”dan Pengungkapan Sektor Utilitas Listrik
GRI Standards “Comprehensive Option” and Electric Utilities Sector Disclosures Content Index
Lembar Umpan BalikFeedback Sheet
306 Laporan Keberlanjutan 2019PT Indonesia Power
Lam
pira
n
Indeks Isi GRI Standards “Opsi Komprehensif”dan Pengungkapan Sektor Utilitas Listrik [GRI 102-55]GRI Standards “Comprehensive Option” and Electric Utilities Sector Disclosures Content Index [GRI 102-55]
GRI StandardPengungkapan Dislosure
HalamanPage OmissionPengungkapan
Dislosure Judul Title
GRI 101: Landasan 2016 GRI 101: Foundation 2016
Pengungkapan Umum General Disclosure
GRI 102:Pengungkapan Umum 2016General Disclosure 2016
Profil Organisasi Organizational Profile
GRI 102-1 Nama organisasi Name of the organization -
GRI 102-2 Kegiatan, merek, produk, dan jasa Activities, brands, products, and services -
GRI 102-3 Lokasi kantor pusat Location of headquarters -
GRI 102-4 Lokasi operasi Location of operations -
GRI 102-5 Kepemilikan dan bentuk hukum Ownership and legal form -
GRI 102-6 Pasar yang dilayani Markets served -
GRI 102-7 Skala organisasi Scale of the organization -
GRI 102-8 Informasi mengenai pegawai dan pekerja lainInformation on employees and other workers -
GRI 102-9 Rantai pasokan Supply chain -
GRI 102-10 Perubahan signifikan pada organisasi dan rantai pasokannyaSignificant changes to the organization and its supply chain -
GRI 102-11 Pendekatan atau Prinsip PencegahanPrecautionary Principle or approach -
GRI 102-12 Inisiatif eksternal External initiatives -
GRI 102-13 Keanggotaan asosiasi Membership of associations -
Strategi Strategy
GRI 102-14 Pernyataan dari pembuat keputusan senior Statement from senior decision-maker -
GRI 102-15 Dampak utama, risiko, dan peluangKey impacts, risks, and opportunities -
Etika dan Integritas Ethics and Integrity
GRI 102-16 Nilai, prinsip, standar, dan norma perilakuValues, principles, standards, and norms of behavior -
GRI 102-17 Mekanisme untuk saran dan masalah etikaMechanisms for advice and concerns about ethics -
Tata Kelola Governance
GRI 102-18 Struktur tata kelola Governance structure -
GRI 102-19 Mendelegasikan wewenang Delegating authority -
GRI 102-20
Tanggung jawab tingkat eksekutif untuk topik ekonomi, lingkungan dan sosialExecutive-level responsibility for economic, environmental and social topics
-
GRI 102-21Berkonsultasi dengan para pemangku kepentingan mengenai topik-topik ekonomi, lingkungan dan sosialConsulting stakeholders on economic, environmental and social topics
-
GRI 102-22 Komposisi badan tata kelola tertinggi dan komitenyaComposition of the highest governance body and its committees -
GRI 102-23 Ketua badan tata kelola tertinggiChair of the highest governance body -
GRI 102-24 Menominasikan dan memilih badan tata kelola tertinggiNominating and selecting the highest governance body -
GRI 102-25 Konflik kepentingan Conflicts of interest -
GRI 102-26
Peran badan tata kelola tertinggi dalam menetapkan tujuan, nilai-nilai dan strategiRole of highest governance body in setting purpose, values and strategy
-
307 Sustainability Report 2019
PT Indonesia Power
Atta
chm
ent
GRI StandardPengungkapan Dislosure
HalamanPage OmissionPengungkapan
Dislosure Judul Title
GRI 102-27 Pengetahuan kolektif badan tata kelola tertinggiCollective knowledge of highest governance body -
GRI 102-28 Mengevaluasi kinerja badan tata kelola tertinggiEvaluating the highest governance body’s performance -
GRI 102-29Mengidentifikasi dan mengelola dampak ekonomi, lingkungan dan sosialIdentifying and managing economic, environmental and social impacts
-
GRI 102-30 Keefektifan proses manajemen risikoEffectiveness of risk management processes -
GRI 102-31 Pengkajian topik ekonomi, lingkungan dan sosialReview of economic, environmental and social topics -
GRI 102-32 Peran badan tata kelola tertinggi dalam pelaporan keberlanjutanHighest governance body’s role in sustainability reporting -
GRI 102-33 Mengomunikasikan hal-hal kritis Communicating critical concerns -
GRI 102-34 Sifat dan jumlah total hal-hal kritisNature and total number of critical concerns -
GRI 102-35 Kebijakan remunerasi Remuneration policies -
GRI 102-36 Proses untuk menentukan remunerasiProcess for determining remuneration -
GRI 102-37 Keterlibatan para pemangku kepentingan dalam remunerasiStakeholders’ involvement in remuneration -
GRI 102-38 Rasio kompensasi total tahunan Ratio of total annual compensation -
GRI 102-39 Persentase kenaikan dalam total rasio kompensasi total tahunanPercentage increase in total annual compensation ratio -
Keterlibatan Pemangku Kepentingan Stakeholder Engagement
GRI 102-40 Daftar kelompok pemangku kepentingan List of stakeholder groups -
GRI 102-41 Perjanjian perundingan kolektif Collective bargaining agreements -
GRI 102-42 Mengidentifikasi dan memilih pemangku kepentingan Identifying and selecting stakeholders -
GRI 102-43 Pendekatan terhadap keterlibatan pemangku kepentingan Approach to stakeholder engagement -
GRI 102-44 Topik utama dan masalah yang dikemukakan Key topics and concerns raised -
Praktik Pelaporan Reporting Practice
GRI 102-45 Entitas yang termasuk dalam laporan keuangan dikonsolidasi Entities included in the consolidated financial statements -
GRI 102-46 Menetapkan isi laporan dan Boundary topik Defining report content and topic Boundaries -
GRI 102-47 Daftar topik material List of material topics -
GRI 102-48 Penyajian kembali informasi Restatements of information -
GRI 102-49 Perubahan dalam pelaporan Changes in reporting -
GRI 102-50 Periode pelaporan Reporting period -
GRI 102-51 Tanggal laporan terbaru Date of most recent report -
GRI 102-52 Siklus pelaporan Reporting cycle -
GRI 102-53 Titik kontak untuk pertanyaan mengenai laporanContact point for questions regarding the report -
GRI 102-54 Klaim bahwa pelaporan sesuai dengan Standar GRIClaims of reporting in accordance with the GRI Standards -
GRI 102-55 Indeks isi GRI GRI content index -
GRI 102-56 Assurance oleh pihak eksternal External assurance -
308 Laporan Keberlanjutan 2019PT Indonesia Power
Lam
pira
n
GRI StandardPengungkapan Dislosure
HalamanPage OmissionPengungkapan
Dislosure Judul Title
G4 Electric Utilities Sector Disclosures 2013:Profil OrganisasiOrganizational Profile
EU1 Kapasitas terpasang berdasarkan sumber energi dan wilayahInstalled capacity based on the source of energy and region -
EU2
Jumlah energi yang dihasilkan berdasarkan sumber energi primer dan wilayahNet energy generated categorized by primary energy source and regulatory regime
-
EU3Jumlah akun pelanggan perumahan, industri industri dan komersialNumber of residential, industrial, institutional, and commercial customer accounts
-
EU5Alokasi pengurangan emisi CO2e berdasarkan kerangka perdagangan karbonAllocation of CO2e emission reduction based on carbon framework
-
Topik Material Material Topics
Ekonomi Economic
GRI 103:Pendekatan Manajemen 20162016 Management Approach
Kinerja Ekonomi Economic Performance
GRI 103-1 Penjelasan topik material dan BoundaryExplanation of the material topic and its Boundaries -
GRI 103-2 Pendekatan manajemen dan komponennyaThe management approach and its components -
GRI 103-3 Evaluasi Pendekatan ManajemenEvaluation of the management approach -
GRI 201:Kinerja EkonomiEconomic Performance
GRI 201-1 Nilai ekonomi langsung yang dihasilkan dan didistribusikanDirect economic value generated and distributed -
GRI 201-2
Implikasi finansial serta risiko dan peluang lain akibat dari perubahan iklimFinancial implications and other risks and opportunities due to climate change
-
GRI 201-3Kewajiban program pensiun manfaat pasti dan program pensiun lainnyaDefined benefit plan obligations and other retirement plans
-
GRI 201-4 Bantuan finansial yang diterima dari pemerintahFinancial assistance received from government -
GRI 103:Pendekatan Manajemen 20162016 Management Approach
Keberadaan Pasar Market Presence
GRI 103-1 Penjelasan topik material dan BoundaryExplanation of the material topic and its Boundaries -
GRI 103-2 Pendekatan manajemen dan komponennyaThe management approach and its components -
GRI 103-3 Evaluasi Pendekatan ManajemenEvaluation of the management approach -
GRI 202:Keberadaan PasarMarket Presence GRI 202-1
Rasio standar upah pegawai entry-level berdasarkan jenis kelamin terhadap upah minimum regionalRatios of standard entry level wage by gender compared to local minimum wage
-
GRI 202-2 Proporsi manajemen senior yang berasal dari masyarakat lokalProportion of senior management hired from the local community -
GRI 103:Pendekatan Manajemen 20162016 Management Approach
Dampak Ekonomi Tidak Langsung Indirect Economic Impacts
GRI 103-1 Penjelasan topik material dan BoundaryExplanation of the material topic and its Boundaries -
GRI 103-2 Pendekatan manajemen dan komponennyaThe management approach and its components -
GRI 103-3 Evaluasi Pendekatan ManajemenEvaluation of the management approach -
GRI 203:Dampak Ekonomi Tidak LangsungIndirect Economic Impacts
GRI 203-1 Investasi infrastruktur dan dukungan layananInfrastructure investments and services supported -
GRI 203-2 Dampak ekonomi tidak langsung yang signifikanSignificant indirect economic impacts -
Indeks Isi GRI Standards “Opsi Komprehensif” dan Pengungkapan Sektor Utilitas Listrik [GRI 102-55]GRI Standards “Comprehensive Option” and Electric Utilities Sector Disclosures Content Index [GRI 102-55]
309 Sustainability Report 2019
PT Indonesia Power
Atta
chm
ent
GRI StandardPengungkapan Dislosure
HalamanPage OmissionPengungkapan
Dislosure Judul Title
GRI 103:Pendekatan Manajemen 20162016 Management Approach
Anti-korupsi Anti-corruption
GRI 103-1 Penjelasan topik material dan BoundaryExplanation of the material topic and its Boundaries -
GRI 103-2 Pendekatan manajemen dan komponennyaThe management approach and its components -
GRI 103-3 Evaluasi Pendekatan ManajemenEvaluation of the management approach -
GRI 205:Anti-korupsiAnti-corruption
GRI 205-1 Operasi-operasi yang dinilai memiliki risiko terkait korupsiOperations assessed for risks related to corruption -
GRI 205-2
Komunikasi dan pelatihan tentang kebijakan dan prosedur anti-korupsiCommunication and training about anti-corruption policies and procedures
-
GRI 205-3 Insiden korupsi yang terbukti dan tindakan yang diambilConfirmed incidents of corruption and actions taken -
G4 Electric Utilities Sector Disclosures 2013:Penelitian dan PengembanganResearch and Development
Penelitian dan Pengembangan Research and Development
EU8
R&D dan biaya-biaya yang ditujukan untuk menjamin pasokan listrik yang dapat diandalkanR&D and allocated cost intended to warrant reliable electricity supply -
Lingkungan Environment
GRI 103:Pendekatan Manajemen 20162016 Management Approach
Energi Energy
GRI 103-1 Penjelasan topik material dan BoundaryExplanation of the material topic and its Boundaries -
GRI 103-2 Pendekatan manajemen dan komponennyaThe management approach and its components -
GRI 103-3 Evaluasi Pendekatan ManajemenEvaluation of the management approach -
GRI 302:EnergiEnergy
GRI 302-1 Konsumsi energi dalam organisasiEnergy consumption within the organization -
GRI 302-2 Konsumsi energi di luar organisasiEnergy consumption outside of the organization -
GRI 302-3 Intensitas energi Energy intensity -
GRI 302-4 Pengurangan konsumsi energi Reduction of energy consumption -
GRI 302-5 Pengurangan pada energi yang dibutuhkan untuk produk dan jasaReductions in energy requirements of products and services -
GRI 103:Pendekatan Manajemen 20162016 Management Approach
Air Water
GRI 103-1 Penjelasan topik material dan BoundaryExplanation of the material topic and its Boundaries -
GRI 103-2 Pendekatan manajemen dan komponennyaThe management approach and its components -
GRI 103-3 Evaluasi Pendekatan ManajemenEvaluation of the management approach -
GRI 303:AirWater
GRI 303-1 Pengambilan air berdasarkan sumber Water withdrawal by source -
GRI 303-2 Sumber air yang secara signifikan dipengaruhi oleh pengambilan airWater sources significantly affected by water withdrawal -
GRI 303-3 Daur ulang dan penggunaan air kembali Water recycled and reused -
GRI 103:Pendekatan Manajemen 20162016 Management Approach
Keanekaragaman Hayati Biodiversity
GRI 103-1 Penjelasan topik material dan BoundaryExplanation of the material topic and its Boundaries -
GRI 103-2 Pendekatan manajemen dan komponennyaThe management approach and its components -
GRI 103-3 Evaluasi Pendekatan ManajemenEvaluation of the management approach -
310 Laporan Keberlanjutan 2019PT Indonesia Power
Lam
pira
n
GRI StandardPengungkapan Dislosure
HalamanPage OmissionPengungkapan
Dislosure Judul Title
GRI 304:Keanekaragaman HayatiBiodiversity GRI 304-1
Lokasi operasional yang dimiliki, disewa, dikelola, atau berdekatan dengan kawasan lindung dan kawasan dengan nilai keanekaragaman hayati tinggi di luar kawasan lindungOperational sites owned, leased, managed in, or adjacent to, protected areas and areas of high biodiversity value outside protected areas
-
GRI 304-2
Dampak signifikan dari kegiatan, produk dan jasa pada keanekaragaman hayatiSignificant impacts of activities, products, and services on biodiversity
-
GRI 304-3 Habitat yang dilindungi atau direstorasiHabitats protected or restored -
GRI 304-4
Spesies Daftar Merah IUCN dan spesies daftar konservasi nasional dengan habitat dalam wilayah yang terkena efek operasiIUCN Red List species and national conservation list species with habitats in areas affected by operations
-
G4 Electric Utilities Sector Disclosures 2013:Keanekaragaman Hayati Biodiversity
EU13
Perbandingan keanekaragaman hayati dari offset habitat dengan keanekaragaman hayati dari area yang terpengaruhBiodiversity of offset habitats compared to the biodiversity of the affected areas
-
GRI 103:Pendekatan Manajemen 20162016 Management Approach
Emisi Emissions
GRI 103-1 Penjelasan topik material dan BoundaryExplanation of the material topic and its Boundaries -
GRI 103-2 Pendekatan manajemen dan komponennyaThe management approach and its components -
GRI 103-3 Evaluasi Pendekatan ManajemenEvaluation of the management approach -
GRI 305:EmisiEmissions
GRI 305-1 Emisi GRK (Cakupan 1) langsung Direct (Scope 1) GHG emissions -
GRI 305-2 Emisi energi GRK (Cakupan 2) tidak langsungEnergy indirect (Scope 2) GHG emissions -
GRI 305-3 Emisi GRK (Cakupan 3) tidak langsung lainnyaOther indirect (Scope 3) GHG emissions
Informasi tidak tersedia untuk 305-3 Saat ini, proses inventarisasi Emisi GRK Scope 3 masih dalam persiapan formatting, mekanisme inventarisasi data serta sumber-sumber emisi terkait. Diharapkan dalam lima tahun ke depan hal ini dapat dilakukan dan dilengkapi.Information unavailable for 305-3To date, Scope 3 GHG emission inventory process is still in the preparation for formatting, data inventory mechanism, and related emission sources. It is expected to be conducted and completed within the next five years
GRI 305-4 Intensitas emisi GRK GHG emissions intensity -
GRI 305-5 Pengurangan emisi GRK Reduction of GHG emissions -
GRI 305-6 Emisi zat perusak ozon (ODS)Emissions of ozone-depleting substances (ODS) -
GRI 305-7
Nitrogen Oksida (NOX), sulfur oksida (SOX), dan emisi udara signifikan lainnyaNitrogen oxides (NOX), sulfur oxides (SOX), and other significant air emissions
-
Indeks Isi GRI Standards “Opsi Komprehensif” dan Pengungkapan Sektor Utilitas Listrik [GRI 102-55]GRI Standards “Comprehensive Option” and Electric Utilities Sector Disclosures Content Index [GRI 102-55]
311 Sustainability Report 2019
PT Indonesia Power
Atta
chm
ent
GRI StandardPengungkapan Dislosure
HalamanPage OmissionPengungkapan
Dislosure Judul Title
GRI 103:Pendekatan Manajemen 20162016 Management Approach
Air Limbah (Ffluen) dan Limbah Effluents and Waste
GRI 103-1 Penjelasan topik material dan BoundaryExplanation of the material topic and its Boundaries -
GRI 103-2 Pendekatan manajemen dan komponennyaThe management approach and its components -
GRI 103-3 Evaluasi Pendekatan ManajemenEvaluation of the management approach -
GRI 306:Air limbah (efluen) dan LimbahEffluents and Waste
GRI 306-1 Pelepasan air berdasarkan kualitas dan tujuanWater discharge by quality and destination -
GRI 306-2 Limbah berdasarkan jenis dan metode pembuanganWaste by type and disposal method -
GRI 306-3 Tumpahan yang signifikan Significant spills -
GRI 306-4 Pengangkutan limbah berbahaya Transport of hazardous waste -
GRI 306-5 Badan air yang dipengaruhi oleh pelepasan dan/atau limpahan airWater bodies affected by water discharges and/or runoff -
Sosial Social
GRI 103:Pendekatan Manajemen 20162016 Management Approach
Kepegawaian Employment
GRI 103-1 Penjelasan topik material dan BoundaryExplanation of the material topic and its Boundaries -
GRI 103-2 Pendekatan manajemen dan komponennyaThe management approach and its components -
GRI 103-3 Evaluasi Pendekatan ManajemenEvaluation of the management approach -
GRI 401:KepegawaianEmployment
GRI 401-1 Perekrutan pegawai baru dan pergantian pegawaiNew employee hires and employee turnover -
GRI 401-2
Tunjangan yang diberikan kepada pegawai purnawaktu yang tidak diberikan kepada pegawai sementara atau paruh waktuBenefits provided to full-time employees that are not provided to temporary or part-time employees
-
GRI 401-3 Cuti melahirkan Parental leave -
G4 Electric Utilities Sector Disclosures 2013:KepegawaianEmployment
EU14
Program dan proses untuk memastikan tersedianya tenaga kerja terampilPrograms and processes to ensure the availability of a skilled workforce
-
EU15
Persentase pekerja yang akan memasuki masa pensiun dalam 5-10 tahun ke depan berdasarkan kategori pekerjaan dan wilayahPercentage of employees eligible to retire in the next 5 and 10 years broken down by job category and by region
-
EU16
Kebijakan dan persyaratan mengenai keselamatan dan kesehatan pegawai serta pegawai kontraktor dan subkontraktorPolicies and requirements regarding health and safety of employees and employees of contractors and subcontractors
-
EU17
Hari bekerja oleh kontraktor dan subkontraktor yang terlibat dalam kegiatan konstruksi maupun kegiatan operation dan maintenanceDays worked by contractor and subcontractor employees involved in construction, operation & maintenance activities
-
EU18
Persentase karyawan kontraktor dan subkontraktor yang dilatih terkait K3Percentage of contractor and subcontractor employees that have undergone relevant health and safety training
-
312 Laporan Keberlanjutan 2019PT Indonesia Power
Lam
pira
n
GRI StandardPengungkapan Dislosure
HalamanPage OmissionPengungkapan
Dislosure Judul Title
GRI 103:Pendekatan Manajemen 20162016 Management Approach
Keselamatan dan Kesehatan Kerja Occupational Health and Safety
GRI 103-1 Penjelasan topik material dan BoundaryExplanation of the material topic and its Boundaries -
GRI 103-2 Pendekatan manajemen dan komponennyaThe management approach and its components -
GRI 103-3 Evaluasi Pendekatan ManajemenEvaluation of the management approach -
GRI 403:Keselamatan dan Kesehatan KerjaOccupational Health and Safety
GRI 403-1
Perwakilan pegawai dalam komite resmi gabungan manajemen-pegawai untuk kesehatan dan keselamatanWorkers representation in formal joint management–worker health and safety committees
-
GRI 403-2
Jenis kecelakaan kerja dan tingkat kecelakaan kerja, penyakit akibat pekerjaan, hari kerja yang hilang, dan ketidakhadiran, serta jumlah kematian terkait pekerjaanTypes of injury and rates of injury, occupational diseases, lost days, and absenteeism, and number of work-related fatalities
-
GRI 403-3
Para pegawai dengan risiko kecelakaan atau penyakit berbahaya tinggi terkait dengan pekerjaan merekaWorkers with high incidence or high risk of diseases related to their occupation
-
GRI 403-4
Topik kesehatan dan keselamatan tercakup dalam perjanjian resmi dengan serikat buruhHealth and safety topics covered in formal agreements with trade unions
-
GRI 103:Pendekatan Manajemen 20162016 Management Approach
Pendidikan dan Pelatihan Training and Education
GRI 103-1 Penjelasan topik material dan BoundaryExplanation of the material topic and its Boundaries -
GRI 103-2 Pendekatan manajemen dan komponennyaThe management approach and its components -
GRI 103-3 Evaluasi Pendekatan ManajemenEvaluation of the management approach -
GRI 404:Pendidikan dan PelatihanTraining and Education
GRI 404-1 Rata-rata jam pelatihan per tahun per pegawaiAverage hours of training per year per employee -
GRI 404-2
Program untuk meningkatkan keterampilan pegawai dan program bantuan peralihanPrograms for upgrading employee skills and transition assistance programs
-
GRI 404-3
Persentase pegawai yang menerima tinjauan rutin terhadap kinerja dan pengembangan karierPercentage of employees receiving regular performance and career development reviews
-
GRI 103:Pendekatan Manajemen 20162016 Management Approach
Keberagaman dan Kesetaraan Peluang Diversity and Equal Opportunity
GRI 103-1 Penjelasan topik material dan BoundaryExplanation of the material topic and its Boundaries -
GRI 103-2 Pendekatan manajemen dan komponennyaThe management approach and its components -
GRI 103-3 Evaluasi Pendekatan ManajemenEvaluation of the management approach -
GRI 405:Keberagaman dan Kesetaraan PeluangDiversity and Equal Opportunity
GRI 405-1 Keanekaragaman badan tata kelola dan pegawaiDiversity of governance bodies and employees -
GRI 405-2 Rasio gaji pokok dan remunerasi perempuan dibandingkan laki-lakiRatio of basic salary and remuneration of women to men -
Indeks Isi GRI Standards “Opsi Komprehensif” dan Pengungkapan Sektor Utilitas Listrik [GRI 102-55]GRI Standards “Comprehensive Option” and Electric Utilities Sector Disclosures Content Index [GRI 102-55]
313 Sustainability Report 2019
PT Indonesia Power
Atta
chm
ent
GRI StandardPengungkapan Dislosure
HalamanPage OmissionPengungkapan
Dislosure Judul Title
GRI 103:Pendekatan Manajemen 20162016 Management Approach
Masyarakat Lokal Local Communities
GRI 103-1 Penjelasan topik material dan BoundaryExplanation of the material topic and its Boundaries -
GRI 103-2 Pendekatan manajemen dan komponennyaThe management approach and its components -
GRI 103-3 Evaluasi Pendekatan ManajemenEvaluation of the management approach -
GRI 413:Masyarakat LokalLocal Communities GRI 413-1
Operasi dengan keterlibatan masyarakat lokal, penilaian dampak, dan program pengembanganOperations with local community engagement, impact assessments, and development programs
-
GRI 413-2
Operasi yang secara aktual dan yang berpotensi memiliki dampak negatif signifikan terhadap masyarakat lokalOperations with significant actual and potential negative impacts on local communities
-
G4 Electric Utilities Sector Disclosures 2013:Masyarakat LokalLocal Communities
EU19
Partisipasi pemangku kepentingan dalam proses pengambilan keputusan terkait perencanaan energi dan pengembangan infrastrukturStakeholder participation in decision making processes related to energy planning and infrastructure development
-
EU20 Pendekatan untuk mengelola dampak perpindahanApproach to managing the impacts of displacement
Tidak berlaku untuk EU20 Hal ini dikarenakan pada setiap pembangunan infrastruktur pembangkitan, Indonesia Power mencatat tidak ada proyek Perusahaan yang mengakibatkan perpindahan atau pemukiman kembali pendudukNot applicable for EU20This is because in every power plant infrastructure development, Indonesia Power recorded no Company’s projects that resulted in the resettlement of residents
EU22
Jumlah orang yang terkena dampak perpindahan dan diberi kompensasi berdasarkan jenis proyekNumber of people physically or economically displaced and compensation, broken down by type of project
-
G4 Electric Utilities Sector Disclosures 2013:Perencanaan dan Tanggap Darurat/BencanaDisaster/ mergency Planning and Response
Perencanaan dan Tanggap Darurat/Bencana Disaster/Emergency Planning and Response
EU21
Langkah-langkah perencanaan kontinjensi, rencana manajemen bencana/ darurat dan program pelatihan serta rencana pemulihan/ restorasiContingency planning measures, disaster/emergency management plan and training programs, and recovery/restoration plans
-
Lam
pira
n
314 Laporan Keberlanjutan 2019PT Indonesia Power
Halaman ini sengaja dikosongkanThis page is intentionally left blank
Atta
chm
ent
315 Sustainability Report 2019
PT Indonesia Power
Lembar Umpan BalikFeedback Sheet
Profil PembacaReader’s Profile
Identifikasi kelompok pemangku kepentingan (pilih salah satu)Stakeholder’s Identification (choose one)
Terima kasih atas kesediaan Bapak/Ibu/Saudara untuk membaca Laporan Keberlanjutan PT Indonesia Power Tahun 2019. Untuk meningkatkan kualitas Laporan Keberlanjutan, meningkatkan transparansi kinerja keberlanjutan dan sebagai masukan untuk penyusunan Laporan Keberlanjutan Tahun 2020, Kami berharap Bapak/Ibu/Saudara untuk mengisi Lembar Umpan Balik ini dan mengirimkannya kembali kepada kami.
Thank you for your willingness to read 2019 PT Indonesia Power Sustainability Report. To improve the quality of the Sustainability Report, improve the transparency of sustainability performance, and as an input for the preparation of the 2020 Sustainability Report, We hope that you fill in the Feedback Sheet and send it back to us.
Nama LengkapFull Name :
Nama Institusi/ PerusahaanName of Institution/Company :
EmailEmail :
TelephonPhone :
Pemerintah Government Media Media
Pemegang Saham Shareholders Masyarakat/Komunitas Community
Pegawai Employee Pelanggan Customers
Pemasok Suppliers Lain-lain, mohon sebutkan: Others, please specify:
Akademisi Academic
Setuju Agree Tidak Setuju Don’t Agree
Setuju Agree Tidak Setuju Don’t Agree
Setuju Agree Tidak Setuju Don’t Agree
1. Laporan Keberlanjutan ini mudah dimengerti This Sustainability Report is easily understandable
2. Laporan ini sudah menggambarkan informasi positif dan negatif Perusahaan This report has described the Company’s positive and negative information
3. Laporan ini sudah menggambarkan komitmen Perusahaan yang sejalan dengan pencapaian tujuan pembangunan berkelanjutan This report has described the Company’s commitment in line with the achievement of sustainable development goals
Lam
pira
n
316 Laporan Keberlanjutan 2019PT Indonesia Power
5. Mohon berikan saran/usul/komentar Bapak/Ibu atas Laporan ini: Please provide your suggestions/inputs/comments for this Report:
Terima kasih atas partisipasi anda, Mohon kirimkan kembali lembar umpan balik ini kepada: Thank you for your participation, Please send this feedback sheet to:
Kinerja Ekonomi Economic PerformanceKeberadaan PasarMarket ExistenceDampak Ekonomi Tidak Langsung Indirect Economic Impact Anti Korupsi Anti CorruptionPenelitian dan Pengembangan Pembangkit Generator Research and DevelopmentEnergi EnergySumber Daya Air Water ResourcesKeanekaragaman Hayati Biodiversity
4. Topik Material apa yang paling penting menurut anda Material topics that are the most important for you (nilai 1 = paling tidak penting s/d 5 = paling penting) (1 - least important, 5 = most important)
EmisiEmissionLimbahWasteKepegawaianEmploymentPengelolaan Keselamatan dan Kesehatan KerjaOccupational Health and Safety ManagementPengembangan Kompetensi dan Karir PegawaiEmployee’s Competence and Career DevelopmentKeberagaman dan Kesetaraan PeluangDiversity and Equal OpportunitiesPemberdayaan MasyarakatCommunity EmpowermentPerencanaan dan Tanggap Darurat/ BencanaDisaster/Emergency Planning and Response
Lembar Umpan BalikFeedback Sheet
PT Indonesia PowerSekretaris Perusahaan Corporate SecretaryCentennial Tower, Lantai 7 7th FloorJl. Jend. Gatot Subroto Kav.24 & 25 Jakarta 12930
Phone : (62-21) 5261923 (Hunting)Fax : (62-21) 5251923, 5252623Email : [email protected]