Tugas Besar hjhj

Download Tugas Besar hjhj

Post on 08-Dec-2015

218 views

Category:

Documents

3 download

Embed Size (px)

DESCRIPTION

nbmnvhvh

TRANSCRIPT

<p>BAB IPENDAHULUANA. LATAR BELAKANGB. TUJUANMengetahui askep tentang 1. VARIOLA2. VARICELLA3. DIAPERST/RUAM POPOK BAYIBAB IIPEMBAHASANA. FARIOLA1. DEFINISIVariola adalah penyakit menular pada manusia yang disebabkan oleh virus variola major atau variola minor.Penyakit ini dikenal dengan nama Latinnya, variola atau variola vera, yang berasal dari kata Latin varius, yang berarti berbintik, atau varus yang artinya jerawat.Variola muncul pada pembuluh darah kecil di kulit serta di mulut dan kerongkongan. Di kulit, penyakit ini menyebabkan ruam, dan kemudian luka berisi cairan. V. major menyebabkan penyakit yang lebih serius dengan tingkat kematian 3035%. V. minor menyebabkan penyakit yang lebih ringan (dikenal juga dengan alastrim, cottonpox, milkpox, whitepox, dan Cuban itch) yang menyebabkan kematian pada 1% penderitanya.Akibat jangka panjang infeksi V. major adalah bekas luka, umumnya di wajah, yang terjadi pada 6585% penderita2. ANATOMI FISIOLOGIorgan kulit Epidermis (Kutilkula) Epidermis merupakan lapisan terluar dari kulit, yang memiliki struktur tipis dengan ketebalan sekitar 0,07 mm terdiri atas beberapa lapisan, antara lain seperti berikut :a. Stratum korneum yang disebut juga lapisan zat tanduk. Letak lapisan ini berada paling luar dan merupakan kulit mati. Jaringan epidermis ini disusun oleh 50 lapisan sel-sel mati, dan akan mengalami pengelupasansecara perlahan-lahan, digantikan dengan sel telur yang baru.b. Stratum lusidum, yang berfungsi melakukan pengecatan terhadap kulit dan rambut. Semakin banyak melanin yang dihasilkan dari sel-sel ini, maka warna kulit akan menjadi semakin gelap. Coba Anda perhatikan kulit orang suku Dani di Irian dengan suku Dayak di Kalimantan pada Gambar 7.8. Jika dikaitkan dengan hal ini apa yang terjadi pada kulit dari kedua suku tersebut? Selain memberikan warna pada kulit, melanin ini juga berfungsi untuk melindungi sel-sel kulit dari sinar ultraviolet matahari yang dapat membahayakan kulit. Walaupun sebenarnya dalam jumlah yang tepat sinar ultraviolet ini bermanfaat untuk mengubah lemaktertentu di kulit menjadi vitamin D, tetapi dalam jumlah yang berlebihan sangat berbahaya bagi kulit. Kadang-kadang seseorang menghindari sinar matahari di siang hari yang terik, karena ingin menghindari sinar ultraviolet ini. Hal ini disebabkan karena ternyata sinar ultraviolet ini dapat membuat kulit semakin hitam. Berdasarkan riset, sinar ultraviolet dapat merangsang pembentukan melanosit menjadi lebih banyak untuk tujuan perlindungan terhadap kulit. Sedangkan jika kita lihat seseorang mempunyai kulit kuning langsat, ini disebabkan orang tersebut memiliki pigmen karoten.c. Stratum granulosum, yang menghasilkan pigmen warna kulit, yang disebut melamin. Lapisan ini terdiri atas sel-sel hidup dan terletak pada bagian paling bawah dari jaringan epidermis. Stratum germinativum, sering dikatakan sebagai sel hidup karena lapisan ini merupakan lapisan yang aktif membelah. Sel-selnya membelah ke arah luar untuk membentuk sel-sel kulit teluar. Sel-sel yang baru terbentuk akan mendorong sel-sel yang ada di atasnya selanjutnya sel ini juga akan didorong dari bawah oleh sel yang lebih baru lagi. Pada saat yang sama sel-sel lapisan paling luar mengelupas dan gugur.Jaringan dermis memiliki struktur yang lebih rumit daripada epidermis, yang terdiri atas banyak lapisan. Jaringan ini lebih tebal daripada epidermis yaitu sekitar 2,5 mm. Dermis dibentuk oleh serabut-serabut khusus yang membuatnya lentur, yang terdiri atas kolagen, yaitu suatu jenis protein yang membentuk sekitar 30% dari protein tubuh. Kolagen akan berangsur-angsur berkurang seiring dengan bertambahnya usia. Itulah sebabnya seorang yang sudah tua tekstur kulitnya kasar dan keriput. Lapisan dermis terletak di bawahlapisan epidermis. Lapisan dermis terdiri atas bagian-bagian berikut. Folikel rambut dan struktur sekitarnyaa)Akar RambutDi sekitar akar rambut terdapat otot polos penegak rambut (Musculus arektor pili), dan ujung saraf indera perasa nyeri. Udara dingin akan membuat otot-otot ini berkontraksi dan mengakibatkan rambut akan berdiri. Adanya saraf-saraf perasa mengakibatkan rasa nyeri apabila rambut dicabut.b)Pembuluh DarahPembuluh darah banyak terdapat di sekitar akar rambut. Melalui pembuluh darah ini akar-akar rambut mendapatkan makanan, sehingga rambut dapat tumbuh.c)Kelenjar Minyak (glandula sebasea) Kelenjar minyak terdapat di sekitar akar rambut. Adanya kelenjar minyak ini dapat menjaga agar rambut tidak kering.d)Kelenjar Keringat (glandula sudorifera)Kelenjar keringat dapat menghasilkan keringat. Kelenjar keringat berbentuk botol dan bermuara di dalam folikel rambut. Bagian tubuh yang banyak terdapat kelenjar keringat adalah bagian kepala, muka, sekitar hidung, dan lain-lain. Kelenjar keringat tidak terdapat dalam kulit tapak tangan dan telapak kaki.e)Serabut SarafPada lapisan dermis terdapat puting peraba yang merupakan ujung akhir saraf sensoris. Ujung-ujung saraf tersebut merupakan indera perasa panas, dingin, nyeri, dan sebagainya.Jaringan dermis juga dapat menghasilkan zat feromon, yaitu suatu zat yang memiliki bau khas pada seorang wanita maupun laki-laki. Feromon ini dapat memikat lawan jenisDermis (Kulit Jangat)3. ETIOLOGIVirus poxvirus dikenal 2 tipe virus yang hamper identik tetapi menyebabkan 2 tipe variola ,variola mayor dan variola minor.4. GEJALA KLINIS1. Panas2. Pusing3. Tidak ada nafsu makan4. Nyeri diotot dan tulang5. Ruam dikulit6. Berwarna kemerahan7.Bentol-bentolTerdapat cairan , nanah, dan darah5. E. PATOFISIOLOGI VIRUSTransmisi secara aerogenDi pakaian penderita di saluran nafas bagian atas</p> <p> Kedalam tubuhVirus multifikasiSistem retikuloendotealDarah melepaskan diriKapiler drmis menuju sel epidermisBadan inklusi intra sitoplasmaInti sel keDIAGNOSA KEPERAWATAN VARIOLA1. gangguan integritas kulit b/d Trauma 2. Gangguan rasa nyaman : nyeri b/d kerusakan kulit/jaringan3. Potensial penularan infeksi b/d kerusakan perlindungan kulit4. Kurang pengetahuan b/d salah interpretasi informasi6. F.PENATALAKSANAAN1. Anak usia 12-18 bulan yang belum terkena cacar air harus mendapatkan satu dosis vaksinasi.2. Anak usia 19 bulan hingga 13 tahun yang belum terinfeksi cacar air harus mendapatkan satu dosis vaksinasi.3. Orang dewasa yang belum mengalami cacar air dan bekerja atau tinggal di lingkungan yang rentan penularan cacar air, seperti di sekolah, panti penitipan anak, rumah sakit, asrama, penjara, atau barak militer.4. Wanita usia produktif yang belum pernah terkena cacar air dan tidak sedang hamil.5. Orang dewasa dan remaja yang belum terkena cacar air dan tinggal dengan anak-anak.6. Orang yang hendak bepergian ke luar negeri dan belum mengalami cacar air.</p> <p>ASUHAN KEPERAWATANa) PENGKAJIAN1. Biodata2.Riwyat kesehatan3.Pola fungsi kesehatan4.Pola persepsi terhadap kesehatan5.Pola aktivitas latihan6.Pola istirahat tidur7.Pola nutrisi metabolik8.Pola elimnesi9.Pola kognitif perceptual10.Pola peran hubungan11.Pola nilai dan kepercayaan12.Pola konep diri13.Pola seksual reproduksib) DIAGNOSA KEPERAWATAN1. gangguan integritas kulit b/d Trauma 2. Gangguan rasa nyaman : nyeri b/d kerusakan kulit/jaringan3. Potensial penularan infeksi b/d kerusakan perlindungan kulit4. Kurang pengetahuan b/d salah interpretasi informasic) C INTERVENSI KEPERAWATANDX11. gangguan integritas kulit b/d Trauma tujuan : Setelah dilakukan tindakan keperawatan selama 224 jam diharapkan masalah bisa teratasiKh :Mencapai penyembuhan tepat waktuMenunjukan regenerasi jaringanIntervensi :Kaji ukuran warna kedalaman lukaR/memberikan informasi dasarSiapkan dan bantu prosedur balutanR/dibunakan untuk penutupNTinggikan area graft bila mungkin/tepatR/menurunkan pembekakanBerikan perawatan lukaR/nenyiapkan jaringan baru karena infeksi1. Gan gguan rasa nyaman : nyeri b/d kerusakan kulit/jaringantujuan : Setelah dilakukan tindakan keperawatan selama 224 jam diharapkan masalah bisa teratasiKH :Nyeri berkurang dan terkontrolEkspresi wajah rileksIntervensi :Berikan tempat tidur yang nyamanR/membantu menurunkan nyeriTutup luka sesegera mungkinR/Perubahan suhu dapat menyebabkan nyeri hebatBerikan analgesikR/untuk menurunkan nyeriKaji keluhan nyeriR/mengetahui seberapa darajat nyeri yang dirasakan1. Kurang pengetahuan b/d salah interpretasi informasiTujuan :Setelah dilakukan tindakan keperawatan selama 224 jam diharapkan masalah bisa teratasiKH :Menatakan pemahaman kondisi prognosis dan pengobatanMelakukan dengan benar tindakan tertentuIntervensi :Kaji ulang prognosis dan harapan yang akan datangR/Memberikan dasar pengetahuan dan informasiDiskusikan harapan pasien untuk kembali kerumahR/Pasien sering kali sulit memutuskan untuk pulsngDiskusiksn perawatan kulitR/luka pada kulit dapat sembuhJelaskan proses terbentuknya jaringanR/menungkatkan pertumbuhan kulit kembali yang optimald) IMPLEMENTASIUntuk meringankan gangguan tersebut, orangtua bisa melakukan kiat-kiat berikut:- Beri kompres dingin yang telah dibubuhi obat antigatal setiap 3-4 jam pada beberapa hari pertama. Mandi air hangat yang telah diberi obat antigatal setiap hari juga diperbolehkan. Mandi tidak membuat cacar menyebar.- Keringkan tubuh dengan cara menekan-nekannya dengan handuk, bukan menggosoknya.- Beri lotion atau bedak antigatal pada area yang gatal, tetapi tidak untuk muka, terutama di dekat mata.- Ganti baju setiap hari.- Cacar yang tumbuh di mulut membuat penderita sulit makan. Pilih makanan yang dingin, lembut, atau sudah diblender. Hindari makanan asam seperti jus jeruk atau asin karena bisa membuat luka di mulut makin perih.- Tanyakan kepala dokter tentang krim pereda nyeri untuk dioleskan pada luka di daerah genital jika cacar juga muncul di area intim tersebut.- Hindari pemberian aspirin karena berkaitan dengan sindroma Reye, yang bisa mengarah pada gangguan lever.- Potong kukunya agar tidak menggaruk ruam di kulit untuk menghindari timbulnya infeksi. Mungkin perlu memakai kaus tangan.- Pisahkan dari orang sehat agar mereka tidak tertular.e) EVALUASIMasalah gangguan integritas kulit b/d Trauma dikatakan teratasi apabila integritas kulit tersebut telah Mencapai penyembuhan tepat waktu dan mampu menunjukan regenerasi jaringan.</p> <p>B. VARICELLA1. DefinisiVaricella adalahinfeksiakut primer oleh virus Varicella Zooster yang menyerangkulitdanmukosa.Klinik terdapat gejala konstitusi, kelainan kulit polimorf, terutama berlokasi dibagian sentral (Ilmu penyakit kulit dan kelamin fakultas kedokteran VI).Varicella adalah penyakit akut menular yang ditandai oleh vesikel dikulit dan selaput lendir yang disebabkan oleh virus Varicella (Ngasyiyah, 2000).Varicella adalah penyakit infeksi akut dan cepat menular, yang disertai gejala konstitusi dengan kelainan kulit polimorf, terutama berlokasi bagian sentral tubuh (Mawarti Harap, 2000).</p> <p>2. EtiologiPenyakit ini disebabkan oleh virus Varicella Zooster. Penamaan virus ini memberi pengertian batuk infeksi primer virus ini menyebabkan penyakit Varicella, sedangkan reaktivitasnya menyebabkan Heripes Zooster.</p> <p>3. Patofisiologi</p> <p>4. Manifestasi KlinisMasa inkubasi penyakit ini 8 12 hari gejalanya : 1. Demam yang tidak terlalu tinggi2. Cepat merasa lelah3. Lelah dan lesu4. Tidak mau makan, pusing5. Kadang-kadang sakit perut, sakit punggung, anoreksia6. Dan timbulnya erupsi kulit.</p> <p>5. Komplikasi1. Bekas luka yang menetap2. Acate Cerebral Ataxia3. Bayi dibawah usia 28 hari4. Orang dengankekebalantubuhrendah.</p> <p>6. PenatalaksanaanPengobatanbersifatsimtomatikdenganantiperitikdan analgesic untukmenghilangkan rasa gataldapatdiberikan sedative.Secaralokaldapatdiberikanbedak yang ditambahdenganzat anti gatal( anti pruritus) seperti menthol, kamfordauntukmencegahpecahnyavesikelsecaradinisertamenghilangkan rasa gatal. Jikatimbulinfeksisekunderdapat pula diberikanobat-obatananti virussepertiasiktovirdengandosis 5 x 400mg sehariselama 7 haridenganhasil yang cukupbaik.</p> <p>ASUHAN KEPERAWATAN</p> <p>a. Pengkajian1. Identitaspasien2. Riwayatkesehatandulu3. Riwayat alergi kulit, reaksi alergi makanan, obat serta zat kimia, dan riwayat kanker kulit.4. Kaji kulit melibatkan seluruh area kulit termasuk membran mukosa, kulit kepala dan kuku.5. Kaji vital sign6. Kaji nyeri7. Kaji nutrisi8. Kaji riwayat imunisasi9. Riwayat kesehatan sekarang</p> <p>b) Diagnosa1. Gangguanintegritaskulitberdasarkandengan trauma2. Nyeriberdasarkankerusakankulit / jaringan3. Retensialpenularaninfeksiberdasarkandengankerusakanperlindungankulit4. Hipertensiberdasarkandenganpenyakit</p> <p>c) IntervensiDX 1 :Intervensi1. Menunjukkan perbaikan kulit dan mencegah terjadinya cidera berulang2. Mampu melindungi kulit dan mempertahankan kelembaban kulit dan perawatan alamia. Rasional Anjurkan mandi secara teratur Hindari menggaruk lesi Anjurkan pasien dengan menggunakan pakaian longgar Jaga kebersihan kulit agar tetap bersih dan kering Monitor kulit adanya kemerahan Oleskan lotion / minyak baby oil pada daerah yang tertekan.</p> <p>DX 2 :Intervensi1. Pasien mampu mengontrol nyeri2. Mampu mengenali nyeri (skala, infeksi, frekuensi dan tanda nyeri).3. Tanda vital dalam rentang normala. Rasional Lakukan pengkajian nyeri secara komprehensif termasuk lokasi, karakteristik, durasi, frekuensi kualitas dan faktor presipitasi. Observasi reaksi nonverbal dan ketidaknyamanan Ajarkan tekhnik non farmakologi untuk mengurangi nyeri Berikan analgetik untuk mengurangi nyeri Pilihrutepemberiansecaraintravenaatau intramuscular untukpengobatannyeriDX 3 :Intervensi1. Kliendapatmengetahuitentangfaktorresikoinfeksidandapatmelakukantindakanpencegahan yang tepatuntukmencegahinfeksi2. Jumlahleukositdalambatas normala. Rasional Kaji tanda dan gejala infeksi Anjurkan klien tanda-tanda infeksi Tingkatkan intake nutrisi Pertahankan tekhnik asepsis Kaji kondisi luka kulit</p> <p>DX 4 :Intervensi1. Suhutubuhdalamrentang normal2. Tidak ada perubahan warna kulit dan tidak pusing serta pasien merasa nyaman3. Nadidan RR dalamrentang normalRasional Monitor suhu sesering mungkin Monitor warna dan suhu kulit Monitor tekanan darah, nadi dan RR Berikan anti penetik Berikan intravena Kompres pasien pada lipat paha dan aksila Monitor intake dan output.</p> <p>d) EvaluasiMasalah gangguan intebritas kulit dikatakan teratasi apabila :1. Fungsikulitdanmembranmukosabaikdenganparut minimal2. Krustaberkurang3. Suhu kulit, kelembapan dan warna kulit serta membran mukosa normal alami, tidak terjadi kelainan neurogik.4. Tidak terjadi kelainan respiratorik.</p> <p>C.DIAPERST/RUAM POPOK BAYI1. DEFINISI Ruam popok adalah iritasi pada kulit bayi Ibu di daerah pantat. Ini bisa terjadi jika ia popok basahnya telat diganti, popoknya terlalu kasar dan tidak menyerap keringat, infeksi jamur atau bakteri atau bahkan eksemaRuam popok merupakan masalah kulit pada daerah genital bayi yang ditandai dengan timbulnya bercak-bercak merah dikulit, biasanya terjadi pada bayi yang memiliki kulit sensitif dan mudah terkena iritasi. Bercak-bercak ini akan hilang dalam beberapa hari jika dibasuh dengan air hangat, dan diolesi lotion atau cream khusus ruam popok, atau dengan melepaskan popok beberapa wakt...</p>