terapan nano material pada bidang biologi dan farmasi an dan ya - b

of 15/15
1 Nanomaterial: Pendekatan Baru Penanggulangan Kanker dan Diabetes Horasdia SARAGIH Laboratorium Sains Terapan, Fakultas Matematika dan Ilmu Pengetahuan Alam Universitas Advent Indonesia Jl. Kolonel Masturi No. 288 Parongpong, Bandung 40559, INDONESIA e-mail: [email protected] ABSTRAK Kanker dan diabetes adalah dua jenis penyakit yang sampai saat ini masih belum dapat diatasi secara sem- purna, sehingga oleh karena itu menjadi penyebab dominan kematian manusia. Efek samping kemoterapi menjadi masalah baru yang harus dihadapi oleh penderita kanker dan kurangnya suplai insulin dalam cairan darah menjadi masalah utama pada penderita diabetes. Obat kanker yang sangat beracun pada kemoterapi ti- dak dapat menyasar secara selektif sel-sel kanker, sel-sel normal juga cenderung dinonaktifkan. Dalam kasus diabetes, sel beta yang ada di pankreas sebagai generator insulin tidak dapat dipacu untuk memproduksi in- sulin sesuai kebutuhan sehingga kelebihan kandungan gula di dalam cairan darah menjadi tidak terkendali. Penemuan karakteristik nanomaterial yang unik memberikan harapan yang sangat berarti terhadap penyele- saian permasalahan di atas. Nanomaterial seperti carbon nano tube (CNT) dapat secara selektif hanya me- masuki sel-sel yang terserang kanker. CNT dapat leluasa menembus membran sel dan keluar-masuk sel tan- pa mengganggu kerja sel. Oleh karena itu CNT dapat dijadikan sebagai carrier pada sistim penghantaran obat pada penderita kanker pada proses kemoterapi. Sementara di lain pihak, usaha yang dilakukan untuk mengatasi permasalahan kurangnya kandungan insulin di dalam darah adalah dengan teknik oral. Namun oleh karena ukuran partikel insulin yang digunakan relatif besar, maka sulit bagi insulin untuk menembus le- luasa pembuluh darah. Dengan demikian, permasalahan ukuran partikel insulin harus diatasi. Teknik yang paling efektif adalah menggunakan rekayasa nanoteknologi untuk mendisain ukuran partikel insulin dalam orde nanometer, atau memacu sel beta dengan nanocitosan untuk memproduksi secara tepat insulin yang di- butuhkan. Pada tulisan ini perkembangan penangangan kedua jenis penyakit di atas dengan pendekatan na- noteknologi akan diuraikan. Kata kunci: NANOMATERIAL, SWCNT, MWCNT, NANOKITOSAN, KANKER, DIABETES. 1. PENDAHULUAN Nanomaterial adalah suatu materi yang uku- rannya berada pada kisaran 1-100 nanometer (nm). Materi ini dapat dalam bentuk kristal yang atom- atomnya tersusun secara teratur maupun dalam bentuk non-kristal (Kumar et al., 2005). Ditemu- kan bahwa perilaku materi yang berukuran nano- meter sangat berbeda dibanding dengan perilaku pada ukuran yang lebih besar (bulk). Perbedaan yang sangat dramatis terjadi pada sifat fisika, ki- mia dan sifat biologinya. Perbedaan yang terjadi memberikan manfaat yang sangat besar sehingga membawa material berukuran nanometer sebagai material unggul pada berbagai bidang terapan, termasuk biologi dan farmasi. Yang paling menarik lagi adalah sejumlah si- fat-sifat yang dimilikinya dapat diubah-ubah seca- ra signifikan melalui pengontrolan ukuran pada orde nanometer tersebut, pengaturan komposisi kimia, modifikasi permukaan, dan pengontrolan interaksi antar-partikelnya. Sifat-sifat yang bergan- tung pada ukuran ini dipercaya sebagai hasil dari tingginya rasio luas permukaan terhadap volume material. Beberapa tahun terakhir penelitian terhadap nanomaterial menjadi intensif dilakukan di berba- gai negara, baik menyangkut metode sintesanya maupun sifat-sifat yang dihasilkannya. Pada bi- dang energi, nanomaterial dilibatkan untuk meng- hasilkan sel surya yang lebih efesien. Pada bidang kesehatan, obat-obatan dikembangkan mengguna- kan nanomaterial sehingga lebih cepat larut dan bereaksi untuk menghasilkan apa yang disebut dengan obat pintar (smart drug) yang dapat men- cari sel-sel tumor secara presisi dan mematikannya tanpa mengganggu sel-sel sehat tetangganya (So- na, 2010; Wong et al., 2011). Berbagai metode sintesa dan terapan baru, dilaporkan hari demi ha- ri. Proses sintesa nanomaterial dapat dilakukan secara top down maupun secara bottom up (Kumar et al., 2005). Secara top down, material yang beru- kuran besar digiling (grinding) sampai ukurannya

Post on 05-Jul-2015

218 views

Category:

Documents

6 download

Embed Size (px)

TRANSCRIPT

1Nanomaterial: Pendekatan Baru Penanggulangan Kanker dan Diabetes Horasdia SARAGIH Laboratorium Sains Terapan, Fakultas Matematika dan Ilmu Pengetahuan Alam Universitas Advent Indonesia Jl. Kolonel Masturi No. 288 Parongpong, Bandung 40559, INDONESIA e-mail: [email protected] ABSTRAK Kanker dan diabetes adalah dua jenis penyakityang sampai saat inimasihbelumdapatdiatasisecara sem-purna,sehinggaolehkarenaitumenjadipenyebabdominankematianmanusia.Efeksampingkemoterapi menjadi masalah baru yang harus dihadapi oleh penderita kanker dan kurangnya suplai insulin dalam cairan darah menjadi masalah utama pada penderita diabetes. Obat kanker yang sangat beracun pada kemoterapi ti-dak dapat menyasar secara selektif sel-sel kanker, sel-sel normal juga cenderung dinonaktifkan. Dalam kasus diabetes, sel beta yang ada di pankreas sebagai generator insulin tidak dapat dipacu untuk memproduksi in-sulinsesuai kebutuhan sehingga kelebihan kandungangula di dalam cairandarah menjaditidakterkendali. Penemuan karakteristik nanomaterial yang unik memberikan harapan yang sangat berarti terhadap penyele-saianpermasalahandiatas.Nanomaterialseperticarbonnanotube(CNT)dapatsecaraselektifhanyame-masuki sel-sel yang terserang kanker. CNT dapat leluasa menembus membran sel dan keluar-masuk sel tan-pamengganggukerjasel.OlehkarenaituCNTdapatdijadikansebagaicarrierpadasistimpenghantaran obatpadapenderitakankerpadaproseskemoterapi.Sementaradilainpihak,usahayangdilakukanuntuk mengatasipermasalahankurangnyakandunganinsulindidalamdarahadalahdenganteknikoral.Namun oleh karena ukuran partikel insulin yang digunakan relatif besar, maka sulit bagi insulin untuk menembus le-luasapembuluhdarah.Dengandemikian,permasalahanukuranpartikelinsulinharusdiatasi.Teknikyang palingefektifadalahmenggunakanrekayasananoteknologiuntukmendisainukuranpartikelinsulindalam orde nanometer, atau memacu sel beta dengan nanocitosan untuk memproduksi secara tepat insulin yang di-butuhkan. Pada tulisan ini perkembangan penangangan kedua jenis penyakit di atas dengan pendekatan na-noteknologi akan diuraikan. Kata kunci: NANOMATERIAL, SWCNT, MWCNT, NANOKITOSAN, KANKER, DIABETES. 1.PENDAHULUAN Nanomaterialadalahsuatumateriyanguku-rannya berada pada kisaran 1-100 nanometer (nm). Materiinidapatdalambentukkristalyangatom-atomnyatersusunsecarateraturmaupundalam bentuknon-kristal(Kumaretal.,2005).Ditemu-kanbahwaperilakumateriyangberukurannano-metersangatberbedadibandingdenganperilaku padaukuranyanglebihbesar(bulk).Perbedaan yangsangatdramatisterjadipadasifatfisika,ki-miadansifatbiologinya.Perbedaanyangterjadi memberikanmanfaatyangsangatbesarsehingga membawamaterialberukurannanometersebagai materialunggulpadaberbagaibidangterapan, termasuk biologi dan farmasi.Yangpalingmenariklagiadalahsejumlahsi-fat-sifatyang dimilikinyadapatdiubah-ubah seca-rasignifikanmelaluipengontrolanukuranpada ordenanometertersebut,pengaturankomposisi kimia,modifikasipermukaan,danpengontrolan interaksi antar-partikelnya. Sifat-sifat yang bergan-tungpadaukuraninidipercayasebagaihasildari tingginyarasioluaspermukaanterhadapvolume material.Beberapatahunterakhirpenelitianterhadap nanomaterialmenjadiintensifdilakukandiberba-gainegara,baikmenyangkutmetodesintesanya maupunsifat-sifatyangdihasilkannya.Padabi-dangenergi,nanomaterialdilibatkanuntukmeng-hasilkan sel surya yang lebih efesien. Pada bidang kesehatan,obat-obatandikembangkanmengguna-kannanomaterialsehinggalebihcepatlarutdan bereaksiuntukmenghasilkanapayangdisebut denganobatpintar(smartdrug)yangdapatmen-cari sel-sel tumor secara presisi dan mematikannya tanpamengganggusel-selsehattetangganya(So-na,2010;Wongetal.,2011).Berbagaimetode sintesadan terapanbaru,dilaporkanhari demi ha-ri.Prosessintesananomaterialdapatdilakukan secara top down maupun secara bottom up (Kumar et al., 2005). Secara top down, material yang beru-kuranbesardigiling(grinding)sampaiukurannya 2berorde nanometer. Alat penggiling paling populer adalahballmill.Disamping itu dilakukan dengan caraevaporasi.Materialberukuranbesardipa-naskansampaipadatemperaturuapnyasehingga terevaporasimenghasilkanpartikel-partikelberu-kurannanometer.Nanomaterialyangdihasilkan pada kedua cara di atas distabilisasi dengan meng-gunakanlarutankimiasepertipolyvinylalcohol (PVA)ataupolyethileneglycol(PEG)sehingga membentuknanokoloidyangstabil.Sayangnya, caraevaporasiberbiayatinggikarenamengguna-kan peralatan yang mahal. Secara bottomupsintesananomaterialdilaku-kandenganmereaksikanberbagailarutankimia denganlangkah-langkahtertentuyangspesifik sehingga terjadi suatu proses nukleasi yangmeng-hasilkan nukleus-nukleus sebagai kandidat nanpar-tikelsetelahmelaluiprosespertumbuhan.Laju pertumbuhannukleusdikendalikansehingga menghasilkannanopartikeldengandistribusiuku-ran yang relatif homogen. Logamkoloid(nanomateriallogamdalam bentukkoloid)telahberhasildisintesasecaratop down maupun secara bottom up. Secara bottom up, paduanlogamorganik(metalorganic)sering nakan.Paduanlogamorganikdidekomposisi(di-reduksi)secaraterkontrolsehinggaikatanlogam danligannyaterpisah.Ion-ionlogamhasil posisibernukleasimembentuknukleus-nukleus yang stabil, yang dibangkitkan baik dengan meng-gunakan katalis maupun melalui proses tumbukan. Selanjutnyanukleus-nukleusstabiltersebutber-tumbuhmembentuknanopartikel.Secaraskematis prosesiniditunjukkanpadagambar1(Kumaret al.,2005).Untukmenghindariprosesaglomerasi antarananopartikel-nanopartikelyangada,lang-kahstabilisasidilakukandenganmenggunakan larutan separator. Gambar 1. Skema proses pembentukan nanomaterial logam koloid secara bottom up (Kumar et al., 2005). 2.TEMPERATURLEBURNANOMATERI-AL Temperaturlebursuatumaterialsangatber-gantungpadaukuranpartikelnya.Semakinkecil ukuransuatupartikelmakinkeciltemperaturle-burnya(Schaefer,2010).Emaspadaukuranbesar (bulk)memilikitemperaturlebur1.064oC,semen-tarajikaukurannya2nmtemperaturleburnyatu-runmenjadi200oC.Hubungantemperaturlebur dengan ukuran partikel dinyatakan oleh persamaan 1): Im(R) = Im() I1 - 2upHR](1) 3denganTm()temperaturleburpadaukuranbulk, adalahsuatukonstantayangbergantungpada jenismaterial,adalahmassajenismaterial,R adalahjari-jaripartikel,danHadalahkalorlaten fusi material. Penurunantemperaturleburakibatmengecil-nyaukuranpartikeldipahamidarikonsepikatan antaratom.Atom-atomyangmenempatiposisidi dalammaterialmengalamiikatandenganatom-atomlainyangadadisekelilingnyadarisegala arahsehinggaikatannyasangatkuat.Sementara atom-atomyangadadipermukaanhanyamenga-lami ikatan dari arah dalam dan dari arah samping sehinggaikatanyangdialaminyasangatlemah. Semakinkecilukuranpartikel,persentasijumlah atom yang ada di permukaan menjadi semakin be-sardibandingdenganjumlahatomyangadadi dalampartikelsehinggasemakinbanyakatom-atomyangmengalamiikatanlemah.Akibatnya, energiikatrata-rataantaratommakinlemahdan menurunkan temperatur lebur. 3.LEBARCELAHPITAENERGINANO-MATERIAL Lebarcelahpitaenergisuatumaterialdi-pengaruhiolehukuranpartikelnya(Schaefer, 2010).Dalamprakteknyalebarcelahpitaenergi dapatdiperolehdaripengujiandenganmengguna-kanspektrometerUltravioletVisible(UV-Vis Spectrometer).Olehkarenaitu,jikalebarcelah pitaenergisuatumaterialdapatdiperoleh,maka ukuranpartikelnyadapatditentukan.Hubungan antara jari-jari partikel r dan lebar celah pita energi Edapatdihitungdenganmenggunakanperumu-san yang diturunkan oleh Brus, yaitu: E = Eg - EgBuIk =h28c2I1mcmc +1mhmc] -1,8c4nssc

(2) dimana: Eg adalah energi transisi hasil pengukuran nanopartikel,EgBulkadalahenergitransisimaterial dalamukuranbulk,hadalahkonstantaPlank,e adalahmuatanelektron,moadalahmassadiam elektron, me adalah massa efektif elektron, mh ada-lahmassahole,danomasing-masingadalah konstantadielektrikmaterialdanpermitivitasnya pada ruang hampa. Suku pertama pada persamaan 2 muncul seba-gaiakibatdariketerbatasanruanggerakelektron dan hole di dalam partikel oleh karena ukuran par-tikelyangsangatkecil(ordenanometer).Efek ukuraninimemperbesarlebarcelahpitaenergi (memperbesar jarak antara pita valensi dengan pita konduksi).Untuk ukuranmaterial yang sangat be-sar(bulk),nilairdapatdianggapmenujuse-hingganilaisukupertamadankeduamenjadinol. SukukeduamunculakibatadanyatarikanCo-loumb antara elektron dengan hole setelah elektron mengalamieksitasi.Ruanggerakelektronyang terbatasmengakibatkanjarakelektrondanhole menjaditerbatasdalamartitidakbisajauh.Aki-batnya,tarikanantarakeduanyaselaluadayang berimbaspadapenguranganenergiyangdimiliki elektron setelah mengalami eksitasi. 4.REAKTIVITASKIMIANANOMATERI-AL Penguranganukuransuatumaterialkeorde nanometermengubahsecaradrastissifatreaktivi-taskimianya.Haliniterjadikarenafraksijumlah atomyangmenempatipermukaanmeningkat. Reaktivitas kimia suatu partikel sangat bergantung pada jumlah atom yang ada pada permukaan parti-keltersebutkarenaatom-atominilahyangakan melakukankontaklangsungdenganatom-atom partikel yang lain (Schaefer, 2010). Misalkansuatupartikelmemilikijari-jarir. Luas permukaan partikel adalah So=4r2. Jika jari-jari efektif suatu atom adalah a, maka luas penam-pangefektifnyaadalahs=a2.Dengandemikian, jumlahatomyangmenempatipermukaanpartikel adalah: Ns = Scs = 42u2(3) VolumepartikeladalahVo=(4/3)r3danvolume satuatomadalahv=(4/3)a3.Dengandemikian jumlahatomyangterkandungdalampartikelter-sebut adalah: N = vc = 3u3 (4) sehinggafraksijumlahatomyangmenempati permukaan adalah: NsN = 4u(5) Daripersamaan5dapatsecarajelasterlihat bahwabilajari-jaripartikelrdiperkecil,maka fraksijumlahatomyangterdapatdipermukaan partikelakansemakinmeningkatsehinggame-ningkatkan reaktivitas kimia partikel. 45.TERAPAN NANOMATERIAL Nanomaterialmemilikipotensiyangsangat besaruntukditerapkanpadabidangbiologidan farmasi.Beberapadiantaranyatelahdicobadan diinvestigasi.Mengacupadakarakteristikyang dimilikinya,beberapajenisnanomaterialtelahdi-gunakan pada teknologi (Kumar et al. 2005): pela-belan sel, penghantaran obat (drug delivery), peru-sakanseltumordenganpemanasan(hyperther-mia), dan penjelas citra magnetic resonance imag-ing(MRI).Pengembangandanjenisterapanna-nomaterialakanterusbertumbuhmengingatuku-ranbagian-bagiandariselsebagaiunitkehidupan beradadalamordenanometer.Proteinmemiliki ukuran sekitar 5 nm, DNA, yang memiliki struktur heliks,memiliki diameter sekitar 2nm,danmasih banyaklagibagianorgantubuhyangmemiliki ukurandalamordenanometer.Nanomaterialme-milikikesetaraanukurandenganbanyakbagian dalam organ tubuh. Obat-obatanyangberukuranmikrometersulit berinteraksi dengan protein maupun bagian-bagian dariselyangukurannyaberordenanometer.Oleh karenafaktorukuranini,banyaktindakanpengo-batanyanggagalmenyembuhkan.Nanomaterial diyakinidapatdigunakanuntukmengontrolinte-raksiantarasatubiomolekulkebiomolekulyang lain di dalam tubuh sehingga memiliki kesensitifan yangtinggi,kepresisianpengontrolanyangtinggi, dandapatdilakukansecaraselektif.Untukusaha tersebut nanomaterial harus didisain dapat berinte-raksidenganproteindanseltanpamengganggu aktifitasnormaldarikeduanyadanharusbiocom-patible dan tidak beracun. 6.PELABELAN SEL NanomateriallogamEudanTbdalambentuk batangannanotelahditumbuhkandanmemiliki sifatfluorosensyangunik.Sifatunikfluorosens iniberkaitandenganlebarcelahpitaenerginya. BatangannanologamEudanTbdapatmelintasi membranseldenganbaiksehinggadapatdikirim ke dalam sitoplasma dan tidak merusak sistim ker-ja sel. Oleh karena itu, kedua batangan nano logam tersebutdapatdigunakansebagaimediapembawa (carrier)dalammenghantarkanberbagaijenisob-at-obatan ke dalam sel.Sifat unik fluoresens batangan nano Eu dan Tb membukapeluanguntukditerapkansebagaipela-belseluntukmendeteksidanmemonitorperuba-hanstrukturgeometrisel.Halyangmenguntung-kanlagibahwa,keduajenislogamtersebutdalam bentuk batangan nano, tidak beracun. Untuk mem-fungsionalisasikeduajenisbatangannanoini, permukaanbatangandibalutdenganpolimerami-nopropyltrimethoxysilane(APTMS)ataumer-capto-propyl trimethoxy silane (MPTMS).

Gambar 2. Potret transmission electron microscopy (TEM) batangan nanomaterial Eu (A) dan Tb (B) yang disinte-sa oleh Patra et al. (Patra et al., 2006). Patraetal.telahmensintesakeduajenisba-tangannano di atas danmengujinya pada sel786-Odanselhumanumbilicalveinendothelial(HU-VEC).BatangannanologamEudanTbdisintesa denganteknikpemanasanmenggunakangelom-bangmikrodenganprekursorEuPO4H2Odan TbPO4H2O. Hasilnya ditunjukkan pada gambar 2. Keberhasilankeduabatangannanotersebutdalam melintasimembransel786-OdanselHUVECdi-buktikan dengan hasil potret yang ditunjukkan pa-da gambar 3.(A)(B) 5Dengan menggunakan confocal laser scanning microscopypadapanjanggelombang=488nm, fluoresens batangannano logam Eudan Tb dalam sel786-Omenghasilkanwarnahijauyangsangat jelas (gambar 3). Batangan nano logam Eu dan Tb olehsifatfluoresennyadapatdiidentifikasiberada padasitoplasmasel.Dilainpihak,dibandingkan denganpotretselyangtidakmengandungbatan-gannanologamEudanTb(selkontrol)sebagai-manaditunjukkanpadagambar3a,poladanuku-ran sel lebih jelas teramati bila di dalamnya terda-patbatangannanologamEudanTb(gambar3b dan3c).Fenomenafluoresenshijauinidihasilkan olehionEu3+danionTb3+didalamsel.Hasilini menunjukkanbahwakeduajenisbatangannano tersebutdapatdenganbaikmelintasimembransel 786-O.Jikaterjadigangguanpadasel786-Ose-hinggageometrisnyaberubah,makaperubahan tersebutdapatdimonitordenganmenggunakan batangan nano logam Eu dan Tb. Gambar 3. Potret fluoresens sel 786-O yang mengandung batangan nano Eu dan Tb. (A) sel 786-O tanpa diberi batangan nano Eu dan Tb, (B) sel 786-O yang mengandung batangan nano Eu, dan (C) sel 786-O yang mengandung batangan nano Tb. Posisi yang ditandai dengan tanda panah menunjukkan fluoresens hijau tajam yang dihasilkan oleh batangan nano di dalam sel. (Patra et al., 2006). PadaselHUVEC,batangannanologamEu danTbtidakmenghasilkanfluorosenshijaume-lainkan fluoresensmerah,dan menunjukkankeha-dirannya pada sitoplasma sel. Sifat fluoresens yang berbedapadajenisselyangberbedainimenghan-tarkanbatangannanoEudanTbmenjadimedia pembeda sel. Oleh kehadiran kedua batangan nano Eu dan Tb pada sitoplasma sel HUVEC maka ben-tuk dan ukuran sel HUVEC juga sangat jelas dapat teramati.Halinijugamenunjukkanbahwabatan-gannanokedualogamdiatasdapatdenganbaik melintasi sel HUVEC.Dari hasil pengujian penggunaan batangan na-nokedualogamEudanTbterhadapkeduajenis sel786-OdanHUVEC,dimanaditunjukkanbah-wa untuk sel yang berbeda diperoleh warna fluore-sensyangberbeda,makakeduajenisbatangan nanologamtersebutdapatdigunakansebagaiin-strumenpelabelseltermasukmendeteksisecara dinisel-selkanker.Pendeteksiandapatdilakukan secarapresisidansecaradinisebelumsel-sel kanker menyebar secara luas. 7.NANOMATERIALDANSELKANKER: PENGHANTARANOBAT(DRUGDELI-VERY) Saatinitindakanyangdapatdilakukanterha-dappenderitakankerhanyalahmemperpanjang umur penderita, tetapi tidak untuk menyembuhkan. Suatuusahaharusdilakukanuntukmenemukan suatucarasehinggatidakanberubahkearahpe-nyembuhan.Diberbagainegaramelaluilembaga penelitianyangdimilikisaatinisedangbekerja keras untuk hal tersebut. Kemoterapi(terapikimia,yaitu:memasukkan zat-zat kimia atau obat-obatan ke dalam tubuh baik secaraoralmaupunnon-oraldalamkurunwaktu tertentu untuk membunuh sel-sel kanker) yang saat ini kita kenal sebagai tindakan yang dilakukan ter-hadap penderita kankermenjadi jalan terakhir (se-laintindakanpembedahan)yangdilakukanoleh para praktisi kesehatan dalam melakukan tindakan terhadappasienpenderitakanker.Sayangnya,sa-sarantujuobatan-obatankemoterapibelumdapat secaraspesifikdikendalikanmenujusel-selyang terserang kanker. Sel-sel sehat di dalam tubuh ser-ingmenjadikorbanseranganobat-obatankemote-6rapiyangsangatberacunkarenajugadimasuki olehzat-zatkimiatersebut.Olehkarenaitu,efek sampingkemoterapitidakdapatdihindarkandan bahkanmenjadimasalahtambahanyangmuncul padapenderita,danseringmenjadipenyebabuta-ma kematian.Ketidak-spesifikansasarankemoterapime-nyebabkanparapraktisi kesehatan sulit untukme-naikkandosisobat-obatanpadapelaksanaanke-moterapi,yangakhirnyatidakdapatmenyelesai-kanataumembunuhsel-selkankerpadatubuhsi penderita.Obatan-obatanyangdigunakanbelum dapatsecaraselektifmenyasarjenisselataujenis organ tertentu yang spesifik di dalam tubuh. Ideal-nya,obatan-obatantersebut(karenasifatnyayang sangat beracun) hanya menyasar pada target-target sel atau organ-organ tertentu yang terserangkank-er untuk menghindari penyerangan terhadap sel-sel sehat yang ada. a.CARBON NANO TUBE (CNT) Carbon nano tube (CNT) adalah suatu material yangdisusunolehatom-atomcarbonyangsaling berikatan, dimana satu atom carbon berikatan den-gantigaatomcarbonyanglain.Rangkaianikatan tersebutmembentuksuatutabung(tube)silinder yangjari-jarinyadalamordenanometer(gambar 4).CNTdapatditumbuhkanmembentuktabung silindertunggal(singlewallcarbonnanotube, SWCNT)dantabungsilinderganda(multiwall carbon nano tube, MWCNT).

(a) (b) Gambar 4. Struktur supramolekul carbon: carbon nano tube (CNT). (a) tabung silinder tunggal carbon (single wall carbon nano tube, SWCNT) dan (b) tabung silinder ganda carbon (multi wall carbon nano tube, MWCNT). Unsur carbon dapatmemiliki berbagai macam bentuk geometri yang setiap geometrinya memiliki sifat yang berbeda. Hal tersebut terjadi karena car-bonmemilikitigakemungkinanuntukberhibrida-si,yaitu:sp,sp2,dansp3yangmerupakankonse-kuensisifatnyasebagaiunsurgolonganIV.CNT adalahsalahsatujenisstruktursupramolekuldari carbondisampingstruktur-strukturlainseperti: graphene, grafit, intan, dan fullerene. Sifat Termal CNT merupakan konduktor panas yang sangat baikdibandingdenganmateriallainyangpernah kita kenal. SWCNT yang sangat kecil (ultra small) bahkan memperlihatkan sifat superkonduktor pada temperatur di bawah 20 K. SWCNT dan MWCNT merupakankonduktorpanasyangsangatbaikse-panjang tabungnya. Sifat konduktivitas panas yang baiksepanjangtabunginidisebabkanolehfeno-menakonduksibalistik(ballisticconduction)se-panjang tabung. CNT dapat mentransmisikan daya panaslebihbesardari6000WK/mpadatempera-turruang,bandingkandenganpenghantarpanas yangpalingpopulersepertitembagayanghanya mampumengkonduksikandayapanasmaksimal 385WK/m.CNTmampustabilpadatemperatur sekitar 7500C tekanan atmosfer dan sekitar 28000C pada tekanan vakum. Sifat Optik SifatoptikCNTsangatdipengaruhiolehuku-rannya. Lebar celah pita energi optiknya dipernga-ruhi oleh ukuran diameternya. Makin kecil diame-terCNT,makinbesarlebarcelahpitaenergiop-7tiknya. Hubungan kedua parameter ini ditunjukkan padagambar5.Lebarcelahpitaenergioptikini mempengaruhiwarnacahayayangdapatdiemisi olehgCNT,baikolehCNTyangbersifatmetalik (M) maupun CNT yang bersifat semikonduktif (S). Gambar 6 menunjukkan warna cahaya yang diemi-siolehCNT(bersifatmetalikdansemikonduktif) padabeberapaukurandiameternya. Gambar 5. Hubungan besar jari-jari CNT dengan lebar celah pita energi optiknya. Gambar 6. Hubungan besar diameter CNT (CNT metalik (M) dan CNT semikonduktif (S)) dengan warna cahaya yang diemisi. Sifat Kimia SifatreaktivitaskimiaCNTjugadipengaruhi olehukurandiametertabungnya.DiameterCNT yang semakin kecil akan meningkatkan reaktivitas kimianya karena luas permukaan spesifiknya (luas permukaan/massa)makinmembesar.Ikatankova-len pada CNT juga dapat dimodifikasi dengan cara mendispersi CNT pada pelarut yang sesuai.Mengacupadasifat-sifatdiatas,selanjutnya CNTdicobaditerapkanpadabidangfarmasiyang dirancangsebagaiperangkatpembawa(carrier) berbagaijenisobat-obatankedalamsel,termasuk kedalamselyangterserangkanker.Halinidi-mungkinkankarenadindingtepitabungCNTda-patdifungsionalisasi,sepertimisalnya,dengan DNA,proteindanpolyethyleneglycol(PEG)se-hinggadanolehkarenaitudimungkinbagiCNT untukmelintasimembranseldenganleluasadan tidak mengganggu kerja sel. SWNTsulitlarutdidalamair,sehinggatidak dapatlangsungdigunakansebagaipembawa.oleh karenaitudiperlukansuatumodifikasisecaraki-mia untuk meningkatkan kelarutannya. Di samping 8meningkatkankelarutannya,modifikasikimiater-sebut juga sekaligus memperbaiki kebiokompatibi-litasannyadanjugameningkatkankemampuannya untukdapatberpenetrasikedalamsel.Bentuk modifikasidapatdilakukandengan:(1)pemasan-gansecarakovalengrupmolekulkimiatertentu pada tubuh (keangka) SWCNT melalui reaksi kon-jugasi-, (2) membalutkan berbagai jenis molekul-molekul fungsional pada dinding SWCNT, dan (3) mengisimolekul-molekulfungsionalkebagian dalam tabung SWCNT.Menkonjugasi SWNT dengan DNA adalah ca-rafungsionalisasikimiayangumumdilakukandi sampingdenganprotein(gambar7a).Dengan mengkonjugasiSWNTdenganDNAatauprotein, makaSWNTdenganmudahdapatlarutdidalam air dan sekaligusdapatmudahmelintasimembran sel menuju ke sitoplasma. Jenis molekul fungsion-alyangdikonjugasikaninimenentukan:(1)sebe-rapalamaSWNTberadadalamcairandarahikut bersirkulasi,(2)sebarapalamaSWNTdapatber-tahan hidup sebelum berubah struktur, (3) ke organ mana SWNT dapat ditujukan, dan (4) berakumula-si-tidaknyaSWNTdidalamorgantubuhataudi bagianorganmanaSWNTakanberakumulasi. Untukmenyasarorgan-organtertentuatausel-sel tertentu di dalam tubuh, dibutuhkan molekul fung-sional tertentu.PolimerPEGditemukansangatattraktifseba-gaimolekulfungsionalpada SWNTdimanadapat membuatSWNTbersirkulasidalamcairandarah dalamwaktuyangcukuplamasehinggadimung-kinkanuntukmencapaitarget-targetyangtersulit didalamtubuh(gambar7b).LiangdanChen melaporkanbahwadenganmenggunakanmolekul fungsionalPEG,SWNTmenjadisangatdinamis danolehkarenaitudimungkinkanuntukdapat mudah melintasi membran sel dan masuk ke dalam sitoplasma. Lebih menguntungkan lagi, ditemukan bahwaSWCNTyangdikonjugasidenganPEG dapatdanhanyamemasukisel-selyangterserang kanker. (a ) (b)

Gambar 7. Konjugasi SWCNT dengan molekul fungsional: (a) DNA dan (b) Polyethylene glycol (PEG) (Liang dan Chen, 2010). KeberhasilanmenkonjugasiPEGpada SWCNTsehinggamenghasilkanfaktabahwa SWCNTdapatdanhanyamemasukiselyang terserangkanker,makapenggunaanSWCNT terkonjugasiPEGselanjutnyadirancangdijadikan sebagai mesin pembawa (carrier) obat-obatan anti kankerkeselyangterserangkanker.Paclitaxel (PTX)(umumdisebutsebagaitaxol)adalahobat antikankeryanglazimdipakaidalamkemoterapi. LiangdanChenselanjutnyamengujikarakteristik konjugasiPTXdenganPEG-SWCNTyang menghasilkankonjugasiPTX-PEG-SWCNT. DitemukanbahwakonjugasiPTX-PEG-SWCNT (skemakonjugasinyaditunjukkanpadagambar8) dapatlarutdenganbaikdidalamair,danPTX yangdikonjugasikantetapmemilikitingkat toxicity yang sama dengan PTX tanpa dikonjugasi. Disampingitu,PTX-PEG-SWCNTmemiliki waktusirkulasiyanglebihlamadidalamcairan darahdibandingdenganPTXyangtidak dikonjugasi.KonjugasiPTX-PEG-SWCNTselanjutnya digunakanuntukmembawaPTXkeselkanker untukmenonaktifkanselkankeryangdisasar.Uji cobadilakukanpadatikusyangtelahdijangkiti olehselkanker(selkankerpayudara4T1 dicangkokkanpadatikus).Fenomenayang diperolehmenunjukkanbahwa:(1)PTX-PEG-9SWCNTtidakditemukanpadasel-selsehattikus, (2) solubilitasnya sangat baik pada berbagai media biologi tikus, (3) PTX-PEG-SWCNT stabil selama 48jam,(4)prosespelepasanPTXdariPEG-SWCNTberlangsungdalamwaktuyangcepat padaselkanker,danPEG-SWCNTrelatiftetap stabilsetelahpelepasan,dan(5)tidakditemukan adanyaagregasiSWCNTdidalamselsetelah PEG-SWCNT melepas PTX. Gambar 8. Skema konjugasi SWCNT dengan molekul fungsional PEG dan paclitexal (PTX) (Liang dan Chen, 2010). Gambar 9. Kurva pertumbuhan tumor (sel kanker payudara 4T1 yang dicangkok) pada tikus yang mendapatkan berbagai perlakuan. Untreated adalah tanpa memerikan perlakuan (kontrol), Taxol adalah penyuntikan hanya dengan taxol (PTX), PEG-PTX adalah penyuntikan dengan PEG-PTX, DSPE-PEG-PTX adalah penyuntikan dengan DSPE-PEG-PTX, Plain SWNT adalah penyuntikan hanya dengan SWCNT, dan PTX-PEG-SWCNT adalah penyuntikan dengan PTX-PEG-SWCNT (Liang dan Chen, 2010). 10HasilkerjaPTXpadaselkanker(tumor) dilihatdariperubahanvolumetumorharidemi hari. Gambar9menunjukkan hasil yangdiperoleh sepanjang25harisetelahdisuntikdaribeberapa jenisperlakuan.Suatuperubahanselama pengukuranteramatipadavolumerelatiftumor dimanapenggunaanPTX-PEG-SWCNTdapat meredampertumbuhantumorsecarasignifikan padadosisyangsamayaitu5mg/kg. Dibandingkandenganjeniskonjugasiyanglain, penggunaan PTX-PEG-SWCNT memberikan hasil yangjauhlebihbaik.Pertumbuhantumordapat diredamsecaraefektifyangdisimpulkansebagai hasil kerja PTX untuk menonaktifkan (membunuh) sel-selyangterserangkanker.Olehkarenaitu, mengacukepadafaktaini,makadimungkinkan untukmembasmiselkankersecaraefektifdengan meningkatkandosisPTXkedalamselkanker. Sementarasel-selnormaltidakmengalamigang-guan. 8.NANOMATERIALDANSELKANKER: HYPERTHERMIA Carbon Nano Tube SWCNTtidaksajaberfungsisebagai pembawasebagaimanaditerangkandiatas.Sifat SWCNTyangdapatmenyerapgelombang elektromagnetikpadarentangpanjanggelombang dari700-1100nmsangatefektifdigunakanuntuk membunuhsel-selkanker.Dilainpihak,sistim biologitubuhadalahtransparanpadarentang panjanggelombangtersebut.Energiyangdiserap padarentangpanjanggelombang700-1100nm olehSWCNTdapatmeningkatkansecaraefektif temperaturSWCNTsampaidiatas42oC,yang padatemperaturinisel-selkankersudahmenjadi tidakaktif.KemampuanSWCNTsecaraselektif hanyamasukkedalamselkankermemungkinkan keunikanpenyerapanpanjanggelombangini digunakanuntukmenonaktifkansel-selkanker tanpa merusak sel-sel sehat tetangganya. Kam,etal.jugatelahmengujicoba penggunaan konjugasi PEG-SWCNT yang disinari dengangelombangnear-infrared(NIR)(808nm) untukmemanaskanSWCNTdidalamselkanker dalamprosesmenonaktifkan(membunuh)sel kanker(hyperthermia).KonjugasiPEG-SWCNT dikirim ke dalam sel HeLa yang terjangkit kanker. SelanjutnyauntukmemastikankehadiranPEG-SWCNTdidalamsel,mikroskopconfocal digunakanuntukmemotretseldanhasilnya ditunjukkan pada gambar 10. Mengacu pada potret yangdihasilkan,teramatibahwaPEG-SWCNT telahhadirpadaselyangterjangkitkanker, sementarapadaselsehatyanglain,PEG-SWCNT tidakditemukan.Untukmemanaskanselkanker tersebut, Kam, et al. menyinari sel yang di dalam-nyaterdapatPEG-SWCNTdengansinarnear-infrared (NIR). Energi yang dihantarkan oleh NIR dalambentukgelombangtersebutdiserapoleh SWCNTdanmengubahnyamenjadienergipanas sehinggatemperaturselnaikmelebih42oC. Temperatursel-selsehattetangganyatidaknaik karenapadasel-seltersebuttidakditemukan SWCNT.Mediumbiologiseladalahtransparan terhadapgelombang NIR. Pemanasan dengan cara inipadatingkatdiatasbatastoleransisel menyebabkansel-selkankermenjaditidakaktif (mati),dimanaprosesnyadapatsecaraselektif dilakukan.

Gambar 10. Potret fluoresens sel HeLayang terjangkit kanker (FR+) yang dihuni oleh PEG-SWCNT (a) dan potret sel normal yang tidak dihuni oleh PEG-SWCNT (b) (Kam, et al., 2005). 11 9.NANOMATERIAL DAN DIABETES Diabetesmellitus(atauseringdisebutdi-abetes)adalahsuatupenyakitdimanakandungan gula(glucosa)padacairandarah(guladarah)me-ningkatmelebihibatasambangatas(hyperglyce-mia).Peningkataninidisebabkanolehadanya gangguanyangterjadidalamprosespenghantaran glucosa ke dalam sel (Poretsky, 2010). Penghanta-ranglukosakedalamseldimediasiolehinsulin denganskemaprosessebagaimanaditunjukkan pada gambar 11.Diabetesdibagikedalamduatipeyangdika-rakterisasiolehmediatorinsulin,yaitu:tipe-1,di-abetesyangterjadikarenagagalnyasel-mem-produksi insulin pada jumlah minimum yang dibu-tuhkanuntukmemediasipenghantaranguladarah kedalamsel(skemasederhanapelepasaninsulin oleh sel- ditunjukkan pada gambar 12) (Poretsky, 2010);tipe-2adalahdiabetesyangterjadikarena kurangnyaresponsivitasreseptorinsulinpada membranseluntukmeresponkehadiraninsulin sebagaimediatorpenghantarguladarahkedalam selsehinggaprosespenghantaranguladarahke dalamselmenjaditidakberjalansebagaimana mestinya (Poretsky, 2010). Gambar 11. Skema proses penghantaran glucosa (gula darah) ke dalam sel yang dimediasi oleh insulin. Pengikatan insulin oleh reseptor insulin pada membran sel menginduksi suatu sinyal transduksi yang dapat dideteksi oleh trans-poter glucosa (GLUT4) sehingga GLUT4 memasukkan glucosa ke dalam sel (Poretsky, 2010). Gagalnyasecarawajarguladarahmasukke dalamselmenyebabkankandunganguladarahdi dalamcairandarahmenjadimeningkat.Beberapa anjuranuntukdilakukanbagipenderitadiabetes tipe-1untukmengontrolkandunganguladarahdi dalamcariandarahnyaadalah:melakukandiet, khususnyaterhadapmakananyangmengandung banyakglucosa;melakukanlatihanfisiksecara teratur, dan terapi insulin sebagai solusi kurangnya suplai insulin oleh sel-.Diabetes tipe-2 sangat dipengaruhi oleh faktor obesitas.Obesitasdapatmenyebabkanmeningkat-nyaresistansireseptorinsulinpadamembransel. Oleh karena itu diabetes tipe-2 erat kaitannya den-ganfaktorketurunandanbudayayangberkem-bangdilingkungannya.Seseorangdapatmenga-lami salah satu tipe diabetes di atas dan dapat pula mengalamisekaliguskeduanya.Beberapacara penyelesaiantelahdilakukanuntukdapatmenga-tasiataumenyembuhkanpenderita,namunhasil yangdiperolehbelummencapaititikyangpaling optimum.Olehkarenaitubeberapaalternatifpen-gembangansedangdiinvestigasiyangsalahsa-tunyaadalahmelibatkannanoteknologi(Zhirno dan Cavin, 2011; Mishra et al., 2008). Mengatasi kekurangan insulin (diabetes tipe-1) padapenderitadiabetesselamainidilakukanden-ganmensuplaiinsulinsecaraeksternalyangdila-kukan secara oral, suntik maupun melalui pernafa-san(nasal)(Poretsky,2010;Sona,2010).Dengan tekniksuntik,yangapabiladilakukanterusmene-russetiaphari,menimbulkanmasalahbaruterha-12daplukasuntik.Padateknikoralinsulinmenga-lamidegradasididalamlambung(stomach)oleh enzimgastric.Untukmengatasimasalahiniinsu-lindibalut(encapsulated)denganberbagaijenis polimeryangbiodegradable.Namunolehkarena ukurannyacukupbesar,balutaninsulinsulitme-nembusmasukkepembuluhdarah.Padateknik penghantaranmelaluipernafasan,permasalahan timbuldenganterjadinyapenyumbatanpadaparu-parukarenaukuranpartikelinsulincukupbesar (Murphy et al. 2008; Mishra et al., 2008). Seluruh permasalahaninimenjaditantangansaatinidan suatu teknik pendekatan baru harus dicari. Gambar 12. Skema proses pelepasan insulin oleh sel-. Ketika kadar glucosa pada cairan darah meningkat di atas batas ambang, transporter glucosa GLUT2 akan memasukkan glucosa ke dalam sel.Glucosa yang masuk ke dalam sel meningkatkan rasio ATP:ADP di dalam sel (melalui proses glycolytic phosphorylation: glucokinase-glycolysis,respiration) sehingga menonaktifkan kanal potassium (K+) yang bertugas mendepolarisasi membran sel. Penonaktifan kanal potassium menyebabkan pembukaan kanal calcium sehingga ion-ion calcium masuk ke dalam sel. Peningkatan kandungan ion calcium di dalam sel memicu pelepasan insulin oleh sel (Poretsky, 2010). Permasalahanukuraninsulinpadateknikoral danpernafasansebagaimanadiuraikanadiatas dapatdiatasidengannanoteknologi.Partikelinsu-lindikonstruksidenganteknikkhusussehingga memilikiukuranyangberadapadakisaran1-100 nm.Morcoletal.telahberhasilmengkonstruksi nanopartikelinsulin-polimer,dimanananoinsulin dikapsulasidenganmenggunakanpolimermem-bentukapayangkitasebutsebagainanokapsul insulinataunanopartikelinsulin(Morcoletal., 2004).Polimerdalamhaliniberperansebagai pembawa(carrier).Calciumphospate-polyethyleneglyco(CAP-PEG) digunakan sebagai polimerpengkapsuldikombinasidengancasein (proteinsusu)untukmembentuknanopartikel CAP-PEG-Insulin (lihat gambar 13). Partikel insu-linberukurannanometerdibalut(coat)dengan caseinuntukmenghidaridegradasiinsulinoleh enzim gastric. Setelah diuji coba secara oral, suatu penurunankadarguladarahterjadisecarasignifi-kan, namun oleh karena sifat casein yang mucoad-hesivemakananopartikelCAP-PEG-Insulinter-konsentrasipadausushalusyangmengakibatkan perlambatan proses absorpsi. Padastudilain,Venugopalanetal.menggu-nakanpolyethuleneglycol-dimethacrylatesebagai polimerpembalut/pembawainsulin.Polimerini digunakanuntukmemproteksiinsulindaritempe-ratur tinggi. Setelah diuji coba pada tikus, penuru-nanguladarahterjadisecarasignifikan(Venugo-13palanetal.2001).Chitosan,dextransulfat,dan cyclodextrintelahjugadigunakansebagaipemba-lut/pembawa(Panetal.,2002).Kombinasipeng-gunaandextransulfate-chitosansebagaipolimer pembalut/pembawamenghasilkankarakteristik yangsensitifterhadappH.Berbagaijenispolimer lain telah diuji coba untuk digunakan dan berbagai sifatyangunikdiperoleh.Seluruhnanokapsulin-sulindenganmenggunakanberbagairagam merpembalutsebagaimanadisebutdiatasmeng-hasilkanpenurunanguladarahyangsangatsigni-fikan.Namundiantaraseluruhnya,penggunaan chitosan menghasilkan efek yang paling tinggi. Gambar 13. Skema nanopartikel calcium phospate-PEG-insulin-casein (Morcol et al., 2004). Gambar 14. Skema nanopartikel dengan gerbang molekuler yang sensitif terhadap pH untuk mengontrol pelepasan insulin yang dipicu oleh kehadiran glucosa pada cairan darah (Sona, 2010). Penghantarannanoinsulinmelaluipernafasan telahjugadiinvestigasi.Grenhaetal.telahmeng-konstruksinanoinsulindenganmenggunakanpo-limerchitosanuntukmembentuknanopartikelin-sulin-chitosandalambentukserbukkeringyang siapuntukdihirup.Efekpenurunanguladarah yangdihasilkanjugasangatsignifikansetelahdi-ujikanpadatikus.Denganmenggunakanpolimer 14nanochitosan sebagai pembawa, jumlah nanoinsu-linyangdapatdibawasangatbesardankemam-puanmelepaskaninsulinpadacairandarahsangat tinggi, yaitu sekitar 75-80% dilepas selama 15 me-nit setelah penghirupan. Teknologiyangsaatinisedangdalampen-gembangansebagaimanadilaporkanolehSona (Sona,2010)adalahpembuatannanoporusmem-branyangsensitifterhadappH(lihatgambar14). Nanoinsulindibalutdengansuatupolimerdimana polimerpembalutnyamemilikiporusberukuran nanometeryangsensitifterhadappHlingkungan-nya. Bila pH cairan darah menurun (< 7) yang dis-ebabkan oleh meningkatnya kadar gula darah, ma-kagerbangnanoporusakanmembukadaninsulin dilepas. Pelepasan insulin akanmenurunkankadar guladarahyangmenyebabkanpHdarahmening-katmenujunormal(~7,4).PadasaatpHnormal, gerbangnanoporusakanmenutup.Polimeryang digunakan untuk membuat pembalut yang memili-kinanoporusiniadalahN,N-dimethylaminoethyl methacrylate dan polyacrylamide yang dikombina-sidenganpolymethacrylicacid-g-polyethylene glycol. 10.KESIMPULAN Artikeliniadalahsuatureviewtermutakhir tentangbagaimanananomaterialberperansangat strategisdalammengatasipermasalahanpenyakit kankerdandiabetes,baikdalamhaldiagnosa maupun dalam hal proses penyembuhannya. Sinte-sadanpenggunaanCNTsangatesensialdalam mendiagnosadanmenonaktifansel-selkanker. Sintesadanpenerapannanochitosansebagaipem-bawainsulindilainpihaksangatmenjanjikanun-tukmengatasimeningkatnyakadargluchosapada cairandarah.Saatinidanbeberapatahunkede-pan penelitian pada kedua bidang ini sangat inten-sifdilakukandiberbagainegarakarenabegitu mendesaknyakebutuhanmasyarakatduniaakan solusiterhadapkeduajenispenyakittersebut.Ki-ranya pada waktunya nanti apa yang kita harapkan dapat terpenuhi. DAFTAR PUSTAKA Kam,N.W.S.,OConnell,M.,Wisdom,J.A.,dan Dai, H., 2005. Carbon nanotubes as multi-functionalbiologicaltrasportersandnear-infraredagentsforselectivecancercell destruction.ProceedingsoftheNational AcademyofSciences,Vol.102No.33, hal. 11600-11605. Liang,F.danChen,B.,2010.Areviewonbio-medical applications of single-wall carbon nanotubes.CurrentMedicinalChemi-stry, Vol. 17 No. 1, hal. 10-24. Liu, Z., Chen, K., Davis, C., Sherlock, S., Cao, Q., Chen,X.,danDai,H.,2008.Drugdeli-verywithcarbonnanotubesforinvivo cancertreatment.CancerRes,Vol.68 No. 16, hal. 6652-6660. Mishra, M., Kumar, H., Singh, R.K., dan Tripathi, K.,2008. Diabetesandnanomaterials.Di-gest Journal of Nanomaterials and Bios-tructures, Vol. 3 No. 3, hal. 109-113. Murphy, E.A., Majeti, B.K., Barnes, L.A., Makale, M., Weis, S.M., Fuga, K.L., Wrasidlo, W., danCheresh,D.A.,2008.Nanoparticle-mediateddrugdeliverytotumorvascula-ture suppresses metastatis. Proceedings of theNationalAcademyofSciences,Vol. 105 No. 27, hal. 9343-9348. Perrault,S.D.danChan,W.C.W.,2010.Invivo assemblyofnanoparticlecomponentsto improvetargetedcancerimaging.Pro-ceedingsoftheNationalAcademyof Sciences,Vol.107No.25,hal.11194-11199. Sona,P.S.,2010.Nanoparticulatedrugdelivery systemsforthetreatmentofdiabetes.Di-gest Journal of Nanomaterials and Bios-tructures, Vol. 5 No. 2, hal. 411-418. Wong,C.,Stylianopoulos,T.,Cui,J.,Martin,J., Chauhan,V.P.,Jiang,W.,Popovic,Z., Jain, R.K., Bawendi, M.G., dan Fukumura, D., 2011. Multistagenanoparticle delivery systemforrdeeppenetrationintotumor tissue.ProceedingsoftheNational AcademyofSciences,Vol.108No.6, hal. 2426-2431. Kumar,C.S.S.R.,Hormes,J.,danLeuschner,C., 2005. Nanofabrication towards biomedical applications.Wilet-VCHVerlagGmbH & Co. KGaA, Weinheim, Germany. Zhirnov,V.V.danCavin,R.K.,2011.Microsys-tems for Bioelectronics: The Nanomorphic Cell. Elsevier Inc., Oxford, UK. Poretsky,L.,2010.PrinciplesofDiabetesMelli-tus.2ndEdition.Springer Science+BusinessMedia,LLC,New York, USA. 15 Morcol,T.,Nagappan,P.,Nerenbaum,L.,Mit-chell,A.,danBell,S.J.D.,2004.Calcium phosphate-PEG-insulin-casein(CAPIC) particles as oral delivery systems for insu-lin.InternationalJournalofPharma-ceutics, Vol. 277, Issues 1-2, hal. 91-97. Venugopalan,P.,Sapre,A.,Venkatesan,N.,dan Vyas,S.P.,2001.Pelletedbioadhesive polymericnanoparticlesforbuccaldeli-veryofinsulin:preparationandcharacte-rization.Pharmazie,Vol.56No.3,hal. 217-219. Schaefer, H.E., 2010. Nanoscience The Science of the Small in Physics, Engineering, Chemi-stry,BiologyandMedicine.Springer-Verlag,Berlin, Germany.