Edisi 20 Nov Nas

Download Edisi 20 Nov Nas

Post on 28-Nov-2014




13 download




1. WASPADA Jumat 20 November 2009 Nusantara 3 Ketua Komisi II DPR Terima Delegasi Pemekaran Simalungun JAKARTA (Waspada): Ketua Komisi II DPR memenuhi persyaratan. Bahkan DPRD Burhanuddin Napitupulu menegaskan, Komisi Simalungun melalui pansus, ketika itu diketuainya II akan konsiten membahas pemekaran daerah sudah melakukan pembahasan, bahkan telah sepanjang dibenarkan Undang-undang. ada kesepakatan mengalokasikan dana. Demikian juga pemekaran Simalungun, termasuk Sebagai wakil rakyat dari daerah pemlihan salah satu usulan pemekaran yang belum Sumut III meliputi Simalungun, Ali Wongso terselesaikan DPR periode 2004-2009. mengaku punya komitmen tinggi memper- Nanti kita lihat perkembangannya, pada juangkan terbentuknya Kabupaten Simalungun prinsipnya Komisi II akan melanjutkkan Hataran. Dia yakin perjuangan ini bisa terwujud, pemekaran sepanjang dibenarkan UU, ujarnya apalagi saat ini pimpinan komisi II berasal dari di dampingi anggota DPR RI dari Fraksi Partai daerah pemilihan Sumut, yang sudah tentu Golkar, Ali Wongso Sinaga saat menerima tokoh mengetahui Simalungun. masyarakat Simalungun di DPR Jakarta, Kamis Dari segala aspek, kabupaten yang dipimpin (19/11). Zulkarnain Damanik itu menurut Ali Wongso, Tokoh masyarakat Simalungun yang da- memang harus dimekarkan. Saat ini katanya, tang ke Jakarta menemui Ketua Komisi II, di Simalungun merupakan daerah tingkat II di antaranya, mantan anggota DPRDSU Maknur Sumut yang paling luas dan berpenduduk padat. Sinaga, mantan ketua pansus pemekaran Janter Simalungun terdiri 31 kecamatan dengan luas Sirait, Marim Purba, Iskandar Sinaga, Sarmedi 400 km persegi, penduduk hampir satu juta. Purba dan H. Tugiman Suprapto. Mereka Soal rencana penghentian sementara pemba- mendesak Komisi II memperjuangkan hasan RUU pemekaran (moratorium), menu- pemekaran Simalungun yang sudah lama rutnya sangat tidak relevan dengan kondisi terbenam di DPR. Simalungun. Menurut Maknur Sinagar, usulan pemekaran Burhanuddin menjelaskan, hingga saat ini Simalungun dimulai sejak 2002, tetapi belum masih ada 20 RUU pemekaran yang merupakan terealisasi. Sementara banyak daerah pemekaran hak inisiatif warisan DPR 2004-2009. Dari 20 yang baru diusulkan langsung dimekarkan. RUU itu, 13 diantaranya sudah memenuhi Usulan pemekaran Simalungun sudah lebih persyaratan administrasi, sehingga tinggal dahulu dibandingkan beberapa daerah di Sumut melakukan harmonisasi RUU-nya. Di luar itu yang sudah dimekarkan, seperti Tapanuli Selatan masih ada 17 RUU yang sudah masuk tahapan dan Labuhan Batu, kata Maknur. pemenuhan persyaratan. Nah RUU pemekaran Janter Sirait menambahkan, masalah Simalungun merupakan bagian dari yang 17 pemekaran Simalungun sebenarnya sudah itu, kata Burhanuddin.(aya) Antara APOTEK MELEDAK: Sejumlah tim Gegana Polda DIY memeriksa keadaan apotek yang meledak di Yogyakarta, Kamis (19/11). Belum diketahui penyebab ledakan, namun sudah ada empat orang luka parah. Kasus Century BPK Takut Masuk Waspada/Andy Yanto Aritonang Wilayah Aliran Dana BERKAS PEMEKARAN: Ketua Komisi II DPR, Burhanuddin Napitupulu di dampingi anggota JAKARTA (Antara): Man- dana itu juga mengakibatkan pihak independen bisa mela- Dradjat memaparkan, diri- Sementara, pembicara DPR dari dapem Sumut III Ali Wongso Sinaga menerima berkas pemekaran Simalungun dari tan anggota Komisi XI bidang seakan-akan terjadi pingpong kukan tugas auditnya dengan nya memiliki sejumlah doku- lainnya mantan anggota Maknur Sinaga dan Janter Sirait. Keuangan DPR Dradjat Wibo- antara BPK dan Pusat Pelaporan lancar. Mengapa dua lem- men yang bisa mematahkan Dewan Perwakilan Daerah wo mengatakan Badan Pe- Analisis Transaksi Keuangan baga negara (BPK dan PPATK) argumen yang mengatakan (DPD) Marwan Batubara JK Harap Persoalan Bangsa meriksa Keuangan (BPK) ta- kut memeriksa secara men- (PPATK) dalam audit Bank Cen- tury. bisa `kalah` dengan PWH? katanya. bahwa bila Bank Century tidak diselamatkan maka akan terjadi mengemukakan, rekomendasi diberikan Tim Delapan atau dalam ke wilayah aliran dana Dia berpendapat, hal itu Untuk itu dia meminta agar krisis sistemik pada perbankan Tim Independen Verifikasi Bisa Diselesaikan Presiden terkait kasus Bank Century. Sudah ada orang BPK me- tidak masuk akal karena BPK berdasarkan UUD 1945 meru- berbagai pihak terkait dapat se- gera mendorong PPATK untuk nasional. Menurutnya, peme-rintah Fakta dan Proses Hukum Chandra-Bibit harus segera MAKASSAR (Antara): MantanWakil Presiden kasus ini pasti bisa terselesaikan. Bukan cuma ngatakan kepada saya, tidak pakan lembaga negara yang memberikan seluruh data yang sebenarnya lebih untung bila dilaksanakan. HM Jusuf Kalla (JK) berharap Presiden Susilo saya, tapi kita semua pastinya ingin bangsa ini berani masuk ke wilayah ali- setara kedudukannya antara lain dibutuhkan terkait dengan audit menutup Bank Century dan Bila tidak diperhatikan, Bambang Yudhoyono bisa segera menyelsaikan aman, ujarnya. ran dana, kata Dradjat dalam dengan Presiden dan DPR. Bank Century yang tengah mengambil alih untuk mem- maka hal itu sama saja dengan segala persoalan yang dihadapi bangsa ini. JK disambut Gubernur Sulawesi Selatan, diskusiSkandal Korupsi Bank Dradjat juga mengutarakan dikerjakan BPK. Jangan sampai bantu para nasabah yang uang- merendahkan kapabilitas Tim Kita berharap saja segala persoalan yang H SyahrulYasin Limpo,Walikota Makassar Ilham Century: Apa Solusinya? di rasa herannya karena saat audit lembaga negara yang telah nya telah dirugikan terkait Bank Delapan. Marwan juga meng- dihadapi bangsa ini bisa segera terselesaikan, Arief Sirajuddin, Wakil Wali Kota Makassar Jakarta, Kamis (19/11). kasus Bank Bali beberapa tahun dibiayai oleh uang rakyat bisa Century. Selain itu, pemerintah inginkan agar tidak ada pihak dan saya yakin presiden bisa menyelesaikan Supomo Guntur dan sejumlah akademisi yang lalu, lembaga audit swasta Price dinilai kalah oleh sejumlah bisa mengejar aset Bank Century yang me-mainkan emosi publik persoalan tersebut, kata Jusuf Kalla setelah tergabung dalam Korps Alumni Himpunan Menurut dia, keengganan Water House (PWH) yang kalangan dengan konsultan yang dilaporkan terdapat di luar terkait dengan rekomendasi tiba di kediaman pribadinya Jl. Haji Bau, Mahasiswa Islam (Kahmi). untuk masuk ke wilayah aliran ditunjuk pemerintah sebagai asing, katanya. negeri. Tim Delapan. Makassar, Kamis (19/11). Sesaat setelah mendarat di Bandara Inter- Dia mengatakan, sejumlah persoalan yang nasional Sultan Hasanuddin Makassar, JK sempat dihadapi bangsa ini seperti permasalahan Bank Century tidak terlalu diketahuinya secara bertemu dengan Menteri Perhubungan Freddy Numberi di ruang VIP Bandara. SBY Terlalu Lama Tindaklanjuti Tim 8 pasti karena kasus tersebut mulai bergulir saat Selain itu, petugas bandara juga sempat JAKARTA (Antara): Ketua sebenarnya tidak terlalu men- berantasan korupsi di Indonesia, dirinya sedang berada di luar negeri. Dia membentangkan spanduk berukuran besar yang Umum PP Muhammadiyah, desak. sebab sudah 10 tahun reformasi berharap kasus yang berlarut-larut itu bisa bertuliskan selamat datang Jusuf Kalla di Din Syamsudin mengatakan Sementara ada bank-bank belum menghasilkan hal-hal terselesaikan karena Presiden Susilo Bambang kampung halaman tercinta saat turun dari pembentukan Tim Independen lain yang setara dengan Cen- signifikan terhadap pembe- Yudhoyono dia nilai mampu menyelesaikan pesawat pribadinya Athirah. Bahkan setelah Verifikasi Fakta dan Proses tury mengeluhkan kurang-nya rantasan korupsi. permasalahan tersebut keluar dari bandara spanduk ukuran besar dari Hukum Chandra-Bibit atau perhatian pemerintah dalam Bahkan menurutnya, Saya tidak tahu pasti letak permasalahannya ratusan warga Maros dan Makassar juga Tim Delapan hanya langkah menyelesaikan persoalan yang perseteruan yang terjadi antara karena saya berada di Eropa dan saya yakin terbentang dengan tulisan I Love You Full JK. basa basi Presiden Susilo sama pada waktu sebelumnya, Komisi Pemberantasan Korupsi Bambang Yudhoyono karena kata dia. (KPK), Polri serta Kejaksaan tindaklajutnya terlalu lama. Karena itu PP Muhamma- telah menunjukkan gelagat Sebab, meski hasil Tim diyah mendesak pemerintah untuk menghilangkan lembaga Delapan bagus namun tindak mengusut tuntas kasus Bank anti korupsi itu. Padahal upaya lanjutnya lama dan mengapa Century serta petinggi yang pemberantasan korupsi saja harus menunggu satu minggu. terlibat di dalamnya. Saya belum optimal tetapi masih Saya melihat ini ada hubungan- mendukung hak angket DPR, tebang pilih belum berani nya dengan kasus Bank Cen- namun anggota legislatif jangan menggasak koruptor kelas tury, kata Din usai menghadiri bersikap setengah hati. Saya kakap. Kok sekarang tiba-tiba Wisuda Magister, Sarjana dan kecewa dengan partai-partai mau dihilangkan, katanya. Program Diploma Universitas koalisi besar dalam kasus-kasus Persoalan ini ujar Din, bukan Muhammadiyah Prof Dr Ham- yang mengandung dugaan hanya sekadar menyangkut ka di Jakarta, Kamis (19/11). kebatilan. Kalau mau bersatu, Bibit dan Chandra tetapi terkait Dia mengatakan, di satu sisi mari bersatu untuk kejayaan keberadaan lembaga tersebut pemerintah begitu cepat men- negara, tegasnya. (KPK-red). Waktu saya datang cairkan dana senilai Rp6,7 triliun Sebelumnya Din mengata- ke sidang Mahkamah Konstitusi untuk sebuah bank sekelas kan, rekomendasi Tim Delapan 3 November, sebenarnya saya Century yang jumlah nasabah- itu bisa dijadikan momentum sudah skeptis dengan upaya nya pun tidak terlalu banyak dan penegakan hukum dan pem- yang ada, tambahnya. Berita Sore/Laswiyati Wakid TENDA: Rumah yang runtuh diganti sementara dengan tenda darurat di depan halaman rumah warga, seperti terlihat di Pariaman, Kamis (12/11). Laris Manis Hanya Paku, Gergaji Dan Martil MASYARAKAT Padang, Sumatera Barat Harga semen yang sebelumnya Rp55.000 sampai saat ini masih menunggu bantuan per sak, sekarang Rp53.000. Begitu pula bahan perbaikan bangunan rumahnya yang hancur bangunan lainnya. Sedangkan harga gergaji digoyang gempa berkekuatan 7,9 SR, pada 30 Rp30.000 per buah. September lalu. Iming-iming bantuan dari Di Pariaman, warga pun tidak berusaha pemerintah maupun lembaga swadaya luar memperbaiki rumahnya secara utuh. Mereka negeri, belum terealisasi. tidak terlalu memikirkan rumahnya yang rusak, Kalaupun diperbaiki, warga hanya membe- tetapi memfokuskan pada usahanya. Tak heran tulkan tiang yang miring, atau memasang seng meski rumahnya runtuh, usaha tetap berjalan. yang terlepas. Sekarang ini yang laris manis Menurut warga Pariaman, Jomarlis, tenda hanya penjualan paku, gergaji dan martil, kata yang dia dirikan itu selain sebagai pengganti Nico, pedagang panglong di Jl. AhmadYani, Padang rumah yang rusak, juga buat berjaga-jaga kalau Pariaman kepada wartawan, akhir pekan lalu. ada gempa susulan. Daripada dihantui perasaan Menurutnya, seminggu setelah gempa hingga was-was, lebih baik berdiam di tenda, kata saat ini hanya paku, gergaji dan martil yang dibeli dia mengaku mau memperbaiki rumahnya, orang. Bahan bangunan lainnya seperti semen, tetapi belum ada dana. Dia masih menunggu batubata, pasir dan besi, apalagi cat tidak iming-iming kucuran dana dari pemerintah, mengalami kenaikan. Pasarannya normal saja, sambil tetap berusaha. meski harganya relatif, kata dia (Laswiyati Wakid/Lina Daulay) 2. 4 Luar Negeri WASPADA Jumat 20 November 2009 Taliban Umumkan Perang Total Lawan Militer Pakistan MIRANSHAH, Pakistan (AP/Antara/AFP): langsung selama dua jam dan kemudian bubar Taliban membantah klaim keberhasilan ofensif dengan tertib, katanya. Pakistan dan bertekad bahwa mereka akan Korban tewas dalam serangan itu termasuk melakukan perang total untuk mengusir pasukan tiga wanita, dua anak-anak dan seorang pria, asing dari pangkalan mereka di dekat perbatasan kata seorang pejabat kepolisian lokal, yang Afghanistan. berbicara tanpa ingin disebutkan jatidirinya. Kami belum kalah. Kami secara sukarela Sementara itu, kantor berita AP melaporkan mundur ke daerah pegunungan dengan strategi seorang pengebom bunuh diri menewaskan yang akan memerangkap militer Pakistan di 16 orang di luar satu pengadilan di baratlaut Pa- daerah itu, kata jurubicara Taliban Azam Tariq kistan Kamis, serangan terakhir yang dilancarkan kepada sejumlah wartawan yang dibawa dengan kalangan militan dalam membalas ofensif mata tertutup ke sebuah daerah perbukitan. angkatan bersenjata di kawasan dekat perbatasan Kelompok militan utama Tehreek-e-Taliban Afghanistan. Pakistan (TTP) mengatur sebuah jumpa pers Pemboman itu merupakan yang keenam dari kawasan suku sehari setelah militer mem- kalinya dalam waktu kurang dari dua minggu bawa wartawan ke Waziristan Selatan untuk di dan sekitar Peshawar, kota terbesar di kawasan melihat medan pertempuran. baratlaut Pakistan. Militer mengatakan kepada wartawan, Korban sipil serangan AS pasukan yang melakukan ofensif darat dan udara Sedikitnya empat orang tewas dan lima orang besar-besaran selama lima pekan telah merebut lagi terluka dalam serangan rudal oleh pesawat sebagian besar kota yang sebelumnya berada mata-mata AS di daerah suku Pakistan di de- di bawah kendali kelompok garis keras di Wa- kat perbatasan Afghanistan, beberapa pejabat ziristan Selatan, bagian dari kawasan suku Pa- mengatakan, Kamis. kistan yang menjadi sarang militan. Serangan itu terjadi di desa Shanakhora di Seorang wartawan AFP, yang termasuk di Waziristan Utara, daerah yang Washington antara kelompok yang dibawa ke sebuah pun- katakan sebagai tempat gerilyawan bersembunyi cak bukit yang tidak diketahui, mengatakan, Ta- dan merencanakan serangan terhadap tentara riq duduk di sebuah tempat terbuka, tanpa alas Barat yang ditempatkan di Afghanistan, yang atau kursi. berdekatan. Tariq, jurubicara pemimpinTTP Hakimullah Serangan pesawat mata-mata AS yang Mehsud, diapit oleh dua pengawal bersenjata. ditujukan ke sebuah kompleks gerilyawan itu Inimerupakaninteraksilangsungpertamamilitan menewaskan empat orang dan melukai lima berjenggot itu dengan warawan sejak militer orang yang lain, kata seorang pejabat senior meluncurkan ofensif pada 17 Oktober. keamanan di daerah itu. The Associated Press Wartawan dari Waziristan Utara dibawa Dia menambahkan dua rudal telah ditem- MEMBAWA KORBAN Beberapa orang yang cedera akibat bom bunuhdiri diangkut ke satu ambulan di Peshawar, Pakistan, Kamis (19/11). Seorang dengan mobil ke perbatasanWaziristan Selatan bakkan dari sebuah pesawat mata-mata AS. pengebom bunuhdiri meledakkan bomnya yang menewaskan sekurang-kurangnya 16 orang di luar kantor pengadilan pada siang hari dengan mata ditutup dan ke- Seorang lagi pejabat keamanan memastikan CEDERA AKIBAT di baratlaut Pakistan, yang merupakan serangan terakhir oleh para militan Islam yang membalas ofensif militer besar- mudian dipindahkan ke kendaraan-kendaraan serangan itu. LEDAKAN BOM besaran dekat perbatasan Afghanistan. yang sudah menunggu, katanya. Kompleks itu digunakan oleh gerilyawan Tanpa sengaja Taliban, tapi tidak jelas apakah ada gerilyawan Satu tembakan tembakan senjata berat asing atau sasaran bernilai tinggi, kata pejsbat tentara Pakistan yang maksudnya ditujukan ke tersebut. Obama: AS Dan Sekutu persembunyian kaum militan, tanpa disenga- Beberapa warga di Miranshah, ibukota dis- ja menewaskan enam warga sipil di baratlaut trik sukuWaziristan Utara, menyatakan mereka Pakistan, demikian kata polisi Kamis. mendengar dua ledakan keras persis sebelum Para demonstran meneriakkan hentikan tengah malam. pembunuhan rakyat tak berdosa dan hentikan Serangan itu terjadi ketika serangan mili- kekejaman, kata Hashim Khan, seorang warga ter terus berlangsung di tetangganya, Waziris- Siapkan Sanksi Untuk Iran lokal yang ikut dalam unjuk rasa memprotes tan Selatan, kubu-kuat Tehreek-e-Taliban Pakis- pembunuhan warga sipil itu. Aksi protes itu ber- tan (TTP) yang ditakuti.(m07) Presiden Afghanistan Dilantik SEOUL, Korea Selatan (AP/Antara/Reuters): kannya akhir tahun ini untuk memajukan perundingan. oleh Iran kepada badan tersebut, yang kemudian memicu nyaakanmengirimsebagianbesar cadangan uranium hasil penga- pengalamanyangsalah,katanya, melalui seorang penerjemah. Untuk Masa Jabatan Kedua Mereka tidak mampu untuk kemarahan negara-negara Barat. yaan rendah ke luar negeri, Memang, semua ini tergantung KABUL, Afghanistan (AP/Antara/ petugas ISAF Tidak akan ada lalu lintas udara . Tampak tidak sabar dengan memberika kataya dan sebagai Pabrik Fordo, nama desa berdasarkan kesepakatan yang pada mereka. AFP):Presiden Afghanistan Hamid Karzai diambil baik berangkat atau tiba, kecuali penerbangan konsekuensinya kami telah mulai terdekat yang dijadikan nama diprakarsai oleh IAEA. Kantor berita Iran ISNA sumpahnya untuk memangku masa jabatan jemaah haji malam hari yang akan membawa Iran, Presiden AS Barack mendiskusikan dengan mitra instalasi itu, dulu sejumlah besar Cerita lama mengutipMottaki,Rabu,menolak kedua lima tahun dalam satu upacara khusus para jamaah ke Mekkah, kata pejabat itu, yang Obama mengatakan Kamis internasional kami tentang warga Iran dibunuh pada saat Menteri Luar Negeri Iran, rancangan perjanjian yang di Kabul. bicara dengan syarat tak disebut namanya. pentingnya untuk memberikan perang dengan Irak pada tahun Manouchehr Mottaki, Kamis diprakarsai oleh pengamat nuklir Karzai dilantik Kamis (19/11) oleh kepala Tentara internasional akan siap siaga untuk (19/11) bahwa Amerika konsekuensi itu, kata Obama 1980-an. Pabrik itu dijaga oleh mengabaikan kemungkinan Perserikatan Bangsa Bangsa Mahkamah Agung Abdul Salam Azimi, di depan membantu pasukan keamanan Afghanistan jika Serikat dan sekutunya sedang dalam satu temu pers bersama senjata-senjata anti pesawat sanksi atas penolakan Teheran (PBB), Badan Tenaga Atom ratusan tamu dan para undangan asing lainnya terjadi serangan, ujarnya. dengan Presiden Korea Selatan terbang dan dibangun di dalam terhadapkesepakatanpengiriman Internasional (IAEA). yang datang dari lebih 40 negara. Perserikatan Bangsa Bangsa (PBB) juga membahas kemungkinan Lee Myung-bak. gunung. uranium diperkaya ke luar negeri IAEA mengatakan bahwa Karzai memulai upacara pelantikan Kamis diperkirakan akan memerintahkan staf sanksi baru guna Para pejabat Iran mengata- untuk diproses lebih lanjut. Iran harus mengirim sekitar 75 itu di halaman terbuka yang digelar dengan internasionalnya agar tetap berada di dalam Tinjau pabrik kedua kan, pembangunan instalasi itu Sanksi adalah literatur tahun persen uraniumnya yang permadani merah, memeriksa pasukan khusus gedung, sementara itu jalan-jalan besar di sekitar memberikan tekanan pada Sementara itu, para penga- merupakan pesan bagi negara- 1960-an dan 1979-an, kata Ma- diperkaya pada tingkat renah ke pengawal presiden sementara rombongan musik Kabul akan ditutup bagi lalu-lintas. Iran agar mematuhi usaha was Perserikatan Bangsa Bangsa negara Barat, bahwa Teheran nouchehr Mottaki pada konfe- Rusia dan Prancis, di mana menyanyikan lagu nasional Afghanistan. Karzai dilantik sebagai presiden untuk lima (PBB)diperkirakanakanmeninjau tidak pernah akan menyerahkan rensi pers saat berkunjung ke uraniumtersebutdijadikanbahan Karzai berada di bawah tekanan keras untuk tahun lagi pada satu upacara yang disebut-sebut internasional untuk pabrikpengayaanuraniumkedua membersihkan korupsi di dalam pemerintahan- sangat megah, dengan penjagaan keamanan hasilpengayaanuraniumnya,dan Filipina. Saya pikir mereka tidak bakar untuk satu reaktor riset menghentikan program Iran yang kontroversi Kamis, bahwa pabrik itu adalah fasilitas cukup bijaksana mengulangi medis di Teheran.(m07) nya. Dia dalam pidatonya pelantikan keduanya yang ketat di istana presiden, di pusat ibukota. sehari setelah Teheran menolak penopang dalam kasus pabrik itu mengatakan bahwa dia akan membuat suatu nuklirnya. perimbangan untuk menjawab tuntutan Menteri terima suap kesepakatan bahan bakar nuklir pengayaan besar di Natanz yang yang didukung Washington. dibom. Kiswah Baru Diserahkan internasional agar dia melakukan Karzai berjanji akan meningkatkan perang Dalam perkembangan lainnya, Menteri PertambanganAfghanistanMohammadIbrahim Peringatan Obama itu mun- Kunjungan oleh tim Badan Washington dan musuh cul setelah Iran menolak satu usul TenagaAtomInternasional(IAEA) bebuyutan Iran, Israel, mengaku Pada Pengawal Kaabah terhadap produksi dan pedagang obat terlarang, saat menyampaikan pidato pelantikannya untuk Adel dituduh menerima suap 30 juta dolar untuk memberikan proyek pembangunan besar kompromi bagi pengiriman ura- ke pabrik itu, yang dibangun di tak pernah memerintahkan nium yang rendah pengayaan ke dekat kota suci Syiah Qom, militernya menyerang fasilitas MAKKAH, Arab Saudi (Waspada): Kiswa (kain penutup Kaabah) masa jabatan kedua Kamis. Narkotika adalah kepada satu perusahaan negara milik China, luar negeri supaya Teheran tidak diumumkan Rabu oleh duta Iran nuklirIranitu,yangmerekacurigai yang baru telah diserahkan kepada pengawal Kaabah tertua dalam ancaman serius bagi Afghanistan, katanya di kata suratkabar The Washington Post dalam dapat memperkaya lebih jauh satu upacara khusus Rabu (18/11) malam. hadapan 800 undangan, termasuk Menteri Luar laporannya Rabu, mengutip seorang pejabat untuk IAEA, Ali Asghar Soltanieh. digunakan untuk pembuatan untuk membuat senjata. Ketua Kepresidenan Urusan Dua Masjid Suci Syeikh Saleh ibn Negeri AS Hillary Clinton. Amerika. Inspeksi ini adalah yang kedua senjata. Namun, berkali-kali re- Abdul Rahman Al-Hussain menyerahkan kain itu kepada Syeikh PemerintahAfghanistanmemutuskanuntuk Perundingan tentang sanksi kalinya dilakukan oleh IAEA publikIslamtersebutmembantah Pengungkapan itu terjadi pada pekan yang Abdul Aziz ibn Abdullah Al-Shaibi di pabrik pembuatan kiswah perang terhadap perdagangan gelap dan samaketikapemerintahAfghanistanmembentuk baru juga menunjukkan bahwa selama kurang dari sebulan. keras tuduhan tersebut. di Makkah, Arab Saudi. Satu tas kecil yang terbuat dari berwarna penghasil obat terlarang. Para pejabat pemerintah Obama menyiapkan tahap beri- Empat pengawas pertama Pemeriksaan PBB diperkira- satuan kejahatan besar untuk memberantas hijau dengan hiasan tulisan emas dan perak yang berisi kunci Kaabah, yang ditemukan terlibat dalam obat-obatan korupsi, dan hanya sehari sebelum Hamid Karzai kutnya begitu Iran gagal me- meninjau pabrik itu pada 25 kan terjadi sehari setelah Iran juga telah diberikan kepada Syeikh Abdul Aziz. terlarang ini akan ditembak dan diseret ke sidang dilantik sebagai presiden Afghanistan yang kedua menuhibataswaktuyangditetap- Oktober setelah diungkapkan menolak rencana, bahwa pihak- Keturunan Al-Shaibi adalah orang yang dipercayakan untuk pengadilan, tegasnya. kalinya. Pada saat tersebut, AS juga mendesak mengurus kain dan membersihkan Kaabah sejak zaman Nabi Pemerintah Afghanistan dan pasukan Karzai agar membersihkan negaranya yang Muhammad SAW memberikan kuncinya pada mereka. Wahai, internasional menjaga ketat ibukota Kabul porak-poranda akibat perang itu dari wabah Raja Saudi Jadi Tuan Rumah para putra Talha, ambilah kunci Kaabah ini dan jagalah selamanya, katanya pada saat itu. Setiap anggota keluarga memiliki wewenang membuka pintu Kaabah. Syeikh Abdul Aziz mengatakan biasanya penyerahan kiswah terhadap kemungkinan serangan Taliban yang diperkirakan dilakukan bersamaan dengan pelantikan Presiden Hamid Karzai Kamis. korupsi dan kronisme. Post mengutip seorang pejabat tak disebut namanya yang akrab dengan laporan-laporan Bandara kota, yang dikuasai oleh Pasukan intelijen militer bahwa, ada kepastian besar Bagi 2.000 Jamaah Palestina dilakukan pada hari pertama bulan Zulhijjah, jadi Rumah Tuhan itu akan disiapkan pada hari kesembilan bulan Zulhijjah, pada hari jamaah Haji berada di Arafah. Ini untuk menjamin Kaabah agar Bantuan Keamanan Internasional (ISAF) NATO akan menutup bandara itu sehari, kata seorang mengenai tuduhan suap sekitar 30 juta dolar kepada Menteri Ibrahim Adel tersebut.(m07) terlihat bersih pada hari berikutnya, yang merupakan Hari Raya MAKKAH, Arab Saudi (Was- pada): Pemelihara Dua Masjid bahkannya bahwa Kedutaanbe- sar Palestina di Amman dan Kairo askan. Dia juga berkunjung ke proyek perluasan Arafah yang Idul Adha. Dia mengatakan sehari sebelumnya (8 Zulhijjah) ketika para Israel Suci Raja Abdullah telah meng- istruksikan pihak berwenang telah diinstruksikan untuk me- minta paspor mereka guna men- telah diratakan tahun ini guna membuat ruang lebih besar lagi jamaah melakukan perjalanan ke Mina, penutup yang lama dibuka. Syeikh Abdul Aziz mengatakan upacara itu biasanya dimulai ketika Gempur Gaza Arab Saudi untuk menjadi tuan dapatkan visa Haji. bagi jamaah. dia dan Al Hussain menandatangani tanda terima penyerahan itu. JERUSALEM (AP): Pesawat rumah bagi 2.000 jamaah Haji Kira-kira 5.000 jamaah Pa- PangeranKhaledmeletakkan Pabrik kiswah itu dibangun di Makkah kira-kira 74 tahun lalu tempur Israel menggempur sa- yang terdiri dari keluarga korban lestina, termasuk tamu Raja, di- batu pertama bagi pembangu- oleh Raja Abdul Aziz dan sejak itu kain tersebut dibuat setiap tahun tu fasilitas penghasil senjata dan seranganIsraelagarmerekadapat perkirakanakanmenunaikanHaji nan tahap ketiga pelayanan ang- oleh warga Saudi yang bekerja di pabrik itu. dua terowongan penyelundu- menunaikan ibadah Haji tahun tahun ini. Sementara itu, Guber- kutan bolak-balik itu, yang akan Kain hitam itu terbuat dari 670 kg sutera murni, 150 kg emas pan di bagian selatan Jalur Gaza ini. Mereka akan diperlakukan nur Makkah Pangeran Khaled Al- digunakanuntukpertamakalinya dan perak yang digunakan untuk melukiskan ayat-ayat al Quran Kamis (19/11), dalam apa yang sebagai tamu pemerintah. Faisal melakukan pemeriksaan tahun ini bagi para jamaah Iran pada kain. Kain dengan ukuran 658 m2 terdiri dari 47 potong, masing- disebut militer sebagai tindakan Menteri Waqaf Palestina fasilitas Haji di kota suci itu Rabu, dan Afrika non-Arab. Sistem itu masing panjangnya 14 m dan lebar 95 cm. harganya berkisar pada balasan atas serangan roket ter- 16,8 juta riyal Saudi. (m07) hadap Israel. Mahmoud Al-Habbash me- termasuk tahap akhir proyek sebelumnya telah digunakan nyambut isyarat baik dari Raja Jembatan Jamarat dan pemba- untukangkutanjamaahdariTurki, Pejabat keamanan Palestina Saudi itu dan mengatakan pihak- ngunan tahap pertama monorail. Eropa, Amerika dan Australia ser- China Kecam Langkah Baru melaporkan tidak ada korban ji- wa dalam gempuran itu. Israel nya akan membuat semua ja- Dalam keterangannya kepa- ta dari Asia Tenggara. maah Palestina itu senang. Dia dawartawan,gubernurmenyata- Ketika pangeran dan rom- Israel Tentang Pemukiman melancarkan perang terhadap militan di Gaza yang dikuasai mengatakan para jamaah akan kan kepuasannya atas penata- bongan yang menemaninya tiba BEIJING, Israel (AP): China mengecam gerakan pemerintah Hamas tahun lalu untuk mem- diseleksi serupa dari Gaza dan an yang dilakukan oleh berba- di Jembatan Jamarat, dia disam- Israel untuk memperluas pemukiman Yahudi di bagian Jerusalem balas serangan roket dan mortir Tepi Barat oleh satu panel khusus. gai departemen pemerintah butolehMenteriUrusanHajiFou- yang diklaim Palestina, dan mengatakan tindakan itu merupakan yang menteror bagian selatan Dia mengatakan undangan untuk melayani para tamu Al- ad Al-Farsy, Menteri Perhubu- ganjalan baru bagi proses perdamaian Timur Tengah. Israel dan menewaskan 18 war- dari kerajaan itu meliputi pemon- lah itu supaya mereka melakukan ngan Jabara Al-Seraisry, dan Ha- Pernyataan oleh Kementerian Luar Negeri China Kamis (19/ ga sipilnya. dokan dan angkutan. Ditam- upacara ritual aman dan memu- beeb Zain Al-Abidine, deputi 11) itu menambah ramai kritikan terhadap Israel, yang sebelumnya Serangan Israel itu mene- menteri urusan perkotaan dan telah mendapat kecaman dari Amerika, Eropa dan tuntutan Palestina waskan lebih 1.400 warga Pales- pedesaan, yang juga menjabat agar Israel menghentikan kegiatan pemukiman di bagian yang Tentara Moldova Diberi sebagaipengawasproyekpemba- dipertikaikan di kota suci itu. tina, dan sejak perang itu berhenti 18 Januari lalu, tembakan roket Kami mendesak pihak Israel untuk mengambil langkah konkrit Bawang Untuk Cegah Flu Babi ngunan tempat-tempat suci. Zain Al-Abidine berbicara untuk memulihkan saling kepercayaan antara Palestina-Israel dan menurun tajam. Menurut perhi- tungan militer, 270 roket dan menciptakan kondisi baik bagi pemulihan kembali perundingan CHISINAU, Moldova (AP): AD Moldova memberi makan bawang mengenai proyek monorel yang mortirditembakkankeIsraelsejak di antrara mereka, kata jurubicara Kemlu China Qin Gang. dan bawang putih kepada tentaranya guna membantu mereka menghubungkan kota-kota suci Kementerian dalam negeri Israel Selasa mengizinkan pem- perang itu dihentikan, dibanding menghadapi flu babi. dengan Makkah, menambahkan bangunan 900 unit perumahan baru di Jerusalem timur yang dicaplok, 3.300 tembakan di tahun 2008. bahwa jamaah akan dapat me- dalam tindakan yang akan memancing kecaman internasional, Namun Israel mengatakan Dokter Kepala Kementerian Pertahanan Kol. Sergiu Vasislita nggunakan fasilitas itu tahun menurut kementerian itu. senjata dan komponen pembuat mengatakan kira-kira 25 gram bawang dan 15 gram bawang putih senjata masih didapatkan militan akan ditambahkan kepada masing-masing tentara untuk makanan depan. Empat menara tempat Komisi perencanaan dan pembangunan telah mengizinkan pembangunan 900 unit perumahan di lingkungan Gilo di Jerusalem, lewat terowongan di bawah per- setiap harinya. Bawang merah dan bawang biasanya menjadi obat pendaratan helikopter akan batasan Gaza dengan Mesir. Dan di Moldova di mana kedua jenis bawang itu diyakini akan mening- dibangun dekat Jamarat untuk kementerian itu menerangkan. Langkah tersebut tiba ketika AS mendesak negara Yahudi itu untuk menghentikan aktivitas tembakan sporadis terus berlan- katkan sistem imunitas seseorang. mengangkut para jamaah yang jut, termasuk serangan roket Vasislita mengatakan Kamis (19/11) bahwa langkah itu telah sakit atau cedera atau sakit saat permukimannya, saat Amerika berupaya untuk membawa Israel dan Palestina kembali ke meja perundingan. The Associated Press Rabu yang tidak menyebabkan diambil setelah 24 tentara jatuh sakit dengan gejala flu babi dalam melaksanakan ibadah. Seorang penumpang yang berhasil diselamatkan menutup adanya korban. Masyarakat internasional acap kali mengkritik Israel karena dua pekan terakhir. Lebih dari 1.000 warga Moldova telah terjangkit Dia mengatakan lebih dari membangun di tanah Palestina yang diduduki, yang Israel rebut hidungnya pada saat regu pertolongan melanjutkan penarikan Militer Israel mengatakan flu babi dan ada laporan setiap harinya 90 kasus flu tersebut menjang- 600 kamera telah dipasang di pada 1967, tapi tanah tempat Palestina ingin membangun negara para penumpang lainnya dari dalam sebuah bus wisata di dalam satu pernyataan bahwa kiti warga. Jamarat untuk memantau gera- mereka pada masa depan. Interstate 90 di Freeborn County, barat Austin, Minnesota, Rabu pihaknya akanmembalas setiap Kira-kira 6.500 pasukan bertugas di tentara Moldova, satu negara kan para jamaah dan mencegah PadaSenin,sebuahharianIsraelmelaporkanbahwaPMBenjamin (18/11). Sebuah bus wisata, yang dioperasikan oleh Strain Bus usaha untuk mengacaukan kecil dari pecahan Republik Uni Soviet yang berbatasan dengan kemungkinan terjadinya kecela- Netanyahu menolak permintaan AS untuk membekukan proyek Line Motorcoach Tours di Rochester, tergelincir dan terbalik, ketenangan masyarakat di sela- Rumania dan Ukraina. (m07) kaan.(an/m07) di Gilo, di pinggiran selatan Jerusalem itu. (m07) masuk parit di jalanraya Interstate di selatan Minnesota Rabu. tan Israel.(m18) 3. 6 Sport WASPADA Jumat 20 November 2009 Uruguay Pesta Pamungkas MONTEVIDEO (Waspada): Uruguay menggelar pesta pamungkas dari rangkaian panjang perjalanan kualifikasi Piala AP Dunia 2010, setelah merebut Aksi striker Spanyol David Villa tak terhadang pemain Austria Aleksandar Dragovic (kiri) dan Paul Scharner (kanan) di Wina, tiket ke-32 menuju Afrika Rabu (Kamis WIB). Selatan, Kamis (19/11) pagi Villa Cs Ulangi Sukses Euro WIB. SPANYOL mengulangi kenangan suksesnya di Euro 2008 Kendati berjuang keras untuk dengan mengandaskan 10 pemain Austria 5-1 dalam duel eksibisi bisa menjinakkan Kosta Rika, internasional di Wina, Rabu (Kamis WIB). Uruguay akhirnya berhasil mere- David Villa mencetak gol dua kali untuk juara Eropa itu di but satu tempat pada putaran Stadion Ernst Happel, mirip dengan kemenangan 1-0 El Matador final dengan membukukan hasil pada final atas Jerman tahun lalu.Tambahan dua gol itu sekaligus imbang 1-1 di kandang sendiri, membuat koleksi Villa menjadi 35 gol dalam 54 penampilan. Stadion Centenario. Sayagembiradatangkesinilagidanteringatdengankenangan Hasil seri itu membuat Di- luar biasa tentang kemenangan lalu. Saya kira kami pantas ego Lugana cs menang agregat mendapatkan kemenangan ini, karena kami bermain bagus, 2-1 setelah menaklukkan Kosta ucap Villa, seperti dikutip dari Sky, Kamis (18/11). Rika1-0padapertemuanpertama Austria yang gagal maju ke Piala Dunia 2010, memimpin di San Jose, Sabtu lalu. lebih dahulu melalui Jakob Jantscher menit kedelapan. Cesc Striker pengganti Sebastian Fabregas menyamakan kedudukan dua menit kemudian, Villa Abreu mencetak gol dengan menggebrak dua kali sebelum turun minum, pemain pengganti tandukannyabagitimtuanrumah Dani Guiza dan Pablo Hernandez lantas memantapkan sukses menit 70. Keunggulan itu disam- El Matador. but para suporter Si Biru Langit dengan membuat kegaduhan di Berbatov Top Skor Bulgaria Centenario.Tigamenitkemudian, kapten tamu Walter Centeno Alvaro Fernandez (kiri) dan Diego Perez (kanan) merayakan sukses Uruguay di atas tiang gawang Stadion Centenario, Montevideo, Kamis (19/11) pagi WIB. AP BOMBER Manchester membangkitkanharapannegara- United Dimitar Berbatov nya dengan melesakkan gol tandukan gelandang Sebastian tegang saat Centeno mencetak pihak timnya, setelah Centeno penyama kedudukan. Eguren mengarah lurus ke gol balasan dari jarak dekat. dapat mencetak gol balasan ke 32 Negara Peserta Afsel 2010 menjadi top skor Bulgaria dengan koleksi 48 gol, setelah Uruguay yang mengoleksi arahnya.Tepat jelang pertanding- Namun hingga peluit berbunyi, gawang tuan rumah. Saya tidak Zona Eropa: Belanda, Inggris, Spanyol, Jerman, Denmark, mencetak dua angka dalam gelar keduanya sebagai juara an berlangsung sejam, Forlan kedudukan tidak berubah lagi. tahu bagaimana pers dapat akses Serbia, Italia, Swiss, Slowakia, Yunani, Slovenia, Portugal kemenangan 4-1 atas Malta dunia tahun 1950, gagal untuk melepaskantembakanmendatar sehingga terlibat perkelahian, dan Perancis. pada partai ujicoba di Paola, mendominasi pertandingan ke sisi kanan Navas, namun kiper Curigai juru kamera sesal Simoes. Zona Asia/Oceania: Jepang, Australia, Korea Selatan, Korea Rabu (Kamis WIB). kendati memilikibanyakpeluang. itu mampu melompat untuk Duel itu sempat dihentikan Kami tidak dendam. Setelah Utara dan Selandia Baru. Sang kapten memasukkan Luis Marin bergerak lincah untuk menangkap bola dengan sigap. selamahampirlimamenitterakhir kami dapat menyamakan kedu- Zona Afrika: Afrika Selatan, Ghana, Pantai Gading, Nigeria, AP Abreuyangditurunkanuntuk karena ada perkelahian antara dukan, pertandingan dihentikan, golpertamanyamenit75untuk memperketat pertahanan Kosta Kamerun dan Aljazair. menyamai rekor mantan gelandang elegan Bulgaria Hristo Bonev Rika saat tim tuan rumah menggantikan Luiz Suarez, seorang juru kamera Uruguay padahal kami sedang tampil Zona Amerika Selatan: Brazil, Paraguay, Chile, Argentina yang mencatat rekor 47 gol. Bomber berusia 28 tahun itu mengeksekusisejumlahtendang- berusaha mengecoh pertahanan di dekat garis lapangan dan bagus, tambah arsitek asal Brazil dan Uruguay. menambah satu gol lagi tujuh menit kemudian, sehingga rekornya an bebas. Kosta Rika. Dia memberi Uru- pemain cadangan Kosta Rika. itu. Zona Amerika Utara: Meksiko, Amerika Serikat dan Hon- melebihi Bonev dalam penampilannya yang ke-74 bagi timnas. MenitkelimakiperKostaRika guaygoldanganmelompatuntuk Pelatih Kosta Rika Rene Sedangkan pelatih Uruguay duras. Dua gol Bulgaria lainnya ke gawang Malta disumbangkan Keilor Navas melakukan diving menandukkan umpan tinggi dari Simoes yang curiga, memper- Oscar Washington Tabarez Valeri Bojinov dan Blagoy Georgiev, sedangkan gol balasan tuan ke sisi kiri untuk menghalau bek Andres Scotti yang melewati tanyakan motif juru kamera mengaku, kini merasa tenang dibenahi, tapi juga ada banyak kesalahan dan menunjukkannya rumah dicetak Michael Mifsud beberapa menit setelah turun tembakan Diego Forlan dari luar Navas. tersebut. Simoes merasa saat itu setelah lolos ke Afsel. Tim ini kebaikan. Kami punya waktu di Piala Dunia, tegas Tabarez. minum. kotak penalti. Semenit kemudian Uruguay merasa gugup dan momentum sedang berada di punya banyak hal yang perlu enam bulan untuk memperbaiki (h01/ant/rtr/ap) Tragedi Enke Hantui Panser ISL U-21 Terbagi Tiga Grup PELATIH Jerman Joachim Loew mengaku, tragedi bunuhdiri kiper Aljazair Tutup Mulut Mesir JAKARTA (Waspada): PT kemudian masuk semifinal dan ka memang dibutuhkan usai Robert Enke masih menghantui, KHARTOUM, Sudan Liga Indonesia selaku pelak- final. tampil di ISL U-21. Hanya saja sehingga pasukan Panser belum bisa (Waspada):Aljazairmenjadiwakil sana regulasi kompetisi non Putaran pertama akan ber- jumlahnya kami batasi, tidak bermain bagus saat ditahan Pantai terakhir benua Afrika yang lolos amatir sepakbola nasional langsung sampai 20 Januari 2010. boleh lebih dari lima pemain. Gading 2-2 dalam duel eksibis di ke putaran final Piala Dunia 2010 kembali menggulirkan kom- Sesuai jadwal yang telah kami Untuk hadiah, juara akan Gelsenkirchen, Rabu (Kamis WIB). dengan menutup mulut Mesir petisi Indonesia Super League buat, putaran kedua akan ber- mendapatkan Rp150 juta, run- Para pemain berusaha fokus lewat kemenangan 1-0 pada (ISL) U-21 diikuti 18 tim, ter- langsung akhir Januari men- ner up Rp75 juta dan Rp50 juta padapertandingan.Sepertiandalihat, AP playoffdiKhartoum,Rabu(Kamis bagi dalam tiga grup. Kom- datang, jelas Joko. untuk posisi ketiga, tukas mereka mampu juga untuk bertan- WIB). petisi bergengsi tingkat junior Ditambahkannya, jadwal Joko. (yuslan) ding sekaligus masih menginginkan kemenangan, ungkap Loew Saya sangat gembira karena yang sudah kedua kalinya laga tim U-21 ini akan mengikuti dalam DPA. kami akhirnya mendapat ke- digulirkan itu sesuai rencana tim seniornya dengan selisih se- Pembagian Grup ISL U-21 Gol injury-time dari Lukas Podolski menyelamatkan Der adilan. Kami bertanding, kami akan dimulai 29 November hari, yakni sesudah atau sebe- Grup 1: Sriwijaya FC, PSPS, Panzer dari kekalahan di depan publiknya sendiri. Jerman menang dan meminta Mesir mendatang. lum seniornya bertanding de- Persija, Persita, Pelita Jaya dan memimpin lebih dahulu menit 11 lewat penalti Podolski, setelah tutup mulut, ujar gelandang Menurut CEO PT Liga In- ngan tim tuan rumah. Mena- Persib. kiper Guy Demel menjatuhkan Stefan Kiessling di kotak terlarang. Aljazair Madjid Bougherra. donesia Joko Driyono dalam riknya lagi, tambah Joko, pema- Grup 2: Persijap, Persik, Pantai Gading yang seperti Jerman sudah lolos ke Piala Dunia Sukses lolos ke putaran final keterangan persnya di Jakarta, in junior dibolehkan membela Arema, Persema, Persela dan 2010 di Afrika Selatan, menyamakan kedudukan dengan cara untuk pertama kali dalam 24 Kamis (19/11), tahun ini akan tim senior, namun tidak untuk Persebaya. ganjil menit 57 melalui Emmanuel Eboue. Seydou Doumbia tahun tersebut, seolah menjadi AP ada modifikasi penyelengga- sebaliknya. membalikkan keadaan lewat tendangan kerasnya menit 85, justifikasi bagi Aljazair setelah Para pemain Aljazair dan Mesir (merah) terlibat konflik di Marrikh ran ISL U-21. Kejuaraan di- Kami membuka kran bagi Grup 3: Bontang FC, Persiba, sebelum Podolski menyarangkan bola menit ketiga injury-time. pertemuanyangdiwarnaiinsiden Stadium, Khartoum, Sudan, Rabu (Kamis WIB). mulai dengan babak pen- pemain junior tampil di tim Persisam, PSM, Persiwa dan kekerasan di Kairo, Sabtu lalu. dahuluan, enam besar, baru senior, jika saja tenaga mere- Persipura. Dinamit Miliki Amunisi Bagus Sebelum kalah 0-2 di Kairo, tim bek Antar Yahia menit 40. Tim Belhadj; 6-Yazid Mansouri, 8- ARSITEK Denmark Morten Aljazair disambut lemparan batu oleh pada pendukung tuan bermain dengan hati dan saya kiraitulahyangmembuathasilnya HassanYebda,18-MouradMeghni (13-Karim Matmour 58); 15- Hari Ini PSDS Jr Awali Perjuangan Olsen makin yakin dengan bakat ba- rumah Mesir, menyebabkan dua menjadilain.Sayakirakamipunya Karim Ziani; 9-Abdelkader gusamunisinya,yangmampubangkit pemainnya mengalami cedera cukup waktu untuk bersiap Ghezzal & 10-Rafik Saifi (14- MALANG ( Waspada): Secara terpisah beberapa gi untuk meraih hasil terbaik dari ketertinggalan untuk menak- di bagian wajah. menuju Piala Dunia di Afrika Kamil Ghilas 85). PSDS Deliserdang Jr nyatakan pemain di antaranya Rofikus guna membawa nama ha- Para pendukung Aljazair Selatan, ucap pelatih Aljazair Mesir (1-3-5-2): 1-Essam El siap berjuang di babak 16 Pratama, Bayu Permadi, Sandi rum Sumut, khususnya De- lukkanAmerikaSerikat3-1padapartai besar nasional Liga Remaja MR Sitanggang serta Agung liserdang, tekad mereka. pemanasan Piala Dunia di Aarhus, kemudian membalas kekerasan Rabah Saadane. Hadari; 4-Abdelzaher El Saqqa itu dengan merampok toko-toko (2-Ahmed Eid75), 18-Wael Piala Suratin U-18 yang diawali, Surya menyatakan akan berju- Juniman pun optimis, Denmark, Rabu (Kamis WIB). Jumat (20/11) sore ini di ang keras untuk dapat merebut PSDS Jr akan kembali berhasil Kami memiliki pemain dengan milik warga Mesir di Aljazair. Aljazair vs Mesir 1-0 (agr 1-0) Gomaa, 6-Hani Saied; 3-Ahmed Gol: Antar Yahia 40 El Muhammadi, 14-Sayed Malang. satu dari dua tiket yang tersedia menorehkan prestasi terbaik AP bakat bagus. Di putaran final Piala Kemenangan diraih dengan Tapi hingga Kamis (19/11) ke putaran 8 besar. pada Piala Suratin 2009, Dunia, mereka akan semakin menanjak, optimisme Olsen. susah payah karena Mesir Wasit: Eddy Maillet (Seychelles) Moawad, 17-Ahmed Hassan, 7- Ahmed Fathi (9-Mohamed Zidan siang, Panpel pertandingan Kami akan tampil dengan setelah tahun 2008 menjadi Sepanjang babak pertama AS mendominasi permainan bermain bagus. Tapi kami harus belum memberikan informasi semangat dan fanatisme ting- juara III nasional. (a05) dan selalu menyerang. Jeff Cunningham melakukan gebrakan sabar menunggu waktu yang Aljazair (1-4-3-1-2): 1-Faouzi 46), 5-Mohamed Aboutrika; 10- apapun kepada PSDS Jr terma- untuk membawa tim tamu memimpin menit 26 dengan tepat untuk melakukan serangan Chaouchi; 2-Madjid Bougherra, Emad Motaeb, 15-Amr Zaki (8- suk pelaksanaan technical 4-Antar Yahia (17-Samir Zaoui Hosni Abd Rabou 46). menaklukkankiperThomasSorensen.TimDinamitmembalikkan keadaan pada babak kedua melalui gol pemain pengganti Johan balik, beber Bougherra. Gol tunggal Aljazair dicetak 66), 5-Rafik Halliche, 3-Nadir (h01/rtr/fifa) meeting untuk menentukan jadual laga yang akan dimulai Timnas U-19 Perlu Absalonsen, Soren Rieks dan Martin Bernburg. sore ini. Gabung bersama tuan ru- Pematangan Mental Kincir Angin Kekeringan Gol Fans PSG Tolak mah Persema Malang Jr, Per- sib Bandung Jr serta Kampar JAKARTA (Antara): Sekjen PSSI Nugraha Besoes mengatakan, timnas U-19 yang pekan lalu tampil di Pra Piala Asia di Bandung Jr, tim Traktor Kuning diarsi- masihmembutuhkanpematanganmentalsaatberhadapandengan BOS Belanda Bert van Marwijk kecewa dengan hasil seri 0-0 yang Ikut Ke Marseille teki Dosman Sagala bertekad meraih tiket lolos ke putaran tim asing. Mereka bisa diharapkan menjadi pemain masa depan kita. diraih tim Kincir Angin ketika men- 8 besar nasional. Dengan ma- Tapi mereka masih membutuhkan pematangan mental, terutama PARIS (Waspada): Suporter Paris Saint Germain menolak untuk jamu Paraguay di Heerenveen, Rabu teri 23 pemain, PSDS Jr di- menyangkut kondisi saat dengan siapa mereka bertanding, jelas mengikuti perjalanan timnya melawan tuan rumah Olympique pimpin manajer Ir Juniman, (KamisWIB), mengulangi hasil sama Nugraha Besoes di Jakarta, Kamis (19/11). Marseille di Ligue 1 dinihari WIB nanti. Selasa (17/11) telah bertolak saat menjajal Italia akhir pekan lalu. Nugraha mengakui ketika tim yang selama dua tahun dibina Fans PSG merasa kecewa dengan pembatalan pertandingan ke Jawa Timur melalui Ban- di kompetisi Uruguay itu berhadapan dengan Singapura dan Jepang Kincir Angin seperti mengalami AFP yang sedianya digelar pada 25 Oktober lalu. Pasalnya, mereka sudah dara Polonia. pada dua pertandingan awal penyisihan Grup F Piala Asia U- kekeringan gol tanpa pemain kreatif terlanjur keluar uang untuk biaya perjalanan ke Marseille dan bentrok PSDS susah melakukan 19 di Stadion Si Jalak Harupat Kabupaten Soreang Bandung, mereka sepertiWesley Sneijder, Arjen Robben Jumat,20November: dengan kepolisian, namun kemudian laga ditunda karena kasus latihan di lapangan Brimob seperti merasa asing berhadapan dengan lawan. dan Robin van Persie, semuanya Marseille v Paris SG (2000) AP flu babi. Untuk menghindari kerugian lebih lanjut, PSG pun menyewa difasilitasi seorang putra Deli- Selain itu, tampil pertama kali di hadapan publik sendiri dengan masih bergelut dengan cedera. Selain Sabtu,21November(GMT): sebuah kereta untuk suporternya. Namun kebijakan ini membuat serdang asal Tanjungmorawa menyandang lambang Garuda merupakan beban yang harus jarang membahayakan gawang lawan, kiper Belanda Maarten BordeauxvValenciennes (1800) fans makin sakit hati dan memutuskan pemboikotan laga tunda yang bertugas di Malang. Soal mereka pikul sejak dini. Stekelenburg pun mesti melakukan penyelamatan gemilang Ludovic Giuly (foto) dan kawan-kawan. kesiapan tim, Dosman Sagala Di putaran Grup F Piala Asia U-19 yang berakhir Selasa lalu, untuk menggagalkan aksi striker Paraguay Oscar Cardozo. GrenoblevLyon (1800) menegaskan tidak ada ma- RacingLensvNancy (1800) Kami bukan binatang. Kami manusia yang bisa bergerak Indonesia mengalami dua kekalahan, yakni kalah 0-1 dari Singapura Penampilan kami buruk dan kurang memuaskan, tapi anda salah. Selama dua hari di Ma- kemanapun sesuai kehendak. Kami sudah melakukannya selama dan dibantai Jepang 7-0.Tetapi dalam tiga pertandingan berikutnya harus melihat bahwa Italia dan Paraguay merupakan tim kuat. StadeRennesvLeMans (1800) lang, kondisi anak-anak bagus imbang 0-0 dengan Australia, menang 6-0 atas China Taipei dan AuxerrevASMonaco (2000) 10 tahun tanpa ada masalah. Kami bukan anjing peliharaan PSG, Kami punya kemampuan mencetak gol, tapi beberapa hari dan fit. Bahkan semangat se- unggul 4-1 atas Hongkong. ujar juru bicara kelompok suporter Lucete Falco dalam Le Parisien terakhir ini kami kehilangan sejumlah pemain andalan karena Minggu,22November: luruh pemain tampak sema- Hal ini menjadi catatan kita, mereka perlu beradaptasi dengan yang dikutip Kamis (19/11). cedera, sesal Van Marwijk. kin meningkat, itu terlihat saat situasi yang berbeda karena selama ini saat dibina di Uruguay OBLNicevToulouse (1600) Selain menolak untuk diberangkatkan dengan kereta, suporter juga tak setuju dengan biaya sebesar 100 euro. Padahal mereka melakukan latihan, jelas selalu berhadapan dengan tim-tim dengan gaya permainan yang St Etienne v Lorient (1600) Kepastian Lippi Montpellier v Lille (2000) hanya mengeluarkan 60 euro jika pergi dengan bis. (h01/bb/afp/ap) Dosman. sejenis, ujarnya. Klasemen Ligue 1: Sebelum PD 2010 Bordeaux 12 8 1 3 20- 9 25 KEPASTIAN masa depan Lyon 12 7 3 2 22-16 24 Marcelo Lippi (foto) sebagai Auxerre 12 7 2 3 13-10 23 pelatih Italia akan ditentukan Monaco 12 7 1 4 16-11 22 sebelum sang juara bertahan Lorient 12 6 3 3 20-11 21 bertolakkeAfrikaSelatanuntuk Montpellier12 6 3 3 19-16 21 mempertahankan gelarnya Valenciennes 12 6 2 4 23-16 20 pada putaran final Piala Dunia Marseille 11 5 4 2 22-15 19 2010 Toulouse 12 5 3 4 14-10 18 AP Hasil duel memang AS Nancy 12 5 2 5 17-17 17 penting dalam sepakbola, tapi Nice 12 5 2 5 15-21 17 anda tak bisa menunda keputusan mengenai masa depan pelatih Paris SG 11 4 4 3 17-12 16 tim nasional hingga setelah Piala Dunia. Kami perlu berangkat Rennes 12 4 4 4 17-12 16 ke Afsel dengan rencana yang jelas, tegas Presiden Federasi Lille 12 4 4 4 14-14 16 Sepakbola Italia (FIGC) Giancarlo Abete, sepert dikutip dari Sochaux 12 5 0 7 13-19 15 AFP Kamis (19/11). , St Etienne 12 4 1 7 10-15 13 Abete menyatakan demikian setelah Gli Azzurri mem- Rc Lens 12 3 3 6 11-20 12 pecundangi Swedia 1-0 lewat gol tunggal Giorgio Chiellini dalam Boulogne 12 2 3 7 9 -22 9 duel eksibisi, Rabu (Kamis WIB) di Cesena. Le Mans 12 2 2 8 10-18 8 (jonny/dari berbagai sumber) Grenoble 12 0 1 11 5 -23 1 4. WASPADA Jumat 20 November 2009 Sport 7 Debut Hebat Devin/Liliyana SHANGHAI, China (Waspada): Devin Lahardi dan Liliyana Selain Devin/Liliyana dan Chen Hong Ling/LinYu Lang 15- Tunggal putri Maria Kristin Natsir melanjutkan debut hebatnya sebagai pasangan baru Simon,pemainIndonesialainnya 21, 18-21. juga tersingkir pasca gagal me- dengan maju ke perempatfinal China Terbuka di Shang- yang lolos ke perempatfinal Sebelumnya,Markis/Hendra ngatasi permainan tunggal putri hai, Kamis (19/11). adalah Sony Dwi Kuncoro yang yangsaatinimenempatiperingkat China Wang Shixian, sehingga akan bertarung melawan pema- tiga dunia tersisih setelah kalah 13-21, 13-21. Mereka akan menantang bawa mereka kembali memim- in China Chen Jin. Sony menga- dikalahkanpasanganTaiwanFang China Terbuka merupakan pasangan tuan rumah Zhang pin hingga laga berakhir. Tadi lahkan pemain India Arvind Bhat Chieh Min/Lee Sheng Mu 19-21, turnamen terakhir dari 12 Nan/ZhaoYunlei, setelah menga- agak terburu-buru sehingga ba- 21-15, 21-16. 21-11, 15-21. rangkaian Super Series yang lahkanpasanganKoreaShinBaek nyak mati sendiri, jelas Devin. Unggul lebih dulu hingga digelar sepanjang 2009. Delapan Cheol/Kim Min Jung 21-11, 21- Untuk tunggal putra, unggu- Ganda putra habis kedudukan17-14padagameper- pemain/pasangan terbaik dalam 16 dalam waktu 26 menit di lan ketujuh Simon Santoso juga Pada ganda putra, Indonesia tama, ganda peraih emas Olim- Super Series berhak mengikuti PudongYuanshen Sport Center. membukukan tempat di delapan sudah tidak punya wakil setelah piade Beijing yang absen sekitar Grand Final yang tahun ini akan Waspada/Rudi Arman Devin/Liliyana yang meng- besar setelah bangkit dari keter- dua pasangan lainnya menyusul tiga bulan itu, terkejar dan kehi- digelar di Johor Baru, Malaysia Drs Ramlan Tarigan memberi pengarahan kepada para guru untuk mensukseskan jalan santai hasilkan total 17 angka melalui tinggalan untuk menyingkirkan Markis Kido/Hendra Setiawan langan game pembuka 19-21. 2-6 Desember mendatang. HUT PGRI, Kamis (19/11). smes, melaju pada game perta- pemain Inggris Carl Baxter 14- tersingkir dari turnamen berha- Mereka bahkan tertinggal Setiap negara/asosiasi mak- ma dengan meraih 11 angka 21, 21-12, 21-18. diah 250.000 dolar AS itu. hampir sepanjang game penen- simal diwakili dua pemain/ beruntunsaattertinggal3-4untuk Simonakanmemperebutkan Pasangan Rian Sukmawan/ tuan setelah merebut game pasangan untuk setiap nomor. 5000 Guru Ramaikan Jalan Santai HUT PGRI menang dengan angka 21-11. Pada game kedua, pasangan satu tempat di babak empat besar dengan melawan favorit tuan Yonatan Suryatama menyerah pada ganda China Guo Zhen- kedua 21-11, sehingga menyerah setelah bermain selama 40 menit. Final Super Series menyediakan hadiah total 500.000 dolar AS debutan itu sempat terkejar se- rumah Lin Dan, yang mengalah- dong/XuChen17-21,19-21.Bona Lawanmemanglebihbagustadi, dengan juara tunggal putra dan MEDAN (Waspada): 5000 akan dihadiri Ketua DPRD Kota Selain jalan santai, acara juga diisi telah berhasil unggul 10-6. Na- kanrekansenegaranyaChenLong pertahanannya kuat, ujar putri akan menerima masing- Septano/Mohammad Ahsan guru direncanakan akan mera- Medan, Pj Walikota Medan Drs hiburanlucky draw dengan ha- mun lima angka beruntun mem- 21-12, 21-15. Hendra. masing 40.000 dolar AS. (h01/ant) ditundukkan pasangan Taiwan maikan jalan santai dalam rangka RahudmanHarahapMMbeserta diah utama 2 unit sepeda mo- menyambut HUT Persatuan Guru Republik Indonesia (PGRI) ke-64 sekaligus Hari Guru jajarannya, mengangkat tema Memacu Peran Strategis Pe- merintah, Daerah, Masyarakat tor, kulkas, televisi, rice cooker, HP dan kipas angin. Selain memberikan keseha- Agung Tersingkir Kejutan, Pecatur Sumut Memimpin Nasional (HGN) di Kota Medan, dan Guru Dalam Mewujudkan tan bagi para guru, jalan santai JAKARTA (Waspada): Pupus ke perempat usai menghentikan Minggu (22/11). Demikianpenanggungjawab Guru Profesional, Sejahtera, Ber- martabat dan Terlindungi. ini juga diharapkan sebagai ajang silaturahim bagi guru. Dalam sudahharapanpetenisasalSumut, rekan satu derahnya Sebastian Kejurnas Catur Di Palangkaraya Agung Bagus Dewantoro, melaju Dacosta 6-3, 2-6, 6-4 dalam waktu kegiatan Drs Ramlan Tarigan di- Jalan santai kali ini akan memeriahkan Hari Guru pada ke babak perempatfinal Turna- dua jam 28 menit. Di nomor MEDAN (Waspada): Pecatur regu. Keberhasilan Pitra hingga dampingi Koordinator Drs Abdul menempuh jarak kurang lebih 25 November bertempat di Hotel men Tenis Xpro Open 2009 seta- ganda, Elbert yang berpasangan mudaSumateraUtaraPitraAndika babak keenam diharapkan men- RahmanSiregar,KetuaPanitiaDra 5kmdenganmengambilrutestart Madani, PGRI Kota Medan juga lah dihentikan petenis gaek Bonit dengan Ryan Tanujoyo sudah AidarUzirMMdanSekretarisAndi dari Mesjid Raya, Jl Brigjen akan menggelar malam anuge- MN (foto) membuat kejutan jadi momentum kebangkitan Wiryawan 7-6 (8), 7-5 di lapangan meraih tiket ke perempatfinal dengan memimpin sendirian cabang olahraga catur di Suma- Yudhistira SPd, Kamis (19/11). Katamso, Pelangi, SM Raja dan rah bagi para guru dengan mem- tenis Hotel The Sultan, Jakarta, dengan mengalahkan pasangan Menurutnya, kegiatan ini finish kembali di Mesjid Raya. berikan 500 sertifikat. (m39) Kamis (19/11). Jabar, Rinaldi Nugroho/Ryan sampai babak keenam kejuaraan tera Utara dalam menghadapi Tersingkirnya Agung mem- Marlo 6-1, 6-1. nasional (Kejurnas) catur ke-40 PON XVIII/2012 di Riau, kata kelompokseniordiPalangkaraya, Parlindungan Purba yang juga KONI Sumut Rindu Kejayaan Labuhanbatu buat Sumut dipastikan tidak mampu menempatkan satu pe- Pada pertandingan lain, ung- gulanteratasChristopherRungkat KalimantanTengah,Kamis(19/11). anggota DPD RI ini. tenisnyapundibabakpamungkas belummenemuikesulitanberarti Pitra yang bersaing di kelom- Namun Parlindungan me- RANTAUPRAPAT (Waspa- Diharapkan muncul lagi L.Batu HT Milwan mengung- pok senior mengumpulkan 6 minta kepada Pitra Andika untuk da): Dengan memiliki Gedung atlet-atlet yang mengharumkan ajang yang diikuti sejumlah untuk merebut tiket perem- kapkan prestasi olahraga L.Batu petenispapanatasputramaupun patfinal, setelah menang atas match point (MP). Sedangkan tidak berpuas diri. Masih ada Olahraga (GOR) terbesar dan nama L.Batu Sumut umumnya beberapa tahun terakhir belum putri nasional. Maklum saja Ayrton Wibowo 6-4, 6-3. Begitu pecatur andalan Indonesia Su- tujuh babak yang harus ditun- termegah di Provinsi Sumatera seperti halnya dua kakak beradik menunjukkan peningkatan. karena Agung merupakan satu- pulaunggulankeduaSunuWahyu Utara, KONI Sumatera Utara Hendrik Simangunsong dan Tidak ada pekerjaan yang tidak santo Megaranto GM tertinggal taskan. Begitu juga dengan pe- SimbolonMNdanSukarnediMN, satunya petenis Sumut yang Trijati yang menyisihkan Ferdi dengan nilai 4,5 MP . catur Sumut lainnya di kelompok namun keduanya berhalangan merindukan kembali kejayaan almarhum Franklin Simangun- bisa diselesaikan kalau dikerjakan masih tersisa. Fauzi 6-4, 6-0. olahraga Labuhanbatu. song yang berjaya pada cabor dengan sungguh-sungguh, Kejurnas senior yang diikuti senior dan junior yang masih main di Palangkaraya karena Sempat memberikan perla- Darisektortunggalputri,ung- 240pecaturmenggunakansistem bertanding pada Kejurnas di kondisi kesehatan yang tidak Ketua Umum KONI Sumut tinjupadaPONXII1989diJakarta. katanya. wanan sejak set pertama, Agung gulan teratas Ayu Fani Damayanti H Gus Irawan SE Ak MM memin- Hendrik sendiri pernah meraih KepadapengurusKONIL.Ba- Swiss 13 babak. Pitra Andika di Palangkaraya, terang Parlin- memungkinkan. yang kalah pengalaman sering (DKI) lolos ke perempatfinal se- ta hal itu saat peresmian GOR medali emas tinju pada PON XV tu yang baru dilantik, bupati terburu-buru di set terakhir telah menang mudah atas Dewi babak keenam mengalahkan dungan. Untuk kelompok junior, Rantauprapat oleh Bupati L Batu 2000 di Surabaya,almarhum mengharapkan agar membuat sehingga gagal menyelesaikan Fortuna (Banten) 6-0, 6-3. Hal Sugeng Prayitno MN dari Kali- Sedangkanmanajertimcatur pecatur Sumut Arif yang tampil HT Milwan, Kamis (19/11), di Franklin pernah mengikuti Sea semangatbaruuntukmendulang duel dengan baik. Bonit yang sama dilakukan unggulan kedua mantanTimur. Di babak ketujuh, SumutSuhadiWNmenyebutkan, di kelompok junior D mem- halamanGORsetempatsekaligus Games. prestasi dan melanjutkan pro- merupakan mantan petenis Lavinia Tananta yang tidak perlu Jumat (20/11), Pitra bertemu pe- Pitra memimpin klasemen se- peroleh nilai 4 dari enam babak pelantikan KONI L.Batu masa Daerah ini juga pernah mela- gram kerja sesuai visi misi dalam papan atas nasional dan kini susah payah untuk menyisihkan catur tangguh asal Riau Ar- mentara di antara deretan pe- yang telah dipertandingkan. bakti 2009-2013. hirkan juara marathon pada PON RJPMD 2006-2010. berusia 41 tahun ini mampu Pradipta Deby Mutiara (Jateng) diansyah GM yang hingga babak catur tangguh Indonesia. Di Sedangkan Hulman yang juga GusyangjugaDirekturUtama VIII/1973 atas nama Darlin Hasi- Menurutnya,cabang-cabang meredampermainanBagusyang 6-1, 6-0. keenam mengumpulkan nilai 5,5 bawahnya ada tiga pecatur mem- tampil di kelompok D baru Bank Sumut ini menyatakan, buan. Pada bagian lain, Gus me- olahraga yang dapat dimanfa- mengadalkan pukulan dari Petenis favorit lainnya Sandy MP . peroleh 5,5 MP yakni Ardiansyah , memperoleh nilai 1,5 MP Jun- . KONI Sumut mengharapkan ngingatkan ada tiga unsur utama atkan di GOR Ran-tauprapat baseline dan forehand yang Gumulya yang juga anggota tim Ketua Umum Pengprov GM (Riau), Hasian Panggabean ior putri SumutTessi yang tampil para atlet L.Batu dapat menjadi dan mutlak dalam peningkatan adalah basket, bola voli, bulu- lumayan bagus. SEA Games Laos, pun hanya Percasi Sumut Parlindungan Pur- (DKI Jaya). di kelompok B dan Yolanda di bagian dari kontingen Sumut di prestasi olahraga, yakni pembina, tangkis, futsal, tenis meja, sepak Pertarungan menarik juga kehilangan dua game untuk ba SH MM didampingi Sekretaris Pecatur Sumut lainnya, Bin- kelompok D sama-sama mem- Porwilsu maupun PON XVIII di pelatih dan atlet. takraw juga gulat, tinju serta sempat tersaji saat petenis Kaltim mengalahkan Enny Sulistyowati Umum Percasi Sumut Ir Perry sar Marbun MN memperoleh peroleh nilai 3 MP dari enam Riau. Dalam sambutannya, Bupati beberapa cabang bela diri. (a27) Elbert Sie mampu merebut tiket (Banten) 6-1, 6-1. (yuslan) Iskandar, Ketua Bidang Kom- nilai 4,5 MPPerolehan nilai Binsar . babak. (m20) petisi Sonny Firdaus SH, Ketua samadenganSusantoMegaranto KONI Sergai Latih Instruktur SEI RAMPAH (Waspada):Dalam upaya meningkatkan mutu KONI Batubara Mengabdi Majukan Olahraga BidangOrganisasiMusdalifahBSc dan Ketua Bidang Litbang Agus GM dan Nurdin Askali MF serta beberapa pecatur lainnya. Binsar 1 2 6 5 7 9 4 8 5 3 9 7 8 1 2 4 3 6 dan standarisasi para pelatih berbagai cabang olahraga, KONI Serdang Siallagan dan unsur kepengu- pada babak ketujuh bertemu LIMAPULUH(Waspada): Antaralainmencaribibit-bibit kembangkan olahraga dengan 4 7 Bedagai akan melaksanakan pelatihan bagi para instruktur cabang rusanPercasiSumut,menyambut Anasrullah MN (Babel). 8 3 2 6 1 5 9 Ketua KONI Sumut H Gus Irawan terbaik dari usia dini untuk cepatsekaligusmensosialisasikan olahraga di kabupaten tersebut. Pasaribu SE AK MM meminta dikembangkan yang akhirnya kepada seluruh pengcab dengan gembira hasil yang diperoleh Menurut Sekretaris Umum 9 3 2 5 4 8 7 6 1 Rapat pun sudah dilaksanakan, dipimpin Ketua Panpel Drs Joni kepengurusan yang baru dilantik dapat memperkuat kontingen melibatkan instansi terkait. pecatur Sumut. Percasi Sumut Perry Iskandar, 5 1 6 3 7 2 4 8 9 Walker Manik didampingiWakil Ketua H Fuadi Pasaribu H Syahlan untuk berjuang mengabdi me- Sumut. Bupati OK Arya Zulkarnain Keberhasilan Pitra memim- Pitra dan Binsar masuk program 8 7 4 9 1 6 3 5 2 Siregar ST H Husnul Fattah SH SIP dan Adlin M Tambun. majukan olahraga yang akhirnya Kami berharap Batubara SH MM mengatakan, Batubara pin sendirian di antara pecatur pecatur unggulan Program Pem- tangguh Indonesia cukup meng- binaanIntensif(PPI)KONISumut 6 2 1 7 8 4 9 3 5 Menurut Manik, Kamis (19/11), pelatihan ini sangat penting dapat membuahkan suatu dapat memberi konstribusi mempunyai banyak atlet ber- dilaksanakan karena perlu adanya standarisasi pelatih agar tumbuh kebahagiaan. memperkuat kontingen Sumut. prestasi dan satu hal bukti adalah gembirakan, setelah pada PON dalam menghadapi PON Riau. 7 4 5 6 9 3 2 1 8 atlet-atlet yang tangguh. Diungkapkan pula, untuk langkah awal Ini pernah saya lakukan Kita yakin ini dapat terlaksana masuknya PSBB ke Divisi III Liga XVII/2008 di Kaltim memperoleh Sumut memiliki dua pecatur 3 9 8 1 2 5 6 7 4 pelatihan ini dipersiapkan untuk menghadapi Pordasu 2010. mendapat kebahagiaanyangluar sebab kabupaten yang baru Indonesia. (a11/a30) medali perunggu di kelompok unggulan lainnya, Yohannes DiPordasu2007,Sergaimendudukirankinglimabesar.Pelaksanaan biasa menciptakan atlit prestasi seumur jagung ini sudah dapat pelatihan direncanakan pada 20-22 November di PT Indosat meraih medali emas pada olah- mengelar festival internasional Kecamatan Pantai Cermin. Peserta pelatihan terdiri dari guru SD raga, sebutnya pada pelantikan FIVOP di Pantai Per-juangan, 12 orang, guru SMP (8) dan guru SMA (5) serta para Pengcab Olahraga kepengurusan KONI Kab Batu- jelas Gus. daerah setempat. (a07) bara periode 2009 s/d 2013 di ha- Sebelumnya, Ketua KONI laman kantor bupati setempat, Batubara Hadi Suriono SE MM Rabu (18/11). mengaku berusaha menumbuh- Sudoku 400 Atlet Peserta Porda Sibolga Isi kotak kosong dengan angka 1 sampai 9. Tidak boleh ada SIBOLGA (Waspada): Pekan mampu mematuhi peraturan pengulangan angka mendatar, menurun, maupun di dalam Olahraga Daerah (Porda) Kota serta memahami dan mengha- kotak 3x3 bergaris tebal. Tidak ada keterlibatan matematika, Sibolga diikuti 400 atlet, Rabu (18/ yati nilai-nilai moral sebagai anak hanya membutuhkan pertimbangan dan logika. 11), di GOR Aek Parombunan Si- bangsa, katanya. bolga Selatan usai upacara pem- Ketua Panitia Kadisbudpar- Tingkat kesulitan hari ini: sedang (***). Jawaban di kolom 8. bukaan oleh Irup Walikota Drs pora Kota Sibolga M Situmorang Sahat P Panggabean MM. dalam laporannya mengatakan, 8 5 7 Dalam sambutannya, Wali- kota menilai Porda merupakan Porda bertujuan meningkatkan persatuan dan kesatuan sesama 2 4 7 1 uji kemampuan untuk berkom- atlet. Cabang olahraga yang petisisecarajujurdansportifsesuai dipertandingkan meliputi atletik, tingkatan dan cabang kegiatan sepak takraw, sepakbola, bola voli, 7 4 2 6 yang diikuti. Kemenangan tidak sebatas menjadi juara, tetapi bulutangkis, pencak silat, tenis meja dan futsal, katanya.(a18) 2 1 3 6 7 8 TAKO Labuhan Batu Siap Tempur RANTAUPRAPAT (Waspa- dan Piala Kasad pada Februari da): Perguruan Karate-Do TAKO dan Maret mendatang, kata Ke- Indonesia Cabang Labuhanbatu tua Pengurus Perguruan Karate- 4 7 5 1 9 6 telah menyiapkan 17 atlet untuk berlaga pada Turnamen Karate Do TAKO Indonesia Cab. L.Batu Ali Akbar Hasibuan SE, Kamis se Sumatera memperebutkan (19/11). 6 2 1 9 Piala Bupati L.Batu HT Milwan pada 20-22 November di GOR Pada kejuaraan nanti, TAKO L.Batu akan mengikuti beberapa 4 1 9 8 Rantau Prapat. kelasdiantaranya,usiadini,senior Selain kesiapan mengikuti 18-26 tahun di kelas 55 kg, 65 kg, turnamen, perguruan TAKO -70 kg, +70 kg, +78 kg, kelas kata 1 6 4 L.Batu juga mempersiapkan para atlet untuk Kejurda TAKO Sumut perorangan pemula serta sen- ior putra.(a27) 5. 8 Sport WASPADA Jumat 20 November 2009 Federer Masuk Grup Maut LONDON (Waspada): akhirnya menunda kolek- Perancis Terbuka. tisi. Dua petenis peringkat Petenis nomor satu dunia, si gelar grand slam petenis Turnamen akhir tahun teratas dari masing-masing Roger Federer, berada di Swiss itu bertambah. yang mementaskan delapan grup akan maju ke semifi- grup maut pada turnamen Di Grup B, Rafael Nadal petenis terbaik dunia ini me- nal untuk memperebutkan akhir tahun World Tour yang menjadi unggulan ke- nggunakan sistem round- tiket ke partai puncak. Final, 22-29 November dua juga mendapat saingan robin atau setengah kompe- (m33/ap) nanti di 02 Arena London. berat. Petenis Spanyol ini ga- bung segrup dengan unggu- Berdasarkan hasil undi- lan ketiga Novak Djokovic Hasil undian ATP Tour finals an, Kamis (19/11), Federer (Serbia), unggulan keenam tergabung di Grup A bersa- Nikolay Davydenko (Rusia) Grup A: ma unggulan keempat Andy dan unggulan kedelapan (1) Roger Federer (Swiss) Murray (Inggris), unggulan yang masuk menggantikan (4) Andy Murray (Inggris Raya) kelima Juan Martin del Potro posisi petenis AS Andy Rod- (5) Juan Martin del Potro (Argentina) (Argentina) serta unggulan dick yang mundur, Robin (7) Fernando Verdasco (Spanyol) ketujuh Fernando Verdasco Soderling (Swedia). Grup B: (Spanyol). Di sini, Nadal akan meng- (2) Rafael Nadal (Spanyol) Ini menjadi pertarungan hadapi dua musuh besar- (3) Novak Djokovic (Serbia) yang berat bagi Federer, ter- nya, yaitu Djokovic dan So- (6) Nikolay Davydenko (Rusia) utama ketika bertemu de- derling. Pertemuan dengan (8) Robin Soderling (Swedia) ngan Del Potro dan Murray, Soderling akan menjadi par- karena kedua pemain sering tai balas dendam Nadal, ka- menjadi sandungan bagi Fe- rena petenis Swedia terse- AP derer. Del Potro malah meng- but memupus harapannya Petenis Skotlandia Andy Murray (kiri) mencabut hentikan dominasi Fede- membuat rekor baru juara nama peserta World Tour Final pada undian di 02 rer di AS Terbuka lalu yang lima kali berturut-turut di Arena London, Kamis (19/11). Mercedes GP Kekang Button Wizards Akhiri Mimpi Buruk BRACKLEY, Inggris (Was- nya pada tahun ini. mengenai apa yang bisa dila- WASHINGTON (Waspa- tara tuan rumah Mavericks Hasil lain: pada): Jenson Button (foto) Jenson tidak akan mela- kukan dan tidak bisa dila- da): Cleveland Cavaliers ti- dengan San Antonio Spurs dipastikan tidak akan mela- kukan apapun dengan McLa- kukan oleh Jenson pada saat dak mampu mempertahan- harus diakhiri dengan over- Atlanta Hawks vs Miami Heat 105-90 kukan kegiatan apapun de- ren hingga akhir tahun ini. ini hingga akhir tahun nanti. kan keunggulan hingga 17 time. Pada babak tambahan New York Knicks vs Indiana Pacers 110-103 ngan tim McLaren hingga Dan jika dia melakukan se- Kami berusaha member- poin dari Washington Wiz- waktu, Spurs akhirnya berte- Orlando Magic vs Oklahoma City Thunder 108-94 awal tahun nanti, pasalnya suatu (bersama McLaren) ka- lakukan itu dengan tegas, ards dan harus tumbang kuk lutut 99-94. Philadelphia 76ers vs Charlotte Bobcats 86-84 sang juara masih terikat mi akan melihatnya, ujar imbuh Fry. 108-91 dalam lanjutan kom- Dirk Nowitzki kembali Boston Celtics vs Golden State Warriors 109-95 kontrak dengan tim lamanya. Nick Fry, executive officer Mer- Sebelum Brawn GP mem- petisi NBA, Kamis (19/11). menjadi bintang timnya se- Memphis Grizzlies vs LA Clippers 106-91 Button memiliki kontrak cedes GP Kamis (19/11). , beli tim Honda, Button sebe- Cavs, tampil labil musim kaligus momok bagi lawan Milwaukee Bucks vs New Jersey Nets 99-85 dengan Brawn GP yang seka- , Dia tidak memiliki kewa- narnya telah memiliki kon- ini, sebenarnya menunjuk- Houston Rockets vs Minnesota Twolves 97-84 dengan menoreh 41 poin se- rang berganti nama menjadi jiban apapun pada kami di ta- trak sejak 2008 hingga 2011. kan keperkasaannya pada Utah Jazz vs Toronto Raptors 104-91 Mercedes GP hingga 31 De- hun 2010, tetapi ada beberapa Namun Button memutuskan babak pertama. Mengandal- kaligus gelar top skor. Portland Tblazers vs Detroit Pistons 87-81 sember 2009. Dengan adanya hal yang terkait dengan pro- untuk menandantangani kan LeBron James yang total (m33/ap) kontrak tersebut, tim yang ses kontrak yang saat ini se- kontrak hingga 2009 ketika mencetak 34 poin dan sem- menjadi juara konstruktor itu dang kami lakukan dengan- Brawn GP resmi mengakuisisi bilan assist, Cavs bahkan melarang Button melakukan nya saat ini, lanjutnya. Honda awal musim lalu. unggul hingga 17 poin. AP Di dua kuarter berikut- aktivitas bersama tim baru- Ada batasan yang jelas (m33/ini) nya, Cavs membiarkan Wi- zards bangkit dan memba- McLaren Toreh Sejarah likkan keadaan. Di kuarter ketiga, pertandingan sema- kin menarik kala Wizards berbalik unggul 60-57. Kolaborasi apik antara WOKING, Inggris (Was- balap terbaik di lintasan F1. menjadi juara dunia dengan mobil yang sama, kata pem- Caron Butler dan Andray Blat- pada): F1 musim 2010 belum Kendati demikian, Button mengungguli kompetitor- balap 29 tahun itu. che berhasil membuat Wiz- dimulai, namun McLaren tetap yakin memiliki kesem- kompetitornya di lintasan Sementara itu, Hamilton ards kembali unggul setelah sudah menoreh tinta emas patan untuk menunjukkan balap, termasuk Hamilton. pun menanggapi duetnya berlari 16-2 untuk memba- terkait dengan bergabungnya kemampuan terbaiknya ber- Kami semua berpikir bersama Button secara positif. wa Wizards unggul 95-78. Le- juara dunia Jenson Button ke sama McLaren. akan bersaing dengan yang Kendati kami saling menge- Bron pun tidak mampu ber- tim berjuluk Silver Arrow Bersama tim barunya ini, terbaik dan Anda harus mem- luarkan kemampuan terbaik, buat banyak pada kuarter tersebut, Rabu (18/11) lalu. Button mengaku siap mem- buktikan diri Anda adalah saya yakin kami akan ciptakan keempat dan hanya men-ce- Sejarah itu tercipta seusai berikan yang terbaik dan me- yang terbaik dengan menga- koneksi yang hebat, papar tak enam poin. tim yang bermarkas di Wo- nunjukkan dirinya pantas lahkan mereka menggunakan Hamilton.(m33/kez/vvn) Di Dallas, duel ketat an- king, Inggris tersebut menda- ratkan Button. Sang juara du- nia tahun ini tersebut akan berduet dengan raja musim lalu, Lewis Hamilton. Ini merupakan pertama kali dalam sejarah F1 di ma- na dua peraih gelar juara du- nia dalam dua musim ter- akhir tampil berdampingan. Tim berjuluk Silver Arrow itu juga menjadi tim pertama yang menduetkan pembalap juara dunia asal Inggris dalam kurun waktu lebih dari em- pat dasawarsa terakhir. Sebelumnya hal serupa dilakukan Lotus yang men- duetkan Graham Hill dan Jim Clark pada 1968. Hill adalah juara dunia 1962 dan 1968, sementara Clark mendomi- nasi musim 1963 dan 1965. Saya pikir merupakan hal yang fantastik sebuah tim di- perkuat duet pembalap asal Inggris. Kami akan mengibar- kan bendera dan kebanggaan yang sama. Saya juga berha- rap bahwa kami bisa mem- buat bangga seluruh bangsa dan juga penggemar Voda- fone McLaren-Mercedes di Pasang Iklan seluruh dunia, kata Button, Hub. 4528431 Kamis (19/11). HP. 081370328259 Selain itu, Button meng- utarakan dirinya tidak takut Email bersaing dengan Hamilton iklan_waspada@yahoo.co.id yang dinilai salah satu pem- PEMBERITAHUAN Dengan ini diberitahukan bahwa PT. PERKEBUNAN NUSANTARA III (Persero) Medan, dalam waktu dekat akan melaksanakan Pengembangan Areal Perkebunan Kelapa Sawit seluas 1.500 Ha, dengan Pola Kemitraan Inti - Plasma, di Desa Muara Upu, Kecamatan Muara Batang Toru, Kabupaten Tapanuli Selatan. Batang Toru, 18 Nopember 2009 A/N Direksi PTP - Nusantara III (Persero) Tim Persiapan Perluasan Areal PTPN III Di Kabupaten Tapanuli Selatan ttd. Ir. Rafel Sibagariang Wakil Ketua 6. WASPADA Jumat 20 November 2009 Medan Metropolitan 9 Zikir Dan Doa Attasykir 150 Ekor Lembu Masuk Di Masjid Raya Al-Mahsun RPH Jelang Idul Adha MEDAN (Waspada): Majelis Talim Attasykir Sumatera Utara MEDAN (Waspada): Sebanyak 150 ekor lembu masuk ke kembali menggelar zikir dan doa bersama para jamaah di Masjid Perusahaan Daerah (PD) Rumah Potong Hewan Kota Medan jelang Raya Al-Mahsun Jalan SM Raja Medan, Minggu (22/11) pkl 08.00 Idul Adha sebelum dipotong. Hewan ini sendiri berasal dari Medan sampai selesai. dan luar Kota Medan. Pemimpin zikir dan doa ustadz Drs. H. Azwardin Nasution, 50 ekor dari dalam Medan sendiri, sedangkan sisanya dari Lam- mengatakan kepada Waspada, Kamis (19/11), ini merupakan pung, Stabat dan Asahan. Lembu ini hanya titipan sebelum dibeli agenda rutin bagi Attasykir Sumut yang dibentuk 2 tahun lalu oleh konsumen untuk kurban pada waktu Idul Adha nanti, kata dilakukan setiap minggu ke-4 tiap bulannya akan dihadiri sekitar Humas PD RPH Kota Medan, Andi Sulistiawan, Rabu (18/11). 700-an jamaah Attasykir maupun masyarakat umum. Namun, tambahnya, PD RPH tidak bertanggung jawab untuk Tujuan zikir dan doa bersama untuk membawa masyarakat pemeriksaan kesehatan dan memberikan jaminan hewan itu sehat. Sumut agar dekat dan menghamba kepada Allah SWT sekaligus Begitu juga dengan harga jual hewan. Masalah ini tanggung jawab ikhuwah Islamiyah. Karena dengan berzikir kita senantiasa Dinas Pertanian dan Kelautan Kota Medan dan pemilik hewan mengingat bertaubat kepada Allah diiringi dengan doa sebagai langsung. Kami hanya tempat penitipan saja, masalah kesehatan wujud kehambaan kepada sang Khaliq. dinas terkait yang melakukannya. Demikian juga masalah harga Diimbau kepada masyarakat Sumut berbondong-bondonglah itu antara pemilik hewan dan konsumen langsung bernegoisasi, datang ke Masjid Raya untuk menikmati hidangan hidayah Allah tambahnya. dan mendengarkan tausyiah dengan tujuan membentengi umat Andi memaparkan, untuk jelang Natal nanti, pihaknya akan Islam umumnya dari ajaran-ajaran sesat yang sedang tumbuh menerima 300 ekor lembu dari Australia, sementara kambing bagaikan jamur ditengah-tengah masyarakat. dan babi tidak ada. Lembu tersebut akan tiba di Medan bulan Diharapkan, agar umat Islam tidak terjebak oleh adanya ajaran Desember mendatang. Jelang Natal nanti kami akan menerima yang sangat membahayakan. 300 ekor lembu dari Australia. Kemungkinan akan tiba di Medan Kata Azwardin, majelis talim Attasykir semata-mata sebagai awal Desember. Dan sekali lagi saya tegaskan kami hanya menam- wadah tempat berkumpul bersama saling silaturrahmi mengham- pung untuk dititip, ujarnya. bakan diri sama rata di sisi Allah tanpa membeda-bedakan. Secara terpisah, Kadis Pertanian dan Kelautan Kota Medan, Zikir tetap mendoakan agar kota Medan, Sumatera Utara Wahid mengatakan, pihaknya akan turun ke lapangan seminggu dilindungi Allah dari bahaya musibah dan bencana. Tasbih, zikir sebelum hari Idul Adha untuk melakukan pemeriksaan kesehatan dan doa bersama akan ditutup dengan siraman rohani oleh dai hewan yang dijadikan untuk kurban. Pihaknya melarang kondang Kota Medan, tambah pengurus Majelis Talim Attasykir melakukan penjualan bagi hewan yang dinyatakan tidak sehat. Sumut Hj. Eliza dan Tuti.(m25) Kami akan turun langsung ke pusat penjualan hewan kur- ban dan tempat pemotongan hewan seminggu sebelum Idul Adha. Hal ini untuk memastikan apakah hewan tersebut benar sehat, Diknas Dukung Walikota Waspada/Surya Efendi bila tidak langsung di bawa kembali. Saat ini kami belum bisa pastikan apakah hewan itu sehat atau tidak, paparnya. (h10) Raih Adipura PEMUDA PEDULI LINGKUNGAN: Gubsu Syamsul Arifin didampingi anggota DPD RI Parlindungan Purba, Pj Walikota Medan Rahudman Harahap dan Sekda Dzulmi Eldin menyalami anggota Komunitas Pemuda Peduli Lingkungan (KOPPLING) sebelum MEDAN (Waspada) : Dinas Pendidikan Kota Medan akan men- dukung sepenuhnya upaya Pj Walikota Medan, H Rahudman melantik 2.500 relawan KOPPLING di lapangan Sejati Pangkalan Mansyur, Medan Johor, Kamis (19/11). KOPPLING ini membantu pemko dalam hal kebersihan lingkungan. Operasi Bibir Sumbing MPI Harahap, untuk menjadikan Kota Medan yang bersih sehingga mampu meraih Adipura. Harus Dilandasi Niat Ikhlas Kita menghimbau pihak sekolah melakukan pembersihan MEDAN (Waspada): Ketua Umum Dewan Pimpinan Nasional serta menanamkan budaya hidup bersih dan tanpa sampah di lingkungan sekolah, kata Kadis Pendidikan Medan, Drs Hasan Basri, MM melalui Kabid Dikmenjur, Drs H Marasutan, Selasa (17/11). Syamsul Arifin Masyarakat Pancasila Indonesia (DPN MPI), Meherban Shah meminta semua pihak yang terlibat kegiatan operasi bibir sumbing gratis diprakarsai MPI bekerjasama dengan Operation Rainbow Canada (ORC), AMDA Malaysia dan RS Bunda Thamrin, dilandasi Siap Pimpin Golkar Disebutkannya, upaya yang sedang dilakukan saat ini dengan dengan hati yang ikhlas. memberikan kepercayaan dan tugas kepada para pengawas sekolah Mari kita dilandasi tugas kemanusiaan ini dengan hati ikhlas, untuk melaksanakan pemeriksaan kesekolah-sekolah terkait kata dia, diwakili Ketua Harian DPN MPI, Bachtiar Effendi Siregar kondisi kebersihan lingkungan sekolah. Dengan program ini, sebelum membuka bakti sosial kemanusiaan operasi bibir sumbing diharapkan para pengawas dapat memberikan penilaian dan gratis di Graha MPI Jl. Alfalah Medan, Kamis (19/11). nantinya akan ada reward terhadap sekolah yang paling bersih, MEDAN (Waspada): Gubsu Dukungan itukan dari bawah sebagai calon tunggal. Saya DPD-DPD II Partai Golkar Hadir Konsulat Jenderal Malaysia di Medan Dato Fauzi Umar, belum bersih dan masih jorok. Syamsul Arifin menyatakan diri- bukan dari saya. Itu peluang, belum berpikir ke sana. Apalagi berkeyakinan Syamsul Arifin Konjen RI di Penang Moenir Ari Soenanda, Dewan Pakar MPI Kebersihan lingkungan sekolah salah satu upaya untuk H. Usman, SE, MSi, mewakili Kapoldasu Kombes Pol. Djoko Ismoyo, memasyarakatkan lingkungan bersih. Bagaimanapun, sekolah nya siap untuk maju dan me- kenapa tak maju, katanya. semua kader Golkar bisa maju akan memimpin Golkar Sumut mimpin Golkar Sumut periode Belum terima dukungan untuk memimpin Golkar ke untuk kepentingan partai. Tidak Ketua Tim ORC dr Kimith Ray, Presiden AMDA Malaysia dr. Antony bisa menjadi contoh di lingkungan masyarakat sekaligus menjadi Balavendrian dan lainnya. tempat pembelajaran bagi siswa agar mereka bisa menerapkan 2010-2015 menggantikan Ali Namun demikian, Syamsul depan, ujarnya diplomatis. untuk kepentingan diri sendiri, Umri pada Musda Golkar yang mengakui dirinya belum mene- Walau demikian, kata Syam- kata seorang kader Partai Golkar, Juga hadir jajaran pengurus DPN MPI antaralain, Sekjen Ir di rumah masing-masing, kata Marasutan sembari menyebutkan Asman Lubis, Bendahara Umum Faisal Ritonga, Ketua OKK sedikitnya ada 92 orang pengawas sekolah yang dilibatkan dalam akan diadakan 23-24 Nopember rima dukungan berupa surat sul, pihaknya telah memper- Hardi Mulyono, dihubungi war- sekaligus ketua pelaksana bakti sosial drg. Herman Sadeck, sekretaris program ini. 2009 mendatang. hingga saat ini. Tapi dirinya tetap siapkan dua program ke depan tawan di Medan, Rabu (18/11). panitia, Arif Hardian dan Ketua DPP MPI Sumut, Buchari Barus. Di tempat terpisah, Kepala SMAN 21, Syawaludin mengatakan, Saya siap bila diminta DPD aktif mengemban tugas yang jika terpilih. Kedua progam Hardi mengklaim sampai Bachtiar Effendi mengatakan, operasi bibir sumbing ini kebersihan sekolah itu selalu terjaga dengan menempatkan petugas II untuk maju memimpin Gol- diberikan. Saya belum terima tersebut, mempersiapkan ka- kemarin 29 DPD II menyatakan sehubungan HUT ke-2 MPI, murni dilandasi niat tulus dan ikhlas kebersihan untuk lingkungan sekolah. Demikian juga petugas kar Sumut, ujarnya, Kamis (19/ dukungan hingga sekarang. Jadi der-kader baru yang dapat men- dukungan kepada Syamsul Ari- tanpa memandang perbedaan suku dan agama. khusus membersihkan rumput di kawasan yang luasnya mencapai 11), ketika ditanya wartawan saya tidak bisa buat komentar jalankan amanah partai. Kedua fin yang saat ini Gubernur Su- Gelar Apel Akbar 1 hektare yang mempunyai siswa hanya 477 orang. tentang kesiapannya memim- banyak untuk menyatakan se- dekat dengan rakyat serta be- mut. Yang saya tahu hanya Diperkirakan lebih kurang 15 ribu anggota dan simpatisan Sedangkan Kepala SMAN 7 Medan, Drs M Abduh mengatakan, pin partai berlambang pohon cara pasti, ucapnya. kerja secara maksimal. DPD II Golkar Madina yang be- akan membanjiri Lapangan Benteng Medan, guna mengikuti para guru di sekolah itu selalu memberikan penyuluhan kepada beringin itu. Terkait dirinya bakal terpilih Dukungan DPD lum menyatakan dukungan- apel akbar memperingati hari ulang tahun (HUT) ke-2 Masyarakat siswa untuk menjaga kebersihan kelas. Meskipun ada petugas Syamsul menyebutkan, secara aklamasi, karena dipre- Hampir seluruh DPD II nya, kata mantan anggota Pancasila Indonesia (MPI), Minggu (22/11). bidang kebersihan. (m36) peluang dirinya maju sebagai diksi sebagai calon tunggal. Partai Golkar di Sumatera Utara DPRD Medan ini. Upacara yang akan dimulai pukul 13:00, akan dipimpin Ketua Golkar Sumut harus dari Syamsul Arifin menyebutkan, berpendapat sama akan me- Dikabarkan, Musda Golkar langsung Ketua Umum Dewan Pengurus Nasional (DPN) MPI, Maherban Shah, ujar Ketua Panitia HUT Ke-2 MPI, Ir Alexander PP Medan Tetap Solid DPDII.Jadi,jikaarusbawahmem- percayakannya memimpin Gol- hal itu belum dipikirkannya le- bih jauh. Sebab lanjutnya, du- milih Syamsul Arifin menjadi Ketua DPD I Partai Golkar, men- yang akan dilaksanakan di Hotel Polonia Senin (23/11) dihadiri Tobing, didampingi Sekretaris Panitia Budi Hartoyo, SE.MM dan kar Sumut lima tahun ke depan, kungan secara sah pun belum jelang Musda partai berlam- Ketua Umum DPP Golkar Bendahara OK Fadhil di Medan, Kamis (19/11). MEDAN (Waspada): Sejumlah pengurus pimpinan anak Menurutnya, HUT kali ini juga akan dirangkaikan dengan cabang (PAC) se Kota Medan menyatakan suasana di tubuh amanah itu akan diembannya. diterimanya. Apalagi terpilih bang pohon beringin tersebut. Aburizal Bakri.(m19/m11) pelantikan pengurus DPP MPI Sumatera Utara, Ketua H Bukhari kepengurusan PP Kota Medan tetap solid dan kondusif serta tidak Barus SE MSP Sekretaris Ir H Lilik Ismadi dan pengurus lainnya. , ada permasalahan. Kepengurusan PP Medan tetap solid bahkan kondusif tidak ada permasalahan, jelas Ilyas, salah seorang pengurus PAC PP , Angka Kematian Ibu Melahirkan Pada upacara akan hadir Dewan Pakar MPI Mayjen (Purn) Tri Tamtomo, Wakil Gubernur Sumatera Utara Gatot Pujo Nugroho, Anggota DPR RI, Pangdam, Kapoldasu, Kejatisu, Ketua Pengadilan yang hadir pada acara kumpul-kumpul pengurus PAC di Kecamatan Medan Amplas, Senin (16/11) sore. Dalam acara tersebut hadir pula 14 pengurus PAC PP masing- Indonesia Tertinggi Di ASEAN Negeri Medan dan Muspida. (cat/m40) masing dari PAC Medan Baru, Medan Timur, Medan Labuhan, Medan Marelan, Medan Selayang, PAC Khusus Mandala dan MEDAN (Waspada): Angka nisasi Kesehatan Dunia (WHO) membantu memberi pencera- Sitompul mengharapkan me- Simalingkar, Medan Tembung, Medan Deli, Medan Polonia, Medan kematian ibu melahirkan di In- yang tertuang dalam Millenium han bagi kalangan bidan seba- lalui diskusi serta pemahaman Denai, Medan Petisah. donesia masih sangat tinggi Development Goal (MDG) gai orang paling depan mem- yang diberikan bisa membantu Ilyas menyebutkan, pasca dinonaktifkannya Rudi Hartawan bahkan tertinggi di wilayah tahun 2015, Indonesia harus bantu proses persalinan ibu para bidan baik dalam kota mau- Tampubolon dari kepengurusan PP Kota Medan dan digantikan ASEAN, kata Ketua Ikatan Dok- mampu menurunkan tingkat melahirkan. pun di daerah terpencil lebih oleh pejabat sementaranya ada isu yang menyebutkan ter Indonesia (IDI) Wilayah Su- kematian ibu melahirkan 50 Henry yang juga menangani cepat dalam memberi perawa- ketidakondusifan dalam tubuh kepengurusan PP Kota Medan. matera Utara, dr. Henry Salim persen dari angka tersebut yakni Kebidanan dan Kandungan di tan terhadap ibu melahirkan. Setelah kami memonitor ternyata isu miring tersebut tidak benar. Siregar, SpOG saat memberi menjadi 140/100 ribu. Tentu- Klinik Spesialis Bunda ini men- Disebutkannya, kegiatan PP Medan tetap solid, tegasnya. (cat) pembekalan terhadap 75 bidan nya ini menjadi tugas berat bagi jelaskan, kematian ibu mela- pembekalan terhadap para se-Kota Medan di Klinik Spesia- kita semua terutama kalangan hirkan biasanya disebabkan bidan ini diharapkan bisa dila- Pemerintah Agar Perhatikan lis Bunda (KSB), Rabu (18/11). berkecimpung dalam bidang pendarahan, infeksi, kejang- kukan secara berkala sebagai Saat ini, kata Henry, angka kesehatan, tambah Henry. kejang serta terlambat dibawa bentuk kepedulian sosial pihak- Nasib Guru Swasta kematian ibu melahirkan secara Upaya untuk menekan ting- ke rumah sakit. Dengan adanya nya dalam membantu program Waspada/ist nasional 240/100 ribu, bahkan le- kat kematian ibu melahirkan ini, sistem rujukan, maka harapan pemerintah, terutama menekan Ketua Operation Rainbow Canada (ORC), dr. Kimith Ray MEDAN (Waspada): Pemerintah daerah ataupun pusat agar bih tinggi dari Vietnam. Hal ini dengan cara melakukan pelati- WHO bisa tercapai 2015. sedini mungkin tingkat kema- memprioritaskan pemberian dana tunjungan kepada para guru didampingi dokter melakukan observe terhadap pasien penderita swasta, karena guru yang berstatus pengawai negeri sudah tentu sangat mengkhawatirkan. han seperti dilakukan Klinik Sementara itu, Direktur RS tian ibu melahirkan seperti bibir sumbing sebelum pelaksanaan operasi dilaksanakan tim mendapatkan gaji tetap dan tunjangan jabatan dari pemerintah. Berdasarkan program Orga- Spesialis Bunda yang sangat Permata Bunda dr. H Syaiful M. diprogramkan WHO.(m26) dokter dari Indonesia di RS Bunda Thamrin Jl. Sei Batanghari. Kebijakan tidak adil apabila guru negeri masih turut mendapatkan tunjungan jabatan melalui sertifikasi guru, kata Bahdin Nur Tanjung pada acara pelantikan pengurus baru Badan Musyawarah Perguruan Swasta (BMPS) Sumut periode 2009-2014 pekan lalu di Hotel Madani Jalan SM.Raja Medan. Tanjung mantan Ketua BMPS Sumut dalam sambutannya mempertanyakan untuk apa lagi guru yang menjadi pegawai negeri diikutkan dalam jalur sertifikasi profesi karena sewaktu masuk pegawai negeri sudah mengikuti berbagai tes dan seleksi, hingga akhirnya mereka diangkat menjadi pegawai yang digaji pemerintah. Lain dengan para guru swasta, ujarnya, masuk menjadi guru di suatu sekolah swasta yang umumnya menerima minim dari kebutuhan hidup layak seorang guru. Sementara itu, Ketua Umum Forum Peduli Pendidikan Indo- nesia, Abdurrahman, secara terpisah mengakui kekurangan guru akan bisa teratasi apabila anggaran pendidikan 20 persen dari APBD dan APBN bisa dialokasikan lebih besar untuk kesejahteraan guru. BMPS Sumut periode 2009-2014 diketuai Ahmad Hosen Hutagalung dilantik oleh Ketua BMPS Pusat A.Fathoni Rodli. (m23) Christmas Season Memupuk Kerukunan Umat Beragama MEDAN (Waspada) : Pagelaran Christmas Season diharapkan tidak hanya menjadi even pariwisata tahunan melainkan sebagai pemupuk kerukunan umat beragama di kota Medan. Even Organizer Christmas Season, PT Fara Mutiara, Binsar Marbun, di Medan, Kamis (19/11) menyatakan, kegiatan tahunan baik umat muslim dengan Ramadhan Fairnya, kristiani dengan Christmas Season, dan umat-umat lainnya merupakan kegiatan untuk pemupuk kerukunan umat beragama. Dengan rukunnya umat beragama ini akan melahirkan kota Medan yang modernis dan religi. Hal ini tidak hanya mengembang- kan bentuk solidaritas sesama umat melainkan akan mengundang wisman manca negara, ujarnya. Meski saat ini tidak ada target menggaet wisman, lanjutnya, namun kedepannya hal ini akan menjadi lirikan wisman sebagai even-even tahunan yang dapat menjadi arena hiburan, promosi, religi, dan pengembangan diri pelajar. Dalam pembukaan Christmas Season di Perguruan Immanuel, Rabu (18/11), Pj Walikota Medan, H Rahudman Harahap, mengha- rapkan seluruh kegiatan Christmas Season 2009 bisa menambah semaraknya perayaan Natal & Tahun Baru bagi seluruh umat Kristiani di Sumut khususnya di Medan. Ketua Panitia, Maju Siregar didampingi Suwandi Purba sebagai pengarah mengatakan, berbagai kegiatan dalam Christmas Season dilaksanakan mulai Rabu 18 November hingga Sabtu 5 Desember 2009. Di antaranya, lomba menggambar tingkat SD, fashion show tingkat SD di Perguruan Kristen Immanuel, lomba karaoke Tingkat SD dan SMP di Radio Narwastu, festival band tingkat SLTA di Gereja Methodis Indonesia, Lomba Kotbah di Radio Narwastu, festival vocal grup di GKPI Sei Agul Medan hingga festival paduan suara kaum muda, paduan suara ibu dan bapak dilaksanakan di Pardede Hall. (m38) 7. 10 Medan Metropolitan WASPADA Jumat 20 November 2009 Pro Kontra Pemutaran Film 2012 MUI Sumut Silakan Tonton MEDAN (Waspada): Majelis Ulama Indonesia nuangkan dalam kisah yang Al Quran, kiamat sebenarnya lam kaitan ini, banyak cara yang difilmkan. Itukan hasil karya. tidak seperti yang di gambarkan dilakukan mereka termasuk Sumatera Utara tidak terlalu mempersoalkan Nasution menjelaskan, pas- dalam film tersebut. Kiamat salah satunya adalah melalui umat Islam untuk menyaksikan Film 2012, tikan akidah kita tidak berubah yang sebenarnya tidak dapat tayangan film baik di layar lebar sepanjang tontonan itu diyakini tidak merubah karena hari kiamat adalah raha- dibayangkan atau dihayalkan, maupun layar kaca. Para orang sia Allah, tidak bisa dicampuri karena hal itu merupakan ke- tua, harus mencermati semua akidah. oleh manusia. hendak Allah yang tidak terukur ini dengan tidak melepas anak- Janganlah takut berlebihan Platt, dan Woody Harelson. Sementara itu, Matlaul dan tak bisa diukur. anak menton film-film yang dalam diri seorang muslim Sementara itu, Ewin, 34, Anwar Sumut dengan tegas Justru, katanya, jika kiamat bisa mengikis rasa keimanan menolak pemutaran Film 2012 itu digambarkan seperti dalam kepada Allah Swt. akibat tontonan film tersebut, warga Kecamatan Medan Johor, di daerah ini, karena akan lebih film tersebut, hal itu cenderung Kiblat ke barat kata Sekretaris Umum MUI yang telah menonton film itu, banyak mudaratnya daripada akan merusak nilai-nilai keyaki- Siregar mengkhawatirkan, Sumut, Hasan Bakti Nasution, mengakui pengelolaan film kali manfaatnya. nan akan kehendak (qadha) pemutaran Film 2012 itu bisa kemarin, menanggapi muncul- ini luar biasa dari sudut penge- Pemprovsu dan masyara- dan kuasa (qadar) dari Allah mempengaruhi kiblat umat nya film bertema hari kiamat masan teknologinya. Menurut- kat harus menolak pemutaran Swt. Islam dari Timur ke Barat. tersebut. Film ini menyuguhkan nya, karena film itu mengemas Film 2012 itu di Sumut tanpa Jadi, tidak ada sedikit pun Artinya, umat tidak lagi percaya dahsyatnya kiamat pada 12 audio visual yang cukup baik, kecuali, kata Ketua Matlaul yang dapat atau bisa menjadi kepada ajaran agamanya ke- Desember 2012. Dikisahkan, bukan tidak mungkin dapat Anwar Sumut Ansor Siregar di pelajaran bagi umat Islam dari cuali kepada teknologi ciptaan warga dunia panik saat ramalan merubah cara pandang dan ke- Medan, Rabu (18/11), setelah apa yang ditayangkan dalam Barat. suku Indian Maya Inca Peru ten- percayaan kita terhadap kiamat, mencermati pemikiran masya- film tersebut, bahkan sebalik- Jika hal ini dibiarkan, pada rakat terhadap film tersebut. nya bisa menjadi murka kepada gilirannya Barat akan menjadi Waspada/Ist tang kiamat menjadi kenyataan. jika ilmu agama si penonton Patung Kristus Sang Penebus tipis. Mengikis akidah Allah Swt, ujarnya. kiblat umat. Persoalan kiamat, Kegiatan Ketertiban dan Kelancaran Lalu Lintas (Kamseltibcar Lantas) dalam bentuk kegiatan yang berdiri kokoh di Rio de Ja- Lebih lanjut menurut Na- Menurut Siregar, banyak Siregar melihat ada sesuatu lanjutnya, tidak ada siapapun Safety Riding Course, Taman Lalu Lintas Anak dan Simulator tertib lalu lintas, yang akan di adakan neiro, Brasil, hancur berkeping- sution, film itu hanyalah karya kekhawatiran yang akan mucul yang tersirat terhadap kehadir- yang tahun, karena itu adalah dalam even Honda Fiesta di Lapangan Merdeka Medan. keping. Hujan meteor berbola fiksi. Tidak jauh beda degan film jika film itu di putar, antara lain, an film itu terutama bagi umat merupakan ilmu Allah Swt. api disusul gempa menggun- berjudul The Day After To- akan terjadi pergeseran nilai Islam. Bahwa, musuh Islam saat Namun, sebagai orang ber- cang hebat. Yang tak kalah menggetarkan, basilika Gereja morrow dan Knowing yang menceritakan kehancuran keyakinan umat khususnya Islam tentang hari kiamat. Bahwa pada hakikatnya sebagai ini sedang merancang bagai- mana agar akidah umat Islam bisa terkikis terhadap keyaki- iman harus percaya tentang hari kiamat, karena itu masuk dalam rukun iman. (m14/ Kapoltabes Gelar Santo Petrus diVatikan, runtuh. Pantauan Waspada terha- dap sekilas film 2012, penonton dunia suatu hari. Nasution mengatakan, dari resensinya, isu kiamat 2012 mana yang dijelas Allah dalam nannya kepada Allah Swt. Da- m36/m15) Safety Riding Di Honda Fiesta banyak yang terpana menyak- sikan kapal perang USS John F Kennedy yang tidak berdaya terkait dengan ramalan suku Maya yang digambarkan dalam salah tahun penanggalan kuno- Pemko Berlakukan Retribusi Ikan MEDAN (Waspada): Kapol- tabes MS Kombes Pol Imam (polisi sayang anak) diarena ta- man lalu lintas anak. Dalam ke- yang cukup baik dari Poltabes MS. Honda secara konsisten diamuk badai dan akhirnya ka- nya yang menyatakan jika abad Margono akan menggelar safety sempatan ini CV. IndakoTrading dan berkesinambungan mem- BELAWAN (Waspada): Per- tentang Perikanan dan Kepmen menarik retribusi ikan dan kita ram. Dalam film beranggaran 21, tepatnya Desember 2012 da Kota Medan No 19 tahun Pertanian No 392/ Kpts/ Ik. 120/ sudah siapkan Perdanya, kata riding (bermotor secara aman) Co juga akan memberikan ban- perhatikan hal-hal yang 200 juta dolar ini, sutradara akan terjadi pergantian abad 2002 tentang retribusi tempat 4/ 99 tentang jalur-jalur penang- B Daulai. di acara Honda Fiesta diadakan tuan operasional 100 buah jas berkenaan dengan keselamatan Roland Emmerich memasang yang ditandai dengan pember- pelelangan ikan akan diterap- kapan ikan oleh staf TNI AL Menanggapi hal itu, M Na- CV. Indako Trading Co selaku hujan kepada jajaran kepolisian berkendara. PT. Astra Honda sejumlah nama yang tak asing sihan bumi. Mungkin inilah kan Dinas Pertanian dan Kelau- Belawan dan KaBP3 Belawan. sir, anggota Komisi B DPRDSU main dealer Honda di Sumatera lalu lintas Poltabes MS. Motor (AHM) menunjukkan lagi, yakni Danny Glover, John yang membuat sang sutradara tan Kota Medan, mulai tahun Dikatakan Wahid, selama mendukung apa yang telah di- Utara pada tanggal 21-22 Selain memberikan duku- keseriusannya dengan me- Cusack, Amanda Peet, Oliver tertarik membuat fiksi dan me- 2010 karena telah lama tertunda. ini perda yang bisa menghasil- siapkan Pemko dalam melaksa- November 2009 di Lapangan ngan dalam hal pengamanan nyiapkan departemen khusus Hal itu dikatakan Kadis Per- kan uang sekitar Rp1 milyar nakan Perda dimaksud. Itu Merdeka Medan. acara, Kapoltabes MS akan ikut safety riding yang selalu rutin tanian dan Kelautan Kota Me- pertahun itu tidak terlaksana sangat baik dan akan kita bahas Kegiatan Honda Fiesta ini serta dalam seremoni pelepa- melakukan kampanye cara DKM Gelar Lomba Baca dan,Wahid, didampingi Kasub- dis Bina Usaha Perikanan, B. karena masih terhalang oleh yang di atasnya yakni Perda No dalam rapat pada Desember yang akan datang, katanya. dimanfaatkan sebagai wujud san merpati sebagai simbol berkendara yng baik dan benar Puisi Tingkat SMA Daulay, seusai pembukaan so- sialisasi UU dan peraturan 7 tahun 1999 yang mengatur hal sejenis. Karena itu kami sangat Menurut Nasir, pembangu- nan seluruh dermaga pelabu- kepedulian sosial Honda untuk memberikan kesadaran kepada dibukanya acara Honda Fiesta, dan akan melepas langsung pada masyarakat. Acara ini merupakan MEDAN (Waspada): Dewan Kesenian Medan (DKM) mengge- perikanan di BP3 Belawan, Kel. berharap agar ada peninjauan han perikanan dan fasilitasnya masyarakat akan pentingnya parade 25 juta Inspirasi Safety perayaan pencapaian 25 juta lar lomba baca puisi karya penyair Medan untuk tingkat siswa Nelayan Indah, Kec. Medan ulang atas Perda itu, katanya. menggunakan dana APBD dan menjaga Keamanan, Keselama- Riding Honda yang diikuti oleh produksi Honda dan bentuk SMA sederajat. Lomba yang merupakan rangkaian even Medan Labuhan. Sejak disahkan Perda Pem- APBN. Untuk itu pemerintah tan, Ketetiban dan Kelancaran pengguna Honda dan 15 klub terima kasih Honda pada Art Festival yang berlangsung 28-29 November mendatang, di Acara sosialisasi akan ber- provsu itu, hanya satu kali ter- daerahharusbisamendapatdana Lalu Lintas (Kamseltibcar Lan- motor Honda. konsumennya dan masyarakat Auditorium RRI Medan. langsung selama 4 hari itu laksana yakni tahun 2000. ketika untuk biaya perawatan sarana tas) dalam bentuk kegiatan Kami akan selalu mendu- yang selama ini memberi Ketua Umum DKM, Hj Anita Ch Daryatmo, didampingi Koor- diikuti 40 orang nelayan asal periode Kepala DPK Sumut Alm dan prasana tersebut. Jika me- Safety Riding Course,Taman lalu kung sepenuhnya upaya Honda kepercayaan dan menjadikan dinator Komite Sastra, Eddy Siswanto, kepada wartawan di Taman Kecamatan Medan Belawan, Ridwan Batubara. Namun, sejak mang Perda Pemprovsu itu tidak Budaya Sumatera Utara, kemarin mengatakan, puisi sebagai salah lintas anak dan Simulator tertib menyosialisasikansafety riding Honda motor pilihannya, Medan Labuhan dan Medan itu Perda tersebut tidak berjalan bisa dilaksanakan maka akan satu karya sastra masih harus secara terus menerus diperkenalkan Marelan. Beberapa materi akan hingga sekarang. Jika Perda itu kita usulkan untuk dicabut, ujar lalu lintas. untuk menciptakan Kamseltib- ujarnya. kepada masyarakat pencintanya agar dipahami dan dicintai. dipaparkan kepada peserta di dicabut maka seluruh kabupa- anggota DPRD asal Kecamatan Dalam gelaran safety riding, car kepada masyarakat, karena Leo Wijaya menambahkan Banyak cara yang dapat digunakan untuk itu, salah satunya antaranya UU No 31 tahun 2004 ten/kota di Sumut akan bisa Medan Labuhan itu. (cre) Kapoltabes MS akan menyedia- mengingat peningkatan jumlah Honda Fiesta akan diisi dengan adalah melalui lomba. Dan tujuan menggelar lomba ini untuk kan mobil pelayanan SIM kendaraan memberi pengaruh beragam acara menarik antara memperkenalkan puisi karya penyair Medan kepada masyarakat. keliling, dua unit Patwal untuk pada tingginya angka kecelaka- lain , Galeri Inspirasi, Service Seluruh puisi itu bertemakan Medan sebagai sebuah kota yang terus berbenah dengan segala kekurangan dan kelebihannya, ujarnya. Gubsu Jamin Tak Ada KKN kegiatan sosialisasi safety riding dengan tema 25 Juta Inspirasi an lalu lintas, kata Kapoltabes. Arifin Posmadi, General Gratis, Fiesta Competition, dan hiburan paling spektakuler dari Anita menyebutkan, pihaknya sengaja meminta kepada 14 penyair Medan untuk menyumbangkan puisinya agar dijadikan bahan lomba ini. Para penyair itu adalah A Rahim Qahhar, Afrion, Dalam Penerimaan CPNS Safety Riding Honda bersama Satlantas Poltabes MS , dan menghadirkan petugas Polsana Manager CV. Indako Trading Co, mengungkapkan terima kasih atas dukungan dan kerjasama band papan atas tanah air, Nidji, dan aneka ragam permainan gratis. (adv) Damiri Mahmud, Hasan Al Banna, Harta Pinem, Hidayat Banjar, Idris Pasaribu, Intan HS, M.Raudah Jambak, M.Yunus Rangkuti, MEDAN (Waspada): Gubsu permainan atau KKN dalam Johny mengaku, kebijakan Nurhilmi Daulay, S.Ratman Suras, Teja Purnama Lubis dan YS Rat. Koordinator Komite Sastra DKM, Eddy Siswanto menambah- kan, pemenang lomba selain mendapat piagam penghargaan H Syamsul Arifin, SE mengi- ngatkan agar setiap pelamar CPNS tidak terpengaruh deng- penerimaan CPNS termasuk oleh pejabat di Pemprovsu. Saya jamin ini dapat dipertanggung- itu diberlakukan karena ba- nyaknya alamat pelamar yang kurang jelas, sehingga petugas IAINSU Sebagai Pusat juga menerima hadiah uang tunai. Juara I masing-masing putra- putri mendapat Rp750 ribu, Juara II Rp500 ribu, dan Juara III Rp300 ribu. Sedangkan Juara Harapan I, II, III masing-masing Rp200 ribu. an iming-iming calo yang ka- tanya mampu mengurus dan meluluskan seseorang diterima jawabkan dengan cara transpa- ran, ujar Gubsu seraya menye- butkan tidak ada yang akan pos mengalami kesulitan me- ngantarkan nomor ujian. Jadi kami buat alternatif, yakni pela- Pengkajian Ilmu Keislaman Dia menjelaskan, calon peserta yang ingin mengikuti lomba menjadi CPNS khususnya di ditutupi. mar boleh datang langsung ke- itu dapat mendaftar di Wisma Kartini Jalan T Cik Ditiro Medan, Pemprovsu. Nomor ujian bagian antaran Kantor Pos Be- MEDAN (Waspada): Seba- yeksikan diri menjadi muara teraan di dunia hingga kesejah- dan Taman Budaya Sumatera Utara. Setiap pendaftaran tidak gai sebuah lembaga pendidikan dari setiap kebaikan, kebenaran, teraan di akhirat kelak, ujar Jangan mau dipengaruhi Sementara itu sebelumnya sar Medan, ucapnya lagi. akan dikenai biaya, bahkan mendapat satu buku yang kumpulan tinggi Islam yang sudah berusia keistimewaan dan kesem- Prof. Fadhil. oleh calo-calo itu. Tidak akan dijelaskan, pelamar Calon Pega- Menurut Johny, dari 51.189 36 tahun, IAIN Sumatera Utara purnaan. 522 Lulusan puisi empat belas penyair Medan. terjadi pencaloan bila masyara- wai Negeri Sipil (CPNS) luar dae- jumlah berkas lamaran yang su- Dalam lomba ini, kita menggunakan sistem penyisihan dan telah mencanangkan visi men- Tentunya, visi tersebut ha- diwisuda kat tidak mau dipengaruhi. rah, seperti Tanah Karo, Tebing dah diantar pihaknya, sebanyak jadi center of excellence bagi nya dapat dicapai melalui jihad Sementara itu, dalam acara final. Untuk finalis pemilihan puisi dilakukan dengan cara undian, Jangan percaya sama mereka, Tinggi, Mandailing Natal (Madi- 11.441 di antaranya merupakan tambah Eddy seraya mengimbau para pelajar Medan segera pengkajian ilmu-ilmu keisla- ilmiyah, ijtihad ilmiyah dan wisuda sarjana ke-51, IAINSU ujar Gubsu, Kamis (19/11), na) dan daerah lainnya bisa lamaran untuk luar daerah. Dari man yang ditujukan bagi kese- mujahadah ilmiyah secara ber- mewisuda 522 orang lulusan mendaftar karena memang peserta dibatasi. (h10) kertika ditanya isu marakmya mencek nomor ujiannya di total jumlah berkas lamaran itu, jahteraan umat manusia. sama-sama oleh seluruh civitas yang terdiri atas 52 orang dari percaloan masuk CPNS itu. Kantor Pos Besar Medan. Keten- sebanyak 15.000 lebih nomor Sebagai perguruan tinggi akademika IAIN SU, melalui Program Pascasarjana, 45 orang Jadwal Penerbangan Di Bandara Polonia Untuk menghempang akti- tuan itu berlaku, bila pelamar ujian sudah diantar ke alamat Islam, IAINSU memproyeksi- sebuah proses panjang yang ha- dari Fakultas Dakwah, 120 orang vitas percaloan itu, kata Gubsu, luar daerah itu belum meneri- para pelamar. kan diri sebagai tempat pengka- rus dijalani dengan penuh se- dari Fakultas Syariah, 268 orang No. Penerbangan Ke Flight Pukul Tiba Dari Fliht Pukul pihaknya juga akan melakukan ma nomor ujian. Di tempat terpisah, Kepala jian ilmu-ilmu keislaman dalam mangat, ulet, pantang menye- dari Fakultas Tarbiyah dan 37 GARUDA INDONESIA berbagai upaya termasuk so- Human Capital Supervisor Badan Kepegawaian Daerah pemaknaannyayangpalingluas, rah dan dilandasi kesetiaan orang wisudawan dari Fakultas 1 Jakarta GA-181 06.25 Jakarta GA-180 06.10 sialisasi melalui media. Kantor Pos Besar Medan, Johny (BKD) Sumut, Arsyad Lubis kata Rektor IAINSU, Prof. Dr. kepada cita-cita, katanya. Ushuluddin. 2 Jakarta GA-183 09.05 Jakarta GA-182 08.00 Gubsu juga menjamin, di Silalahi, Kamis (19/11) menje- menjelaskan, Pemprovsu sudah Nur Ahmad Fadhil Lubis, MA Dijelaskannya, IAINSU ada- Para wisudawan-wisuda- 3 Jakarta GA-185 10.55 Jakarta GA-184 09:30 Pemprovsu tidak akan ada per- laskan, kebijakan menerbitkan menyurvei beberapa tempat dalam acara Dies Natalis Ke-36 lah sebuah lembaga akademis wati tersebut semuanya telah 4 Jakarta GA-187 12.25 Jakarta GA-186 10.50 mainan atau KKN dalam pene- nomor ujian bagi pelamar luar yang dinilai memadai, yakniYa- danWisuda Sarjana Ke-51 IAIN- dengan visi kemanusiaan yang menjalani proses pendidikan 5 Jakarta GA-189 13.45 Jakarta GA-148 11.50 rimaan CPNS. Ini dapat diper- daerah itu guna memudahkan yasan Perguruan Sinar Husni,Ya- SU di gedung Aula kampus ter- universal, bukan lembaga pen- dan pelatihan, sehingga memi- 6 Jakarta GA-191 15.45 Jakarta GA-188 12.50 7 Jakarta GA-193 17.10 Jakarta GA-190 14.10 tanggungjawabkan. registrasi nomor ujian CPNS yasan Perguruan Panca Budi, sebut Jl.Willem Iskandar Medan didikan yang mengusung visi liki keahlian dalam berbagai 8 Jakarta GA-147 18.10 Jakarta GA-192 16.15 Saya jamin tidak akan ada formasi 2009 di Sumut. USU, Unimed dan IAIN. (m19) Estate, Kamis (19/11). primordial dan sektarian. Peng- bidang kajian. Mereka adalah 9 Jakarta GA-195 19.10 Jakarta GA-196 19.35 Prof. Fadhil menyebutkan, kajian ilmu-ilmu keislaman di kelompok generasi muda yang 10 Jakarta AIR ASIA GA-146 14.45 Jakarta GA-147 16.30 Zulkarnain Lubis Dikukuhkan peringatan Dies Natalis atau hari jadi IAIN SU dilaksanakan setiap tahun pada 19 Nopem- kampus tersebut ditujukan bagi kesejahteraan umat manusia atau rahmatan lil alamin. siap mendarmakan keahlian- nya masing-masing bagi per- baikan kualitas masyarakat, 1 Kuala Lumpur AK- 937 08.50 Kuala Lumpur AK-936 08.25 2 Kuala Lumpur 3 Kuala Lumpur 4 Kuala Lumpur QZ- 8054 AK- 457 AK-939 09.40 18.00 20.10 Kuala Lumpur Kuala Lumpur Kuala Lumpur QZ-8055 AK-456 AK-938 11.55 17.40 19.40 Guru Besar Tetap UMA ber, sebab pada tanggal tersebut 36 tahun lalu, persisnya pada tahun 1973, para pemuka aga- Watak ilmiah dari kajian keislaman di IAIN, lanjutnya, diarahkan untuk mendukung ujar Prof. Fadhil. Di usianya yang ke-36 tahun ini, IAINSU telah melahirkan 5 Penang QZ-8074 16.05 Penang QZ-8075 18.05 MEDAN (Waspada): Prof. Dikatakannya, UMA memi- Pada kesempatan itu, Koor- ma dan tokoh-tokoh masyara- posisinya sebagai wadah men- sarjana mencapai 30.031 orang. 6 Jakarta QZ-7497 12.20 Jakarta QZ-7496 19.15 Ir Zulkarnain Lubis MS PhD, liki tenaga pengajar sebanyak dinator Kopertis Wilayah I Su- kat di Sumatera Utara memu- diskusikan aneka persoalan Sebagian besar dari mereka te- 7 Jakarta QZ-7503 13.30 Jakarta QZ-7502 13.05 dikukuhkan sebagai guru besar 400 orang dengan latar bela- mut-NAD mengatakan, saat ini tuskan untuk mengambil satu keagamaan secara matang dan lah menyebar di segenap penju- 8 Jakarta QZ-7505 18.40 Jakarta QZ-7504 15.40 tetap Universitas Medan Area kang pendidikan yang berbeda- Sumut-NAD masih memiliki langkah strategis mendirikan damai untuk menghasilkan ru Sumatera Utara, bahkan In- MANDALA AIRLINES (UMA)setelahdilakukanpengisti- beda. UMA memiliki tenaga kualitas dosen yang belum me- satu perguruan tinggi bagi solusi yang paling konstruktif donesia. Mengabdikan ilmunya 1 Padang RI 089 17.20 Padang RI-088 15.45 haran dirinya, di Kampus II Jl. pengajar guru besar yang cukup madai yakni 40 persen dosen pengkajian dan pengembangan bagi umat. kepada masyarakat luas melalui Sei Serayu Medan, Kamis (19/11). banyak dari Kopertis maupun yang masih S-1 dan sisanya ilmu-ilmu keislaman. Ilmu-ilmu yang dikem- berbagai jalur, baik sebagai LION AIR Hal ini mengangkat akredi- perguruan tinggi negeri lainnya. terdapat pada kategori S-2 dan Dengan visi menjadi center bangkan di IAINSU ditujukan pegawai pemerintahan, guru 1 Jakarta JT- 381 06.30 Jakarta JT-380 08.20 bilitas UMA selaku salah satu Tetapi yang menjadi guru besar S-3 dan guru besar atau pro- of excellence, lanjutnya, IAIN SU bagi peningkatan kualitas kehi- di sekolah-sekolah, pedagang, 2 Jakarta JT- 397 09.00 Jakarta JT-398 09.20 perguruan tinggi swasta di Me- tetap UMA saat ini sudah ada fesor. Jumlah profesor masih akan terus mengupayakan dan dupan manusia, baik kesejah- politisi, pemimpin informal 3 Jakarta JT- 301 10.00 Jakarta JT-394 10.20 dan dan merupakan salah satu lima orang, sebutnya. sangat sedikit dan Kopertis 4 Jakarta JT- 395 11.00 Jakarta JT-302 11.20 merealisasikan di masa-masa teraan lahiriyah maupun kese- berpengaruh di masyarakat dan perguruan tinggi yang berka- Prof.Yakub Matondang me- sangat mendorong dosen S-1 mendatang dengan mempro- jahteraan batiniyah, kesejah- sebagainya. (m41) 5 Jakarta JT- 303 12.00 Jakarta JT-398 10.45 tegori baik. nyebutkan, dalam konteks untuk melanjutkan studinya 6 Jakarta JT- 399 13.45 Jakarta JT-382 13.05 7 Jakarta JT- 383 15.35 Jakarta JT-384 14.55 Rektor UMA, Prof. Dr.Yakub pembelajaran ideal, universitas agar memenuhi kriteria menja- 8 Jakarta 16.25s 9 Jakarta JT- 385 JT- 387 17.05 18.35 Jakarta Jakarta JT-396 JT-306 19.35 Matondang mengatakan, guru besar diangkat oleh Menteri Pen- didikan, berbeda dengan nega- atau perguruan tinggi harus memiliki 20 persen tenaga pe- ngajar yang berlatar belakang di seorang dosen, katanya. Sementara itu, Prof. Zulkar- nain Lubis dalam orasi Ilmiah- 780 Ribu Sarjana Menganggur 10 Jakarta 11 Jakarta JT- 305 JT-309 21.15 22.25 Jakarta Jakarta JT-386 JT-308 21.35 23.20 ra lain yang diangkat oleh rek- tornya sendiri. Dengan ditetap- pendidikan profesor atau guru besar tetap. UMA seharusnya nya yang berjudul Peranan Koperasi Dalam Pemberdayaan UMSU Lepas 1.106 Lulusan 12 Batam/S.baya JT-972 12.55 Batam/S.baya JT-971 12.20 kannya Prof. Zulkarnain Lubis mempunyai 80 orang guru Ekonomi Rakyat Melalui Pe- 13 Banda Aceh JT-396 19.35 Banda Aceh JT-397 08.20 sebagai guru besar tetap UMA, besar tetap. Hal ini akan segera nyaluran Kredit Mikro me- MEDAN (Waspada): Hati UMSU, rektor, senat dan civitas Kepala Humas UMSU 14 Penang JT-8288 09.10 Penang JT- 8289 11.35 nurani telah banyak hilang dari akademika UMSU, Koordinator Anwar Bakti mengatakan, 15 Penang JT-8286 12.30 Penang JT-8287 15.00 diharapkan ini menjadi salah terwujud karena saat ini banyak nyebutkan, ada empat yang satu acuan untuk mengangkat dosen yang melanjutkan pendi- menjadi fokus utama dalam bangsa ini, banyak orang benar KopertisWilayah I Sumut-NAD, sebanyak 1.106 lulusan UMSU MALAYSIA akredibilitas UMA. dikannya, terangnya. perberdayaan ekonomi rakyat disalahkan dan sebaliknya pengurus APTISI Wilayah IA yang diwisuda pada periode II 1 Kuala Lumpur MH-861 09.05 Kuala Lumpur MH-860 08.25 yakni peningkatan sumber banyak orang salah dibenarkan. Sumut, pimpinan Bank Syariah tahun 2009 ini, terdiri dari 2 Kuala Lumpur MH-865 15.25 Kuala Lumpur MH-864 14.45 daya manusia, peningkatan Muhammadiyah melalui ins- Mandiri cabang Medan. lulusan Program Pascasana (S2) ketersediaan modal kerja, pe- titusi Pendidikan Tingginya Din mengatakan, era globa- Magister Ilmu Hukum 59 orang. SILK AIR ningkatan akses ke pasar dan bertekad menciptakan kaum lisasi merupakan arena kompe- Sedangkan jenjang S1, yakni 1 Singapura MI-233 08.40 Singapura MI-232 07.50 peningkatan ketersedian sa- 2 Singapura MI-237 20.35 Singapura MI-238 19.50 intelektual yang memiliki SDM tisi antar bangsa, dimana setiap Fakultas Agama Islam 21 orang, rana produksi. berkualitas dan bisa bekerja bangsa dituntut memiliki SDM Fakultas Keguruan dan Ilmu VALUAIR Jika ini digabungkan maka dengan hati nurani sehingga berkualitas agar punya daya Pendidikan 432 orang, Fakultas 1 Singapura (4,7) VF-582 08.30 Singapura (4.7) VF-581 07.50 ekonomi masyarakat lapisan mampu melakukan perubahan saing yang tinggi. Bangsa yang Ilmu Sosial dan Ilmu Politik 48 2 Singapura (1,3,6) VF-584 20.45 Singapura (1,3,6) VF-583 20.00 bawah akan meningkat, ujar ke arah lebih baik di tengah- tidak memiliki daya saing akan orang, Fakultas Pertanian 11 Zulkarnain Lubis yang juga tengah masyarakat. terpelanting dan tersingkir dari orang, Fakultas Ekonomi 323 BATAVIA AIR sebagai Kepala SMA Negeri Plus 1 Jakarta 7P-592 10.10 Jakarta 7P-591 09.35 Demikian disampaikan Ke- dunia internasional, ujarnya. orang, Fakultas Hukum 176 Mandailingnatal. tua Umum PP Muhammadiyah Menurut Din, meski saat ini orang dan Fakultas Teknik 36 2. Jakarta 7P-598 12.50 Jakarta 7P-597 12.15 Permasalahan yang terjadi 3 Jakarta 7P-594 15.50 Jakarta 7P-593 15.15 Prof Dr HM Din Syamsuddin di Indonesia ada sebanyak orang. 4 Jakarta 7P-596 19.10 Jakarta 7P-595 18.25 saat ini adalah, lanjutnya, koperasi yang seharusnya MA pada wisuda Program Pas- 780.000 sarjana menganggur, Sementara itu, Koordinator 5 Batam 7P-568 13.00 Batam 7P-567 11.05 casarjana, Sarjana dan Ahli lulusan UMSU tidak sampai KopertisWilayah I Sumut-NAD menjadi sumber modal bagi SRIWIJAYA AIR rakyat kecil tidak melakukan Madya Universitas Muhamma- menganggur dan bangga, se- Prof Zainuddin M.Pd dalam 1 Jakarta SJ-015 10.20 Jakarta SJ-010 11.50 fungsinya sesuai dengan asas diyah Sumatera Utara (UMSU) suai pernyataan rektor, lulusan pesannya kepada para wisu- 2 Jakarta SJ-011 15.30 Jakarta SJ-016 18.35 koperasi yakni terbuka, jujur, periode II tahun 2009 di gedung UMSU sudah banyak mendu- dawan/ti mengatakan, kunci 3 Jakarta SJ-017 19.10 Jakarta SJ-014 20.15 mandiri dan sukarela. Koperasi Selecta Jalan Listrik Medan, duki posisi strategis, baik di ting- kesuksesan dalam hidup ini ada 4 Batam SJ-035 15.05 Jakarta SJ-034 14.30 memang mencari keuntungan Selasa (17/11). kat daerah maupun nasional. 4 hal, yaitu harus terus belajar, 5 Pekanbaru SJ-041 15.20 Pekanbaru SJ-140 15.25 Waspada/Sugiarto 6 Banda Aceh SJ-010 11.30 Banda Aceh SJ-140 14.20 Rektor UMA, Prof. Dr.Yakub Matondang (kiri) mengukuhkan tapi keuntungan bersama, saat Hadir Ketua Umum PW Jika tidak ada lagi pekerjaan tumbuhkan bakat dan motivasi 7 Penang SJ-102 07.20 Penang SJ-103 09.35 Prof. Ir. Zulkarnain Lubis sebagai guru besar tetap UMA dalam ini banyak koperasi yang men- Muhammadiyah Sumut, para yang bisa dilamar, alumni terhadap ilmu yang sudah dipe- 8 Padang SJ-021 16.00 Padang SJ-020 14.45 acara pengistiharan guru besar di Kampus II UMA Jl. Sei Serayu cari keuntungan para pengu- Ketua Ortom dan Majelis PW UMSU diharapkan dapat lajari, berdisiplin dan pandai (m32) Medan, Kamis (19/11). rus, terangnya. (m41) Muhammadiah Sumut, BPH menciptakan lapangan kerja. bergaul/berkomunikasi. (m29) 8. WASPADA Jumat 20 November 2009 Medan Metropolitan 11 KejariTangguhkan Penahanan Tersangka Penipuan MEDAN (Waspada): Belum dibawa ke persidangan, AS alias JPU Upaya Paksa Alim, warga JalanWahidin Medan, tersangka dalam kasus dugaan penipuan dan penggelapan yang berkas perkaranya baru saja dilimpahkan ke Kejaksaan Negeri Medan, bebas berkeliaran. Melihat tersangka tidak ditahan, korban Amir Hasan, warga Hadirkan Chandra Jalan Pukat Banting IV Medan, mencak-mencak dan menduga kasus yang merugikan dirinya hingga puluhan juta itu telah Tiga Aktor Utama Demo Anarki Dituntut 35 Tahun disusupi mafia peradilan. Kepada wartawan di Mapoltabes Medan, Kamis (19/11), dia MEDAN (Waspada): Jelang nya ke persidangan. Abdul Azis Angkat tewas. mengatakan, beberapa waktu lalu kasus itu sudah diterima (P21) agenda tuntutan, GM Chandra Kalau memang sakit maka Jaksa beralasan para ter- dan akan segera di sidangkan. Namun, di Kejaksaan tersangka Panggabean, terdakwa utama harus ditunjukkan surat sakit- dakwa terbukti sebagaimana justru dibebaskan meski kasus itu belum sampai di meja hijau. demo anarki massa pendukung nya, sudah seperti itu prosedur- keterangan saksi dan fakta-fakta Ini pasti ada permainan mafia peradilan, ungkapnya. Diceritakannya, kasus itu berawal April lalu, tersangka datang pembentukan ProvinsiTapanuli nya. Karena setiap sidang Sela- dalam persidangan, melakukan ke tokonya meminta blok mesin traktor dengan alasan mau (Protap) yang menewaskan Ke- sa-Kamis, selalu tidak hadir ala- tindak pidana pasal 340 tentang dijuala kepada calon pembeli. Merasa tak curiga dan mengingin- tua DPRD Sumut Abdul Azis sannya sakit. Jangan sampai ini perencanaan pembunuhan kan dagangannya laku, korban memberikan blok traktor itu. Angkat di gedung dewan, men- jadi salah pengertian semua junto pasal 170 dan pasal 146 Ternyata barang bernilai jutaan itu bukan dijualkan, namun derita gangguan mental. Na- orang, jelasnya. KUHPidana tentang pembuba- memberikannya kepada polisi sebagai barang bukti atas kasus mun secara fisik normal dan da- Ubah jadwal sidang ran rapat badan pembentuk yang sebelumnya sudah menimpa tersangka. pat dihadirkan ke persidangan. Setelah mendengarkan undang-undang. Saat korban meminta kepada tersangka ternyata barang Demikian disampaikan penjelasan dari saksi tersebut, Jaksa P Tumanggor dalam . Waspada/Surya Efendi sudah tidak ada dan akhirnya mengadukan kasus itu ke polisi. Kepala Klinik Rutan Tanjung ketua majelis hakim, Kusnoto, pembacaan tuntutan terdakwa DITUNTUT 12 TAHUN: John Haidel Samosir, salah seorang terdakwa utama kasus demo maut Kemudian tersangka ditahan polisi. Namun, setelah kasusnya Gusta Medan, dr MS Siregar saat membuat ketetapan untuk me- John Haidel Samosir, menye- massa Protap 3 Februari 2009, dituntut hukuman penjara 12 tahun di Pengadilan Negeri Medan, dilimpahkan ke Kejari Medan, penahanan tersangka ditang- diperiksadipersidanganPengadi- ngubah jadwal sidang menjadi butkan, terdakwa mengakui ba- Kamis (19/11). guhkan kejaksaan. (cat) lan Negeri Medan, Kamis (19/11). setiap hari pada pekan depan. rang bukti yang disita darinya, Sementara itu, Jaksa Penun- Hal ini untuk memaksimalkan berupa tas yang berisi berkas, Muspika Bongkar tut Umum (JPU) Amrizal Tahar mengatakan, akan mengupa- waktu penahanan terhadap Chandra yang akan berakhir rantai dan gembok. Gembok tersebut, ujar Tumanggor, digu- 1.849 Persil Tanah Pemprovsu Warung Miras yakan paksa menghadirkan pada 10 Desember mendatang. nakan untuk mengunci pintu BELAWAN (Waspada): Muspika Medan Labuhan yang Chandra. Ini ketiga kalinya terdakwa tidak menghadiri Jadi, sudah jelas ya, jaksa dan penasihat terdakwa. Mulai gerbang pemisah antara ge- dung DPRDSU dengan Bank Belum Bersertifikat dipimpin Camat Drs Muslim, Msp menertibkan sejumlah persidangannya dengan alasan pekan depan sidang mulai dari Mandiri.Tas berisi berkas, gem- warung yang menjajakan minuman keras yang selama ini sakit, ujarnya. Senin sampai Jumat. Jangan ada bok dan rantai diakui terdakwa. MEDAN (Waspada): 1.849 tidak untuk tetap memperta- tetap tidak bergerak milik Pem- beroperasi di sepanjang bahu jalan KL Yos Sudarso Km.16,5 Lebih lanjut di hadapan alasan lagi sakit, kalau memang Gembok digunakan untuk Persil tanah yang tersebar di 23 hankan opini APBD 2008 deng- provsu yang dirangkum dalam Kelurahan Martubung (Simpang Kantor-red), Senin (16/11). majelis hakim, MS Siregar me- sakit maka harus dirawat. Kalau mengunci pintu tembok di Satuan Kerja Perangkat Daerah an predikat Wajar Dengan Pe- 11 kelompok masalah. Yakni, Pembongkaran paksa itu dilakukan karena selama ini peda- nyatakan sejak awal penaha- tidak, bagaimana caranya tetap bank Mandiri, ujar Tumanggor. (SKPD) Pemerintah Provinsi ngecualian (WDP), katanya. tanah tidak/belum memiliki gang tidak memiliki izin operasional dan tidak mau mengindah- nan, Chandra sudah enam kali dihadirkan di persidangan, Tindakan itu, lanjutnya, Sumatera Utara, sampai kini Dari 1.849 persil tanah seni- sertifikat. kan peringatan yang telah dikeluarkan Camat Medan Labuhan. datang ke klinik menyampaikan terangnya. diindikasikan kuat sebagai belum bersertifikat. Nilai persil lai Rp240 miliar lebih yang be- Kemudian gedung dan ba- Selain itu, beberapa warung yang ada dilokasi itu membuat keluhannya. Selama enam kali JPU Amrizal Tahar menam- bentuk perencanaan. Aksi tanah yang belum bersertifikat lum bersertifikat itu, Dinas Per- ngunan tidak/belum memiliki resah warga karena menjual minuman keras (miras) yang pemeriksaan itu, kata dia, Chan- bahkan, pemanggilan paksa unjukrasa pada Februari lalu, itu mencapai Rp240 miliar le- kebunan memiliki nilai paling bukti/catatan perolehan, tanah belakangan menjadi tempat mangkal sejumlah wanita malam dra mengalami keluhan yang akan dilakukan. Pasalnya, kata menyebabkan meninggalnya bih, sedangkan upaya menyer- tinggi sebesar Rp80,316 miliar digunakan/dimanfaatkan oleh atau pekerja seks komersial (PSK). Instruksi Walikota Medan, sama seperti oyong, kunang- Amrizal di hadapan majelis Ketua DPRD Sumatera Utara, tifikatkan seluruh aset diproyek- lebih dengan 19 persil tanah. pihak ketiga tanpa ijin, gedung pedagang dilarang berjualan di bahu jalan, kata Muslim. kunang, susah tidur, mencret, hakim, untuk ketiga kalinya Abdul Aziz Angkat. sikan tuntas tahun 2010. Kemudian disusul Dinas Sosial digunakan/dimanfaatkan oleh Sebelum pembongkaran dilaksanakan, Muspika Medan lemas, tidak bisa makan, demam. Chandra tidak mau dihadirkan Jaksa mengutarakan, pe- Kepala Biro Perlengkapan sebesar Rp25,749 miliar dengan pihak ketiga tanpa ijin, tanah Labuhan telah mengadakan pertemuan dengan pedagang yang Namun, keluhan ini hanya ke persidangan. Meski sudah nyebab kematian Abdul Aziz dan Aset, Bondaro Siregar, di- 53 persil tanah, Dinas Pengairan dan atau gedung diakui sebagai membuahkan hasil kesepakatan kalau pedagang tidak akan bersifat subjektif dari terdakwa. dibujuk secara persuasif Chan- Angkat akibat adanya pukulan dampingi Kepala Bagian Penga- Rp19,952 miliar dengan 1.463 milik pihak ketiga, tanah dan menjual minuman keras. Namun hingga 10 kali diperingatkan Saat kita lakukan pemerik- dra tetap tidak mau meninggal- (benda tumpul) dengan bekas daan dan Aset, Nurlela, kepada persil tanah, Dinas Kesehatan gedung yang belum terdaftar tetap membandel dan tak mau membongkar sendiri warung saan, tekanan darah normal, kan selnya.Sampai saat ini, memar. Memar terdapat sebe- wartawan, Rabu (18/11) menje- Rp17, 993 miliar lebih dengan sebagai aset daerah, serta asal mereka, ucap Muslim. denyut jantung normal, teka- kami belum bisa menghadirkan lum korban meninggal, kata laskan, upaya menyertifikatkan 21 persil tanah, Dinas Pendidi- usul tanah tidak jelas. Tidak ada perlawanan dalam upaya pembongkaran yang nan perut juga normal. Artinya terdakwa ke persidangan maje- jaksa S. Overa Tambun, rekan seluruh aset tanah itu menjadi kan Rp16,825 miliar lebih deng- Berikutnya, ijin pemanfaa- dilakukan seluruh kepling itu dan beberapa petugas Polsekta secara fisik normal, ucap dia. lis. Terdakwa bersikeras tidak P Tumanggor. . prioritas pihaknya sepanjang an lima persil tanah dan Dinas tan tanah dan bangunan tidak Medan Labuhan berjaga-jaga di sekitar lokasi.(cre) Menurut Siregar, kondisi mau keluar sel dengan alasan Hal lain yang diungkapkan tahun 2010. Pertanian Rp16,343 miliar lebih tertib, gedung tidak dimanfaat- yang dialami Chandra merupa- sakit, ujarnya. jaksa sebagai bentuk perenca- Upaya itu agar pelaporan dengan enam persil tanah. kan dan kondisi rusak berat, do- kan bentuk manifestasi dari rasa Dituntut 35 Tahun naan, adanya peti mati, span- data aset Pemprovsu kepada Diakui Nurlela, data 1.849 kumen hibah atas dan gedung Pembobol Bengkel Diringkus takut dan cemas yang tengah Sementara itu, tiga terdak- duk dan teriakan massa. Abdul Badan Pemeriksa Keuangan persil tanah yang belum berser- tidak jelas, serta penilaian harga MEDAN (Waspada): Selama sebulan menjadi buronan, melanda dirinya. Hal itu lazim wa utama kasus ini, kemarin, Aziz harus tandatangani reko- (BPK) Perwakilan I Medan, bisa tifikat itu merupakan hasil dari atas aktiva tidak bergerak tidak pembobol bengkel milik Leli Herawati Harahap, 40, warga Jalan terjadi pada tahanan lainnya dituntut penjara 35 tahun di mendasi (Provinsi Tapanuli) terpenuhi dengan baik, paling analisa pemetaan masalah aset wajar dan terlalu rendah. (m19) Pelita VI Medan, ditangkap Reskrim Unit Jahtanras Poltabes jika sudah memasuki masa Pengadilan Negeri Medan, Dua kalau tidak mati, ungkap jaksa. dari Jalan Bambu Medan, Rabu (18/11). penuntutan. terdakwa melancarkan protes Usai mendengarkan tun- Kasus Pemalsuan BAP Tersangka Yan Sinaga, 30, warga Jalan Pelita VI Medan, Saya 12 tahun sudah beker- kepada jaksa seusai membaca- tutan JPU, terdakwa Jun Haidel kemudian dijebloskan ke dalam sel Mapoltabes Medan. ja di Rutan, memang manifes- kan tuntutan. langsung protes dan menyata- Kasat Reskrim Poltabes, Kompol Gidion Arif Setiyawan, melalui Kanit Jahtanras, AKP Faidir Chaniago, menjelaskan, tasi orang yang menghadapi tuntutan seperti itu. Namun, Datumira Simanjuntak dan John Haidel Samosir oleh jaksa kan, tuntutan itu tidak adil. Ka- rena menurutnya, aksi demo Bripka MSP Jalani Sidang peristiwa pembobolan tersebut terjadi Oktober lalu. secara fisik dia bisa dihadirkan dalam persidangan terpisah, itu dilakukan hanya ingin me- Tersangka masuk ke dalam bengkel korban dengan cara MEDAN (Waspada): Bripka Medan, rabu (18/11). nungkalit akhirnya hakim de- ke persidangan, ucapnya. dituntut masing-masing 12 ta- nuntut kesamaan di daerah memanjat tembok dan membuka pintu belakang dengan MSP Simanungkalit, terbukti Persidangan itu sesuai SP: ngan putusan No.1240/Pid.B/ Mendengar pernyataan itu, hun penjara. Sedangkan Hasu- tapanuli. Sehingga dirinya mencongkelnya. melanggar Peraturan Pemerin- No. Pol : SP/477/X/2009/P3D 2008/PN Medan terdak-wa anggota majelis hakim Asmui dungan Butarbutar dituntut 11 melalui kuasa hukum akan Dari dalam bengkel tersangka mengambil barang-barang tah Republik Indonesia (PPRI) yang ditandatangani Kanit P3D (Victor M Simamora-red) di- meminta tim medis untuk tegas tahun penjara. Ketiganya meru- mengajukan nota pembelaan. seperti satu kotak kunci, satu mesin gerenda besar, satu mesin No 2 tahun 2003 pasal 6 huruf AKP Subeno, SH. Pada kesim- nyatakan lepas dari segala tun- dalam menyampaikan kondi- pakan bagian dari delapan aktor Di sidang lainnya, terdakwa gerenda tangan, satu bor tangan dan dua mesin becak bermotor q dan pasal 5 huruf a tentang pulan BAP Laboratorium Fo- tutan hukum dan ongkos perkara sinya. Jika memang tidak sakit intelektual aksi demo anarki yang Hasudungan Butarbutar dike- (betor) yang sedang diperbaiki serta beberapa batang besi yang menyalahi wewenang dan me- rensik Poldasu menyebutkan dibebankan kepada negara. ditaksir harganya jutaan rupiah. maka jaksa harus membawa- menyebabkan Ketua DPRDSU nakan tuntutan 11 tahun. (h05) lakukan hal menurunkan ke- bahwa tanda tangan korban Menurut korban Simamora Ketika dilakukan pemeriksaan, tersangka mengaku pernah hormatan dan martabat Kepo- Viktor M Simamora, non identik usai mengikuti sidang kepada juga melakukan tindak pidana pemerasan terhadap seorang warga tionghoa laporan polisinya di Mapolsekta Medan Timur. (m39) Persoalan Pasar Pringgan lisian Republik Indonesia. Hal itu dituangkan dalam Berita Acara Pemeriksaan (BAP) atau tidak merupakan tanda ta- ngan yang berbeda dengan tan- da tangan Viktor M Simamora. wartawan, mensinyalir, bahwa kasus tersebut merupakan ka- sus pesanan yang dititipkan dari Tuntas Pekan Depan Laboratorium Forensik No 2075/DTF/2009 tanggal 29 Mei 2009, yang dibacakan dalam Terungkapnya kasus pe- malsuan BAP dan tandatangan atas korbanViktor M Simamora Lee Myoung Su melalui AKBP Adikuntoro mantan Kapolres Deliserdang kepada penyidik MEDAN (Waspada): PjWali- yang mau berjualan di dalam. PKL belum ditertibkan. Karena sidang profesi dan kode etik yang dilakukan penyidik Reser- (Kasat Reskrim) Poltabes MS kota Medan, Rahudman Hara- Tapi, karena masih ada yang selain mengurangi omzet secara tertutup terhadap Bripka se Umum (Resum) Poltabes Kompol Budi Haryanto SIK, hap menegaskan, penyelesaian berjualan di badan jalan mereka pedagang yang berada di dalam M Simanungkalit, yang dipim- Medan, Bripka MSP Simanung- penyidik (Kanit Resum) AKP persoalan Pasar Pringgan, ming- turun kembali. Persoalan ini Pasar Pringgan, keberadaannya pin Kompol A. Karokaro dan se- kalit terungkap di persidangan Moch. MY Marzuki SIK dan gu depan. Pemko tetap pada so- belum selesai akibat sebagian juga membuat pasar menjadi kretaris AKP Subeno di gedung Pengadilan Negeri Medan. Atas penyidik pembantu Bripka MSP lusi awal menempatkan peda- pedagang masih mencle-men- jorok dan macet. Deli Bhayangkara Mapoltabes perbuatan Bripka MSP Sima- Simanungkalit. (m39) gang kaki lima di lantai dua pa- cle, ucapnya. Anggota Komisi C DPRD sar tersebut atau basement. Dia memaparkan, solusi Medan, Hasyim, ketika diminta Pasalnya, di lantai dua ma- sih tersedia 38 kios yang masih kosong dan bisa dimanfaatkan yang ditawarkan tetap pada ren- cana semula memindahkan mereka ke dalam pasar atau ba- tanggapannya terkait persoalan itu mengatakan, pihaknya tetap komitmen agar penyelesaian Direktur PT FSC Digugat untuk PKL berjualan. Begitu sement. Namun, untuk base- harus melalui pembahasan me- MEDAN (Waspada): Penga- para tergugat atau kuasa hu- Awalnya tergugat I melaksa- juga di basement cukup untuk ment harus menunggu selesai libatkan pihak terkait. Pemba- dilan Negeri Medan menggelar kumnya belum juga bersedia nakan kewajibannya dengan dijadikan tempat berjualan, renovasi yang dilakukan pihak hasan bersama diharapkan bisa sidang gugatan PT Bintang Te- hadir menghadapi gugatan itu. membayar cicilan 162. 500.000 hanya merenovasi ventilasi ketiga pengelola pasar. menghasilkan jalan keluar nera (BT) diwakili Direkturnya Dalam materi gugatan yang juta dolar AS. udaranya sedikit. Mereka akan dipindahkan terbaik, yang tidak merugikan Agus Sujana, Rabu (18/11). diajukan kuasa hukum peng- Namun sejak akhir April Minggu depan persoalan ke dalam pasar dan dalam salah satu pihak. Penggugat menuntut pem- gugat, ChanWai Khan SH, Fajar 2007 sampai Nopember 2007, Waspada/Rudi Arman ini sudah selesai. Dan saat ini minggu ini akan diselesaikan Solusi yang ditawarkan ha- Kanit Jahtanras Poltabes Medan, AKP Faidir Chaniago, sudah dilakukan pembahasan, semua. Sehingga tidak adalagi rus dilalui pembahasan. Solusi bayaran utang 560.125.00 dolar Syahnan Damanik, dan Lihardo tergugat I tidak lagi melaksa- terlihat menunjukkan tato milik tersangkaYan Sinaga di ruang ucap Rahudman saat ditemui persoalan lagi di pasar itu, yang ditawarkan Pemko Medan AS oleh Shahreza Iqbal selaku Sinaga meminta kepada majelis nakan pembayaran dengan sisa kerjanya, Rabu (18/11). Waspada di Kantor Walikota pungkasnya. mengundang tanda tanya kena- direktur PT Blora Sawita Che- hakim agar meletakkan sita utang 560.125.00 dolar AS. Peng- Medan, Rabu (18/11). Seperti diketahui, sejumlah pa pedagang tidak mau, pada- mindo (FSC), ahli waris Susanto terhadap harta benda tergugat. gugat sudah menagih dengan Liem pemilik PT FSC, dan Sugi- Menurut Lihardo Sinaga cara kekeluargaan, baik lisan Pengedar Dan Pembeli Dijelaskannya, sebenarnya beberapa PKL sudah mau naik pedagang formal Pasar Pringgan kembali turun memblokir Jalan hal diberi gratis sewa tiga bulan. Kalau mau dialihkan ke base- harto Lim. Ketiganya tercatat dalam gugatannya, transaksi maupun tulisan. Namun, ke atas. Namun, akibat sebagian Iskandar Muda, Rabu (18/11). ment, renovasi segera biar bisa sebagai tergugat I, II, dan III. jual-beli quantity commodity hingga saat ini tidak ada Ganja Masuk Sel PKL masih berjualan di badan Salah seorang pedagang Br Tari- dipindahkan secepatnya. Inilah Pantauan Waspada, kema- RBD palm oil dan palm fatity penyelesaian. jalan, pedagang ini kembali gan mengatakan, blokir jalan pentingnya pembahasan rin, penggugat mengajukan acid disfilled antara PT BT yang Sesuai surat per 11 Desem- MEDAN (Waspada): Sat Narkoba Poltabes Medan meringkus turun. Sebenarnya sudah ada terus dilakukan mereka selama itu,jelasnya. (h10) gugatan karena para tergugat bergerak di bidang komoditi ber 2008, tergugat mengakui pengedar dan pembeli daun ganja di Jalan Binjai, Kec. Sunggal, melakukan wanprestasi atau ekspor sebagai suplayer dengan utangnya. Untuk persidangan Kab. Deli Serdang, Senin (16/11), secara berbeda. tidak membayar sisa utangnya. PT FSC disepakati. selanjutnya digelar 15 Desem- Dari kedua tersangka yakni, MS, 25, (pengedar) dan MP , 40, penduduk Jalan Binjai Km-13, Kec. Sunggal, Kab. Deli Serdang, disita barang bukti 2,5 Kg ganja, 2 amplop ganja, 2 paket shabu- Kakek Pengevakuasi Mayat Sidang dipimpin Ketua Majelis Hakim Panusunan Harahap itu merupakan yang Dalam kontrak jual -beli itu disetujui, pembayaran jatuh tempo saat penyerahan/pene- ber 2009. Para tergugat dipanggil untuk hadir dalam persidangan menghadapi gugatan terse- shabu, bong, pipet dan lainnya. TANPA sandal, kakek dihantui, kita kan nolong dia kedua kalinya digelar. Namun rimaan barang di pabrik PT FSC. but.(h05) Keterangan Waspada peroleh di Mapoltabes Medan menyebutkan, pertama kali yang ditangkap tersangka MP Ketika . yang punya tujuh cucu ini juga. Kita kan bersihkan dilakukan pemeriksaan MP mengaku ganja itu dibelinya dari tersangka MS. datang dari Kab. Langkat ke RS. Pirngadi Medan, Jumat (13/11). Pakaiannya tampak puing-puing tubuhnya dari jalan raya agar nanti dia tenang di dalam kubur sana, Dato Bandaraya Ipoh Malaysia Berdasarkan pengakuan MP polisi kemudian menciduk , tersangka MS yang diduga usai menggunakan shabu-shabu di sekitar lokasi kediamannya. Sementara dua temannya yang lusuh dan kumal. Dia da- tang ke rumah sakit itu, bu- kan untuk berobat, bukan ujar pria yang hobi mancing ini. Karena sudah terbiasa, Bantu Operasi Bibir Sumbing ikut mengkonsumsi narkoba itu melarikan diri. Tersangka MS mengakui membeli ganja seharga Rp1 juta pula untuk menjenguk ke- Azis mengakui tidak merasa MEDAN (Waspada): Dele- atas pejabat pemerintah Kota secara dekat bagaimana pelaya- lebih dari seorang pria yang baru dikenalnya. Dia juga sebelum- rabat atau sanak saudara- bau saat mengevakuasi ma- gasi Bandaraya Ipoh Malaysia Medan beberapa waktu lalu nan kesehatan di rumah sakit nya pernah menjalani hukuman dalam kasus narkoba. Dalam nya yang sakit. yat sudah mulai membusuk. dipimpin Datok Bandaraya dalam rangka menjalin silatu- milik Pemko itu. kasus ini, tersangka dikenakan pasal 78 Subs 85 UU No.22 tahun Dia hanyalah seorang Mungkin udah biasa kali ya, Ipoh Malaysia yang berbahagia rahmi hubungan kedua negara Sementara itu, Rahudman 1997 dengan ancaman 20 tahun penjara. (m31) petani yang mengantarkan jadi nggak ada mual atau Dato Haji Roshidi Bin Haji Ha- dan menjalin hubungan kerja Harahap, memberikan apresiasi mayat bersama tim PMI bauk lagi saat mengevakuasi sim didampingi Konjen Malay- sama dalam bidang kesehatan. dan berterima kasih terhadap Cab. Langkat yang dieva- mayat, katanya. sia, Fauzi Omar, akan memban- Ini merupakan kunjungan tawaran kerja sama ini, karena Ibu Dan Anak Terlibat kuasinya sendiri dari Su- ngai Wampu Langkat. Dia Kesan yang paling me- nyedihkan hatinya adalah tu operasi bibir sumbing terha- dap anak-anak yang menderita hormat balasan, dan kunjungan ini selain mempererat hubung- peningkatan di bidang keseha- tan merupakan salah satu pro- Togel Masuk Sel adalah M. Azis, 67, (foto) warga Desa Ampera, Kec. Waspada/Mursal AI mengevakuasi mayat korban pembunuhan. Saya merasa bibir sumbing di Kota Medan. Demikian dikatakannya saat an kedua negara yang berte- tangga, juga melakukan hubu- gram pemerintah Kota Medan. Menurutnya, kerja sama ini MEDAN (Waspada): Ibu dan anak terlibat judi toto gelap Stabat, Kab. Langkat. kecelakaan. Saya sering bantu- kasihan dengan mayat- melakukan kunjungan kehor- ngan kerja sama dibidang kese- agar disegerakan dan di kota dibekuk polisi dalam penyergapan di kediamannya Jalan Sendok, Bukan yang pertama bantu polisi kalau ada mayat mayat korban pembunuhan, matan di Balai Kota Medan, Se- hatan yakni akan melakukan Medan juga ada sejumlah orga- Gang Kelapa, Lingkungan III, Kel. Sei Putih Tengah, Kec. Medan kali dia mengevakuasi ma- di sungai dan mayat korban saya berpikir kok ada yang nin (16/11), yang diterima lang- operasi bibir sumbing terhadap nisasi sosial yang ikut berperan Petisah, Rabu (18/11). kecelakaan dan pembunuhan. sung PjWalikota Medan, Rahud- anak-anak yang menderita bibir melakukan bhakti sosialnya yat yang hanyut di sungai orang setega itu. man Harahap didampingi Sekda sumbing di Kota Medan, ujar melakukan operasi bibir sum- Dari kedua tersangka yakni, D br Manik, 52, (sub agen togel) atau di jalan raya korban Sebagai imbalannya saya Mengenai penemuan dan putrinya P br Sitompul, 23. disita barang bukti dua Dzulmi Eldin, dan Ketua Umum Dato Bandaraya Ipoh. bing terhadap anak penderita kecelakaan, bahkan korban terkadang diberi seratus ribu mayat laki-laki yang baru di Asososiasi Kota Bersaudara Kota Menurutnya, anak yang bibir sumbing. Dengan adanya handphone berisikan puluhan nomor togel pesanan pelanggan, pembunuhan, tapi sudah atau terkadang uang rokok dapatnya ini, Azis meng- Medan, dr H Rosihan Arbie. menderita bibir sumbing akan kerja sama dengan Pemerinta- kertas berisikan puluhan nomor togel, 2 pulpen, uang Rp155 puluhan mayat yang dieva- saja, kata kakek yang memiliki utarakan, mayat ini dite- Delegasi Bandaraya Ipoh dibawa ke Ipoh Malaysia, dan han Ipoh, mudah-mudahan pe- ribu dan lainnya. kuasinya. Bahkan, dia pun 14 anak ini. mukannya saat dia hendak sebanyak 30 orang ini selain disana akan dilakukan operasi ningkatan kesehatan dapat Keterangan Waspada peroleh di lapangan, penangkapan tak ingat lagi sudah berapa Tak hanya mayat yang mancing dekat rumahnya. terdiri dari sejumlah majelis serta perawatannya. Setelah itu, cepat terwujud, dan tidak saja ibu dan anak itu berawal Reskrim Polsekta Medan Baru sedang mayat yang sudah diang- kondisi tubuhnya yang masih Kemudian dia memanggil Perbandaran Ipoh (Pejabat Pe- para anak tersebut akan dijadi- kerja sama di bidang kesehatan melacak buronan terlibat tindak kejahatan. Setiba di Jalan kutnya dari sungai dan utuh saja yang dievakuasinya. warga, selanjutnya mela- merintah Kota) juga diikuti kan sebagai anak angkat. tetapi banyak peluang-peluang Ayahanda Medan, mendapat informasi ada praktik judi togel jalan raya. Tapi juga mayat-mayat yang porkannya kepada polisi. wartawan dari media cetak dan Dipaparkannya, selain lain yang bisa dijalankan. di kawasan itu. Nama Azis sudah sangat sudah membusuk dan yang isi Terus saya disuruh ikut elektronik serta pimpinan melakukan kunjungan hormat Delegasi Bandaraya Ipoh ini Kemudian melakukan penggerebekan dan menangkap terkenal di Kepolisian Resort otaknya sudah keluarpun rombongan PMI bantu mere- rumah sakit di Ipoh. ke Balai Kota Medan, pihaknya berada di Kota Medan selama tersangka D br Manik bersama putrinya P br Sitompul bersama (Polres) Langkat. Dia sering dipegangnya. Dan isi otak-otak ka bawa mayat ke rumah Datok Bandaraya Ipoh yang akan mengunjungi rumah sakit lima hari dimulai 15 sampai 19 barang bukti. dimintai bantuan untuk mayat itupun dipegangnya sakit ini untuk diotopsi, berbahagia Dato Haji Roshidi umum Dr Pirngadi yang meru- November.Selamaberadadikota Selain menangkap kedua tersangka juga turut diamankan mengambil mayat-mayat dengan kedua belah tangannya. ujarnya. Bin Haji Hasim mengatakan, pakan milik Pemerintah Kota Medan, delegasi Bandaraya Ipoh dua pria yang belum diketahui keterlibatannya ke Mapolsekta yang hanyut atau korban Ngapain mesti takut * Mursal AI kunjungan kehormatan ini me- Medan. Kunjungan ke rumah juga akan mengunjungi Guber- Medan Baru. (m31) rupakan kunjungan balasan sakit tersebut untuk melihat nur Sumatera Utara. (h10) 9. 12 Opini WASPADA Jumat 20 November 2009 Ahli Bidah Atau Aliran Sesat? haya Bidah Dalam Islam oleh Syekh Jumat, berijtihad tahlilan di kematian, Ali Mahfudz, dosen luar biasa Univer- hadiah pahala, berijtihad tambah Oleh Dr. Arifin S. Siregar sitas Al-Azhar, Cairo Mesir), disebutkan syaidina pada syalawat, dsb, yang di sana imam Ash Syathibi mencela telah menyimpang dari Sunnah. pembagian Bidah menjadi 2,3,5 ba- Padahal pintu ijtihad telah tertutup U ntuk tidak terjebak pada Ustad menjawab : Ayat ini telah di- gian. Katanya yang namanya bidah pada aqidah/ibadah. Untuk itu ustad Aliran Sesat/Ahli Bidah nasikh mansukh (telah dihapuskan) hanya 1 macam yaitu sesat, sesuai Ramli berkomentar : Ada Hadis me- tetapi menginginkan men- oleh ayat anu (tak tercatat oleh saya). Hadis Nabi SAW. Maka ustad Ardian- ngatakan : seorang mujtahid (ulama) jadi seorang Ahli Sunnah Maka ayat anu itulah yang berlaku. syah berkomentar: Buku yang anda bila berijtihad benar maka memperoleh Waljamaah, maka sejawat Dr Imsyah Ayat An Nisa 39 batal. baca itu tidak benar. Ini buku saya, 2 pahala, bila salah memperoleh 1 pa- Satari, SpM (Spesialis Penyakit Mata) Kemudian saya komentari : Ayat tulisan imam Ash Syathibi asli. hala. Itulah alasan ustad Ramli boleh- mengadakan pengajian setiap malam QS Al-An Am 164 dan QS Yasin 54 dan Maka menjadi pertanyaan, apakah nya ulama berijtihad pada aqidah/ Senin di rumahnya. Saya nasihatkan QS Al Baqarah 286 isinya senada, apa- buku yang saya baca karangan Syekh ibadah. agar ustadnya yang dipakai seimbang kah akan turut batal (terhapus)? Atau Ali Mahfuzd dosen luar biasa Univer- Saya tanggapi: Nabi SAW telah dari faham tua dan faham muda agar berarti Imam Syafii tidak tau masaalah sitas Cairo itu, adalah Syekh Ali Mah- membatasi bolehnya berijtihad itu, TAJUK RENCANA seimbang sehingga pendengar dapat nasikh mansuk ini. fuzd salah kutip buku Al Itisham? Apa- hanya pada masaalah muamalah (ma- memilah mana yang sesuai Quran dan Kemudian saya tanya : Apa yang kah ustad Ardiansyah lebih pintar dari saalah keduniaan). Pada aqidah/iba- Hadis. dimaksud Nabi SAW pada Hadisnya Syekh Mahfuzd? Apakah ustad Ardian- dah tidak boleh. Buktinya : Sejawat saya itu mengomentari di menyebut : Sunnah Waljamaah, siapa syah menganggap ulama besar Indo- 1. Pada QS Al Maidah 3 : . Mudah-mudahan Presiden mana beliau akan membuat pengajian ini beribu kali dan mengundang ulama dari Timur Tengah. orangnya ? Jawab ustad Nasir : Orang- orang Ahli Sunnah Waljamaah, itulah kita ini. nesia KH Jafar Sujarwo dan KH Rahnip bodoh (salah terjemah)? Seharusnya seorang ulama/ustad yang santun tidak telah Kusempurnakan agamamu un- tukmu dst. 2. HR Ahmad Nabi SAW bersabda: Berkata Jujur Demi Hukum Saya tanggapi : Ustad mengatakan mengatakan demikian. Alangkah san- Mengenai urusan dunia kamu, kamu Topik Wirid Yasin kita ini adalah Ahli Sunnah Waljamaah. tunnya bila mengatakan: Mari kita teliti lebih tau mengenai urusan agama Begitulah, sebagai wujud dari ren- Kalau begitu seharusnya kita meng- lagi apakah penafsiran saya atas kitab (aqidah/ibadah) ikut aku. cana itu diadakanlah pengajian yang amalkan Sunnah-Sunnah Nabi SAW. Al Itisham yang salah, atau kitab tulisan 3. Atau HR Muslim : Barang siapa P rediksi banyak orang salah yang mengira setelah Tim-8 (Tim Pencari Fakta) dibimbing 3 ustad yaitu Prof DR H Kenyataan kita shalat qabliyah Jumat Syekh Ali Mahfudz yang salah. menyampaikan amalan (aqidah/iba- membuat rekomendasi maka Presiden SBY pasti langsung merespon butir- Ramli Wahid, MA, DR H Ardiansyah, dan kita azan Jumat 2 kali sesudah ma- Untuk dimaklumi masaalah bidah dah) yang tidak ada dalam petunjuk butir rekomendasinya, seperti menghentikan penyidikan kasus Bibit dan Lc dan HM Nasir, Lc, MA dengan topik: suk waktu dan di masjid keduanya di rujukannya adalah sabda Nabi SAW bu- kami (Sunnah) maka amalan itu ter- Chandra. Malah Presiden SBY mengingatkan agar dirinya jangan sampai Wirid Yasin, Aliran Sesat dan Bidah. mana tidak ada Sunnahnya, tidak di- kan ulama. Nabi bersabda : Kullu bid tolak (bidah sesat). didorong atau dipaksa untuk mengambil langkah di luar kewenangan Pada kesempatan diskusi, saya ta- amalkan Nabi SAW, tidak oleh sahabat atin dholalah Setiap bidah ada-lah 4.Kaidah Ushul Fiqih : Sesung- terkait kasus hukum dua pimpinan KPK non-aktif itu. nya masaalah menghadiahkan pahala dan tidak oleh Imam Syafii. sesat. Saya sependapat dengan ulama guhnya ibadah itu haram, kecuali ada Mengawali rapat untuk membahas rekomendasi Tim Independen Verifikasi Fakta pada yang mati. Kemudian ustad Nasir Kita tahlilan pada kematian hari yang mengartikan kullu itu semua. petunjuk (Sunnah) yang memboleh- mengatakan kebolehan hadiah pahala 1,2,3 dan hari ke-40, ke 100 dan ke kannya. dan proses hukum Bibit dan Chandra di Kantor Kepresidenan, Jakarta, Rabu (18/ 1.000. Tidak diamalkan Nabi SAW, sa- itu adalah ijma ulama. Saya tanggapi: Topik Aliran Sesat Jadi sesuai petunjuk di atas itu, ma- 11), Presiden mengatakan penyelesaian kasus Chandra dan Bibit memang harus Itu bohong, karena ulama dulu ber- habat dan Imam Syafii. Kemudian sya- Membicarakan aliran sesat tampil ka hak cipta aqidah dan ibadah hanya cepat dilakukan namun harus tetap dalam koridor hukum yang jelas. Maka kecelelah pencar-pencar, tidak ada pertemuan lawat ajaran Nabi SAW : Allahumma Prof DR H Ramli Wahid, MA. Untuk ada pada Nabi SAW. Setelah Nabi SAW banyak orang yang sejak awal sudah memaksakan kehendaknya agar kasus Bibit sedunia, tidak ada telepon, mas media, shalli ala Muhammad .......... dst. Kita itu ustad mengutarakan ada 10 penye- wafat,tidakbolehadalagiterbentukibadah dan Chandra di-SP3-kan saja karena Polri dituding tidak punya cukup bukti untuk dsb, sehingga tidak ada kesempatan buat : Allahumma shalli ala syaidina bab timbulnya aliran sesat, di anta- dan aqidah yang baru. Berarti pintu ijtihad dimajukan ke persidangan. untuk cari kata sepakat (ijma). Yang Muhammad . dst. Kemudian Nabi ranya mengingkari salah satu rukun untuk aqidah/ibadah tertutup. Memang kalau Presiden SBY mau tidak sulit menghentikan kasus yang menimpa ada adalah Ijma Sahabat. SAW tidak mewasiatkan berdoa/zikir iman, mengingkari Hadis Nabi SAW dsb. Mari kita kembali pada Quran dan Bibit dan Chandra. Sebab, ia punya hak untuk menghentikan kasus demi kepentingan Padahal Imam Syafii menolak berjamaah dengan suara jahar setelah Memang aliran sesat kita semua Sunnah secara jujur sebelum terlambat masyarakat (umum) mengingat kasusnya sudah melebar tak tentu arah dan amalan itu, maka ustad Nasir menja- selesai shalat fardhu, tapi kita lakukan sepakat harus ditolak (dibasmi). Yang (ajal datang) untuk bertobat. membenturkan masyarakat dalam dua kelompok. Yang satu mendukung KPK wab : Kami mengamalkan itu bukan dan suara jahar. Jadi ada segudang disesalkan versi sesat yang diuta- menolak kriminalisasi lembaga pemberantasan korupsi itu, sementara belakangan mengikut Imam Syafii, tapi mengikut amalan aqidah/ ibadah yang kita rakan ustad Ramli, tidak menggu- Kesimpulan ini muncul pula komunitas atau kelompok pendukung Polri untuk meneruskan kasus faham Syafiiyah. Maka saya tanya : amalkan, yang tidak ada Sunnahnya. nakan sesat versi Nabi SAW : Sebu- 1. Beragama ini perlu tahu kenapa Bibit dan Chandra ke pengadilan. Syafiiyah itu siapa? Tolong ustad sebut Kalau begitu, barangkali lebih tepat ruk-buruknya perbuatan adalah yang dan mengapa (QS Al Isra 36). ulamanya ! Bila sudah mengaku Sya- orang yang demikian disebut Ahli mengada-ada (menambah-nambah) 2. Pengajian adalah penyampaian Justru itulah kita harus menghargai putusan Presiden SBY, jika memang RI-1 tidak fiiyah, seharusnya mengikut pendapat Bidah wal Jamaah bukan Ahlu setiap yang mengada-ada adalah agar tahu membedakan mana yang be- mau mengintervensi aparat penegak hukum dengan satu harapan, semoga ucapan Imam Syafii. Mengaku Syafiiyah, tapi Sunnah Waljamaah. nar, bukan memaksakan harus diterima. bidah, setiap bidah adalah sesat . Presiden jujur dan ke luar dari lubuk hati paling dalam. Jangan sampai lain di mulut menolak pendapat Imam Syafii, itu dst. Versi Nabi SAW, sesat itu terjadi 3. Pengajian harus beserta diskusi lain di hati. Juga dalam kaitan kasus Bank Century yang merugikan keuangan negara bukan Syafiiyah. Itu pembohongan. Topik Bidah karena bolehnya berijtihad pada aqi- ikhlas mencari kebenaran. Jangan ter- lewat dana talangan Rp6,7 triliun. Untuk ini ustad Nasir tidak menjawab. Ustad DR H Ardiansyah, Lc meng- dah/ibadah. Sehingga ulama meng- lalu dibatasi tanggapan-tanggapan Dalam kondisi hukum kita sangat mem- Kemudian saya tanya : QS An Nisa utarakan bidah itu tidak harus 1 ma- ada-ada (menambah-nambah) pada yang sehat dan argumentasi yang kuat. prihatinkan saat ini, sudah waktunya Presiden 39 : Tidaklah seseorang itu mendapat cam, tapi bisa 2,3 atau 5 macam, sesuai aqidah/ibadah. Kenapa mereka meng- 4. Harus diakhiri dengan berjabat Intisari SBY berupaya menegakkan supremasi hu- ganjaran (pahala) melainkan menurut pendapat imam Ash Syathibi pada ada-ada ? Karena ada pendapat di an- tangan dan berpelukan. kum. Jangan malah membuat kondisi hukum apa yang dikerjakannya sendiri. Jadi bukunya Al Itisham. tara ulama membolehkan ijtihad pa- kita semakin parah dan menyedihkan nanti- sesuai ayat ini Allah tidak membenar- Untuk itu saya bantah, justru me- da aqidah/ ibadah. Sehingga mereka Penulis adalah pengama sospol kan hadiah pahala. nurut buku yang saya baca (Kitab : Ba- berijtihad membuat shalat qabliyah Alangkah bijaksana nya.begitu jugaanjlok sampai titik mengenas- kan, Citra Polri dengan citra Kejaksaan Agung, dan keagamaan jika semua pihak membe- menyusul banyak kasus ditemukan di KPK dan tidak luput pula di Mahkamah Agung. ri kesempatan aparat pe- Sehingga tempat-tempat rakyat mencari ke- negak hukum menyele- adilan sudah semakin tidak dipercaya publik Kompetensi Aparatur Dan Kualitas Pelayanan saikan kasus Bibit-Chan- dengan banyaknya kasus yang menimpa ins- dalamsuatustandarpelayanandapatterlihat oleh orang-orang yang berada di luar organi- titusi penegak hukum tersebut belakangan Oleh Ir Adiwijaya, Ph.D dengan jelas dasar hukum, persyaratan sasi, misalnya Badan Pemeriksa (inspektorat, dra, Bank Century, dan ini. Kalaupun pejabatnya mengatakan tidak pelayanan, prosedur pelayanan, waktu pe- BPK, Irjen dsb) dan masyarakat sebagai atau menolak di lembaganya marak calo atau layanan, biaya serta proses pengaduan, se- penerima pelayanan. Jika pengawasan ter- Antasari. makelar perkara, hal itu harus dibuktikan dengan kenyataan di lapangan. Biarkan fakta bicara, bukan membela diri dengan kata-kata. J alam rangka mewujudkan tata peme- rintahan yang bersih dan berwibawa, penyelenggaraan pemerintahaan diarahkan pada upaya peningkatan kinerja Penyebab utama dari rendahnya pro- fesionalitas dalam organisasi publik adalah petugas pengelola pelayanan. Untuk itu, kompetensi aparatur dapat dikembangkan hingga petugas pelayanan memahami apa yang seharusnya mereka lakukan dalam memberikanpelayanan.Masyarakatsebagai pengguna jasa pelayanan juga dapat menge- sebutdilaksanakandenganbaikdankesung- guhan, tentunya pelayanan akan semakin baik pula. Sebab, masalah markus ini sudah demikian merajalela dalam berbagai lembaga birokrasi agar mampu menciptakan kondisi tahui dengan pasti hak dan kewajiban apa Penutup melalui pengembangan SDM yang diartikan hukum dan keadilan kita, sekalipun sulit membuktikannya, namun dirasakan betul yang kondusif bagi terpenuhinya kebutuhan sebagai bentuk peningkatan pengetahuan yang harus mereka dapatkan dan lakukan Dalam mewujudkan tata pemerintahan keberadaannya. masyarakat, meningkatkan kualitas pelayan- SDM yang dapat meningkat kearah lebih untuk mendapatkan suatu jasa pelayanan. yang baik pemerintah telah dilakukan berba- Melihat ekspose media massa di mana tiga pimpinan: KPK (Tumpak Hatorangan an kepada masyarakat; dan menekan tingkat baik pada masa yang akan datang melalui Kejelasan pemahaman petugas dalam pe- gai upaya perbaikan terhadap birokrasi pe- Panggabean) berfoto sembari berpegangan tangan dengan Kapolri Jenderal Pol penyalahgunaan kewenangan di lingkungan pengalaman-pengalaman maupun pendi- nyediaan pelayanan akan memperjelas pe- merintahan sebagaimana diuraikan di atas, Bambang Hendarso Danuri dan Jaksa Agung Hendarman Supandji, muncul banyak aparatur pemerintah. dikan dan pelatihan. Pengalaman yaitu ilmu ranan masing-masing pihak dalam penye- Namun demikian, pada kenyataannya ki- dugaan, di antaranya kasus-kasus yang tengah hangat saat ini akan diselesaikan begitu Untuk mewujudkan itu, aparatur meru- yang diperoleh dari perjalanan hidup se- diaan pelayanan. Melalui standar pelayanan nerja birokrasi masih belum optimal, antara saja di bawah tangan. Tentu saja masyarakat keberatan kalau kasus yang mencuat, pakan kunci keberhasilan bagi kinerja or- seorang selama menjalani aktivitas baik ini dapat diketahui pula bagaimana hubung- lain dicerminkan dengan masih banyaknya seperti kasus Bibit dan Chandra, kasus Bank Century, kasus Antasari Azhar diselesaikan ganisasi instansi pemerintah dalam menja- dalam organisasi ataupun di luar organisasi. ankerjayangharusdibangunantarapegawai keluhan masyarakat, baik menyangkut pro- lankan roda pemerintahan.Hendaknya pe- Pendidikan yaitu ilmu yang diperoleh sese- yang satu dengan yang lain. Keraguan pega- sedur, kepastian, tanggung jawab, moral di luar jalur hukum. Masyarakat pasti tidak akan dapat menerima apa pun alasannya, merintah memberikan perhatian khusus wai akan keputusan- keputusan apa yang petugas,sertamasihterjadinyapraktekpungli orang berdasarkan kemampuan intelektual termasuk jika Presiden melakukan intervensi atau melanggar janjinya. bagi aparatur yang menjalankan tugasnya yang dimilikinya yang diperoleh dari suatu harus diambil dengan sendirinnya akan hi- yang memperbesar biaya pelayanan dan Di sinilah kita harapkan Presiden SBY tetap ingat dengan komitmennya untuk dengan baik sebagai pemberi pelayanan lembaga formal dengan berbagai disiplin lang sepanjang masih dalam aturan yang masih kurang profesionalismenya aparatur memberantas KKN/korupsi. Poin inilah yang dilihat rakyat sehingga mereka memilih kepada masyarakat. sebagai pelayan masya- ilmu didalamnya. Pelatihan yaitu ilmu yang termuat dalam standar pelayanan. Faktor pemerintah dalam melaksanakan tugas dan SBY dalam Pilpres lalu. Meskipun besannya Aulia Pohan, mantan Deputi Bank rakat tentunya kompetensi yang dimiliki diperoleh seseorang dalam kaitan pelaksa- utama yang menjadi perhatian pimpinan fungsinya,sehinggaseringkalibirokrasimasih Indonesia ditangkap KPK dan akhirnya dihukum penjara namun SBY bergeming harus seimbang dengan pelayanan yang naan tugas yang bersifat teknis dan mana- dalam kaitan ini adalah kepercayaan penuh dianggap sebagai penghambat pelaksanaan membantu. Begitu pula saat kasus kriminalisasi KPK mencuat berlanjut pada akan diberikannya. Upaya peningkatan jerial yang diperoleh dari lembaga formal yang harus diberikan oleh pimpinan kepada tugas-tugaspemerintahandanpembangun- kasus terbukanya rekaman banyak pejabat tinggi Polri dan Kejaksaan Agung profesionalisme aparatur dalam pelayanan maupun informal. pegawainya. Pimpinan harus memiliki ke- an. Peran pemerintah dalam meningkatkan bermainmain dengan hukum (perkara), Presiden SBY malah bertekad menjadikan tidak akan tercapai apabila banyak perma- Dari ketiga pengembangan SDM , apa- yakinan, pegawai yang bertugas dapat mela- mutu pelayanan di Indonesia telah diwujud- salahan yang masih menjadi penghambat ratur dapat meningkatkan pengetahuannya kukan pekerjaannya dengan baik, apabila kan melalui Peraturan Pemerintah Nomor penegakan hukum sebagai prioritas dalam 100 hari kerja. Sungguh kita salut bila bagi kinerja pelayanan. Permasalahan yang mereka melakukan kesalahan pegawai juga 101 tentang Pendidikan dan Pelatihan Jabat- dengan mengkolaborasi ketiganya. Dengan SBY tegar menegakkan supremasi hukum. terjadi antara lain yakni rendahnya kualitas pengalaman yang telah dimilikinya selama harus diberi kesempatan untuk menyelesai- an Pegawai Negeri Sipil (PNS). Peraturan di- Kalau melihat perkembangan di masyarakat yang menginginkan Presiden Sumber Daya Manusia (SDM) Aparatur, menjalankan tugas dan tanggungjawabnya kan permasalahannya sendiri. Hal ini pen- maksudkan untuk meningkatkan kompe- SBY komit dengan janji-janjinya, sudah selayaknya kasus Bibit dan Chandra kurangnya motivasi untuk meningkatkan sebagai aparatur pemerintah, kompe- ting, dikarenakan apabila pegawai menge- tensi aparatur guna penyelenggaraan peme- diteruskan ke pengadilan. Apalagi Polri katanya memiliki cukup bukti keterlibatan kompetensinya serta rendahnya moralitas tensinya dapat lebih ditingkatkan dengan tahui dia kurang mendapatkan kepercayaan rintahan yang lebih baik dengan kualitas pejabat KPK itu. Demikian pula dengan kasus Bank Century seharusnya semua dari aparatur itu sendiri. Hal ini mengakibat- pendidikan dan pelatihan yang telah diikuti- akan menurunkan motivasinya dalam be- SDM yang lebih baik pula. Selain itu dalam pihak mendorong pihak terkait mengungkap apa yang sebenarnya terjadi pada kan melekatnya image negatif terhadap apa- nya. Pendidikan dan pelatihan ini dapat kerja bahkan cenderung akan sangat meng- menjalankan tugas dan fungsinya aparatur bank kecil itu namun entah demi menyelamatkan siapa sampai pemerintah me- ratur untuk mempersulit masyarakat, se- berupa pendidikan struktural, fungsional gantungkan dirinya pada perintah atasan dapat mengikuti semua prosedur yang telah ngucurkan dana segar demikian besar, sementara kasus pembayaran ke nasabah hingga peluang untuk melakukan Korupsi, dan teknis. agar terhindar dari kesalahan serupa. ditetapkan dalam memberikan pelayanan. Kolusi dan Nepotisme (KKN) masih terbuka. Upaya peningkatan kompetensi apara- Kejelasan dalam proses dan prosedur Dan dalam menjalankan prosedur harus malah tidak selesai juga. Hak angket yang digagas ratusan anggota DPR RI perlu Ada pameo yang melekat di birokrasikalau pelayanan akan mempermudah organisasi adafungsipengawasanyangbisamengawasi tur ini sebagaimana yang tercantum dalam didorong, termasuk oleh Fraksi Demokrat jangan menolak, agar masyarakat tidak bisa dipersulit mengapa dipermudah, yang dalam mengevaluasi kinerja, baik kinerja setiap kegiatan dari pelayanan. Pengawasan Peraturan Pemerintah No. 101 tahun 2000 menduga-duga kasus Bank Century melibatkan elite kekuasaan, setidaknya nama terus tertanam dalam pikiran sebahagian tentang Pendidikan dan Pelatihan Jabatan individu maupun kinerja organisasi secara ini dimaksudkan untuk menghindari terjadi- Boediono dan Sri Mulyani tersebut-sebut. Dan satu kasus yang tak kalah menariknya besar aparatur pelayanan. Dengan memper- Pegawai Negeri Sipil (PNS), tujuan diklat keseluruhan.Melaluistandarpelayananakan nya penyelewengan dalam pemberian pela- menyangkut tuduhan kepada Antasari Azhar pasca pencabutan BAP oleh Williardi sulit masyarakat maka aparat pelayan bisa antara lain untuk meningkatkan pengeta- mudah diketahui bagian-bagian mana yang yanan kepada masyarakat sedini mungkin. Wizard jangan sampai direkayasa.= mendapatkan imbalan yang akan diberikan huan, keahlian, keterampilan, dan sikap masih harus dilakukan perbaikan. Karena oleh masyarakat yang menginginkan urus- untuk dapat melaksanakan tugas jabatan standar pelayanan juga dapat menjadi alat Penulis Widyaiswara Madya Badan Diklat annya cepat selesai. Lalu yang menjadi per- ukur masyarakat dalam hal transparansi dan Provinsi Sumatera Utara Hubungi kami tanyaan adalah bagaimana meningkatkan secara profesional dengan dilandasi kepriba- diandanetikaPNSsesuaidengankebutuhan akuntabilitas maka masyarakat juga akan kualitasaparaturagarmenghasilkanpelayan- instansi, sedangkan yang menjadi sasaran dapat mengetahui apabila mereka harus KANTOR PUSAT Penerbit: PT Penerbitan Harian Waspada an yang berkualitas dan masyarakat menjadi diklatadalahterwujudnyaPNSyangmemiliki menghadapi prosedur yang salah. Peluang puas dengan pelayanan yang diberikan? kompetensi yang sesuai dengan persyaratan pegawaiuntukberbuattidakprofesionaljuga Jalan Letjen Suprapto/Brigjen Katamso No. 1 Komisaris Utama: Tribuana Said Medan 20151 Direktur Utama: dr. Hj. Rayati Syafrin, MBA, MM Untuk menjawab permasalahan yang dihadapi, ada beberapa strategi yang akan jabatan masing-masing. Kompetensi yang dimaksudkan dalam peraturan adalah ke- akan terhalangi. SUDUT BATUAH Tel: (061) 4150858, Faks Redaksi: (061) 4510025, SIUPP: 065/SK/MENPEN/SIUPP/A.7/198 dapat digunakan instansi pemerintah de- mampuan dan karakteristik yang dimiliki Perlunya Fungsi Pengawasan Faks Tata Usaha: (061) 4531010. ngan melihat dari sudut pandang manaje- Meskipun standar prosedur pelayanan tanggal 25 Februari 1988 seorangPNS,berupapengetahuan,keteram- E-mail Redaksi: redaksiwaspada@gmail.com men sumber daya manusia, yakni pengem- pilan, dan sikap perilaku yang diperlukan telahdilaksanakan,namunfungsipengawas- * Anggota DPRD sibuk ke luar Anggota SPS No. 13/1947/02/A/2002 kota KANTOR PERWAKILAN bangan SDM melalui pendidikan dan pela- dalam pelaksanaan tugas jabatannya. an bukan berarti menjadi diabaikan. Penga- Percetakan: PT Prakarsa Abadi Press tihan,pembuatanprosedurstandarpelayan- wasan diperlukan sebagai alat control dari - Istilah anak Medannya pantang Bumi Warta Jaya tak sibuk Jalan Letjen Suprapto/Brigjen Katamso No. 1 an serta adanya pengawasan. Untuk lebih Prosedur Standar Pelayanan jalannya pelaksanaan pelayanan itu sendiri, Jalan Kebon Sirih Timur Dalam No. 3 Medan 20151 jelas hal ini akan diuraikan sebagaimana Berbagai persoalan yang banyak diha- selainitupengawasanjugamerupakanseba- Jakarta 10340 * Rudolf M Pardede siap maju jadi Tel: (061) 6612681 berikut ini. dapi aparaturpemerintahdalampenyediaan gai alat untuk mengevaluasi kesalahan-ke- Tel: (021) 31922216, Faks: (021) 3140817. Isi di luar tanggung jawab percetakan pelayanan sebagaimana diuraikan di atas salahan yang terjadi dan menjadi referensi Walikota Jalan Ratu Syafiatuddin No. 21 C Pengembangan SDM dapat diatasi dengan pembuatan standar bagi pelaksanaan berikutnya untuk melaku- - Na beado amang! Banda Aceh 23122 Harga iklan per mm kolom: Upaya penyediaan pelayanan yang pro- pelayanan dalam tiap-tiap organisasi pela- kan tindakan perbaikan. Pengawasan ini da- Tel & Faks: (0651) 22385 BW Rp. 11.000,- fesional tidak akan terwujud apabila tidak yanan publik. Standar pelayanan adalah pat dilakukan secara internal dan eksternal. * Putusan nonaktif Abdillah- FC Rp. 30.000,- didukung pegawai yang memiliki kemam- suatu tolak ukur yang dipergunakan untuk Pengawasan internal dapat dilakukan orang- Ramli belum turun Jalan Iskandar Muda No. 65 Lhokseumawe Halaman depan BW Rp. 33.000,- puan yang handal. Sebagaimana yang telah acuan penilaian kualitas pelayanan sebagai orangyangberadadalamlingkunganorgani- - Berarti masih terkatung-katung Tel: (0645) 42109 Halaman depan FC Rp. 90.000,- dijelaskan, organisasi instansi pelayanan sasi itu sendiri, misalnya pengawasan yang komitmen atau janji dari pihak penyedia pe- D oel Wak Jalan Sutami No. 30 Kisaran. Tel: (0623) 41412 Ukuran kolom: 40,5 mm publik masih dinilai tidak profesional dalam layanan kepada pelanggan untuk membe- dilakukanolehatasanterhadapbawahannya. memberikan pelayanan kepada masyarakat. rikan pelayanan yang berkualitas. Idealnya Sedangkan pengawasan eksternal dilakukan Dewan Redaksi: H. Prabudi Said, H. Teruna Jasa Said, H. Azwir Thahir, H. Sofyan Harahap, H. Akmal Ali Zaini, H. Muhammad Joni, Edward Thahir, M. Zeini Zen, Hendra DS. Redaktur Berita: H. Akmal Ali Zaini. Redaktur Kota: Edward Thahir. Redaktur Sumatera Utara: M. Zeini Zen. Redaktur Aceh: Rizaldi Anwar. Redaktur Luar WASPADA Negeri: H. Muhammad Joni. Redaktur Nusantara & Features: Gito Agus Pramono. Redaktur Opini: H. Sofyan Harahap. Redaktur Ekonomi: Armin Rahmansyah Nasution. Redaktur Olahraga: Johnny Ramadhan Silalahi. Redaktur Minggu/Humas: Hendra DS, Redaktur Agama: H. Syarifuddin Elhayat. Asisten Redaktur: Rudi Faliskan (Berita) Zulkifli Harahap, Muhammad Thariq (Kota Medan), Feirizal Purba (Sumatera Utara), T. Donny Paridi (Aceh), Syafriwani Harahap (Luar Negeri), Setia Budi Siregar (Olahraga), Hj. Hoyriah Siregar (Ekonomi), T. Junaidi (Hiburan), Hj. Erma Sujianti Tarigan (Agama), Hj. Neneng Khairiah Zein (Remaja), Austin Antariksa (Kreasi), Armansyah Thahir (Otomotif), Anum Purba (Wanita), Hj. Ayu Kesumaningtyas (Kesehatan), Denny Adil (Pelangi). Sekretaris Redaksi: Hj. Hartati Zein. Iklan: Hj. Hilda Mulina, Rumondang Siagian (Medan), Lulu (Jakarta). Pemasaran: Andi L. Said (Medan), H. Subagio PN (Sumut), S. Manik (NAD). Wartawan Kota Medan (Umum): H. Erwan Effendi, Muhammad Thariq, Zulkifli Harahap, David Swayana, Amir Syarifuddin, Ismanto Ismail, Rudi Arman, Feirizal Purba, Zulkifli Darwis, H. Abdullah Dadeh, H. Suyono, Ayu Kesumaningtyas, M. Ferdinan Sembiring, M. Edison Ginting, Surya Effendi, Anum Purba, Sahrizal, Sulaiman Hamzah, Sugiarto, Hasanul Hidayat, Aidi Yursal, Rustam Effendi. Wartawan Kota Medan (bidang khusus): H. Syahputra MS, Setia Budi Siregar, Austin Antariksa, Dedi Riono (Olahraga), Muhammad Faisal, Hang Tuah Jasa Said (Foto), Armansyah Thahir (Otomotif), Dedi Sahputra (Penugasan Khusus). Dedek Juliadi, Zulfan Efendi, Tetty Rosiana, Handaya Wirayuga (Koran Masuk Sekolah/KMS). Wartawan Jakarta: Hermanto, H. Ramadhan Usman, Hasriwal AS, Nurhilal, Edi Supardi Emon, Agus Sumariyadi, Dian W, Aji K. Wartawan Sumatera Utara: H. Riswan Rika, Nazelian Tanjung (Binjai), H.M. Husni Siregar, Hotma Darwis Pasaribu (Deli Serdang), Eddi Gultom (Serdang Bedagai), H. Ibnu Kasir, Abdul Hakim (Stabat), Chairil Rusli, Asri Rais (Pangkalan Brandan), Dickson Pelawi (Berastagi), Muhammad Idris, Abdul Khalik (Tebing Tinggi), Mulia Siregar, Edoard Sinaga (Pematang Siantar), Ali Bey, Hasuna Damanik, Balas Sirait (Simalungun), Helmy Hasibuan, Agus Diansyah Hasibuan, Sahril, Iwan Hasibuan (Batubara), H. Abu Bakar Nasution, Nurkarim Nehe, Bustami Chie Pit (Asahan), Rahmad Fansur Siregar (Tanjung Balai), Indra Muheri Simatupang (Aek Kanopan), H. Nazran Nazier, Armansyah Abdi, Neirul Nizam, Budi Surya Hasibuan (Rantau Prapat), Hasanuddin (Kota Pinang) Edison Samosir (Pangururan), Jimmy Sitinjak (Balige), Natar Manalu (Sidikalang), Arlius Tumanggor (Pakpak Bharat)Parlindungan Hutasoit, Marolop Panggabean (Tarutung), Zulfan Nasution, Alam Satriwal Tanjung (Sibolga/Tapanuli Tengah), H. Syarifuddin Nasution, Mohot Lubis, Sukri Falah Harahap, Balyan Kadir Nasution (Padang Sidimpuan), Idaham Butarbutar (Gunung Tua), Iskandar Hasibuan, Munir Lubis (Panyabungan), Bothaniman Jaya Telaumbanua (Gunung Sitoli). Wartawan Aceh: H. Adnan NS, Aldin Nainggolan, Muhammad Zairin, Munawardi Ismail, Zafrullah, T. Mansursyah, T. Ardiansyah (Banda Aceh), Iskandarsyah (Aceh Besar), Maimun (Lhoksukon) Bustami Saleh, M. Jakfar Ahmad, Jamali Sulaiman, Arafat Nur, M. Nasir Age, Fakhrurazi Araly, Zainal Abidin (Lhokseumawe), Muhammad Hanafiah (Kuala Simpang), H. Syahrul Karim, H. Ibnu Sadan, Agusni AH, H. Samsuar (Langsa), Amiruddin (Idi), HAR Djuli, Zainuddin Abdullah (Bireuen), Bahtiar Gayo (Takengon), Muhammad Riza, H. Rusli Ismail (Sigli), T. Zakaria Al-Bahri (Sabang), Khairul Boang Manalu (Subulussalam), Rusli Idham (Meulaboh), Jaka Rasyid (Blang Pidie), Zamzamy Surya (Tapak Tuan), Ali Amran, Mahadi Pinem (Kutacane), Bustanuddin , Wintoni (Blangkejeren), Khairul Akhyar (Bener Meriah), Tarmizi Ripan, Mansurdin (Singkil), Rahmad (Sinabang). Semua wartawan Waspada dilengkapi dengan kartu pers. Jangan layani dan segera laporkan ke pihak berwajib atau ke Sekretaris Redaksi bila ada oknum yang mengaku wartawan Waspada tetapi tidak bisa menunjukkan kartu pers yang sah, ditandatangani Pemimpin Redaksi 10. WASPADA Jumat 20 November 2009 Mimbar Jumat 13 Akselerasi Bank Syariah Belum Sesuai Target Riba dalam Persfektif Agama-agama KETUA umum Asosiasi Bank Syariah Indonesia ini dapat membuka akses BSM yang (Asbisindo) A Riawan Amin, beberapa waktu lalu lebih luas terutama dalam hal trade Oleh Mustafa Kamal Rokan finance. Apalagi Deutsche Bank mengatakan, bahwa target akselerasi perbankan syariah memiliki pengalaman luas dalam hal yang ditetapkan oleh Bank Indonesia tak sesuai islamic trade finance. FAISAL Basri, ekonom Indonesia pernah menga- orang yang tidak bersalah Yuslam mengatakan penandata- takan bahwa lalu lintas modal di negara maju bergerak Demikian juga sabda Nabi Sulaiman as. dalam dengan target yang diharapkan. Pasalnya, pertumbuhan secara bebas praktis tanpa pembatasan. Selanjutnya kitab Amsal XXVII: 8: Adapun orang yang menambah bank konvensional juga meningkat pesat. nganan nota kesepahaman dilakukan dalam rangka meningkatkan pangsa banyak negara berkembang yang mengikuti jejak hartanya dengan rubiyat (riba) dan laba yang keji, pasar BSM di industri perbankan liberalisme dalam lalu lintas modal. Gambaran lalu yaitu mengumpulkan dia bagai orang yang menaruh ApayangdikatakanolehA. Riawan penandatanganan kerjasama dengan hambatan utama pengembangan syariah. Dia mengatakan pelaku di lintas modal bergerak dalam sistem liberalisme ekono- kasihan atas orang miskin . Amin ada benarnya juga jika melihat Deutsche Bank dan Bank Mandiri industri keuangan syariah yakni perpa- industri perbankan syariah bertambah mi dapat dilihat dari perederan uang dan instrumen Dalam kitab Nabi Jehezkiel XVIII : 7 dan 8 disebut- dari angka dan data yang selama ini (Eropa) Limited London (BMEL). jakan sudah selesai. Indonesia juga banyakseiringbakalmasuknyapemain keuangan lainnya yang tidak lagi sekedar sebagai kan: Dan ia memberi makanan kepada orang yang dimiliki oleh bank syariah. Dalam kerjasama ini dimaksudkan memiliki populasi Muslim terbesar baru dari dalam dan luar negeri. Untuk penopang sektor riil, melainkan uang telah menjelma lapar serta melindungi orang telanjang dengan Untuk mencapai pertumbuhan untuk melakukan arrangement di dunia yakni lebih dari 200 juta. Selain meningkatkan atau mempertahankan sebagai komoditas perdagangan. Lebih dari itu, uang pakaian. Dan ia tidak mengambil rubiyat dan tidak aset sebesar 25 persen, analisa info pembiayaan sindikasi, transaksi valuta itu dari sisi emerging market, pertum- pangsa pasar, BSM terus menjalin juga bagai sosok makhluk yang dapat diternakkan menerima laba yang terlalu banyak. bank memberikan ilustrasi, aset per- asing, fasilitas untuk membeli produk buhan Indonesia juga cukup baik. kemitraan strategis dan menguntung- dan beranak pinak, berlipat ganda dalam waktu Bunga Menurut Yunani Dan Romawi bankan syariah harus mencapai angka instrumen investasi, dan di bidang Penandatanganan nota kesepa- kan dengan lembaga-lembaga di singkat. Nah, al-hasil, produk keuangan dengan berbagai Dalam catatan sejarah, peradabanYunani dimulai Rp57 triliun. Untuk pertumbuhan aset trade finance, serta remittance. haman antara BSM dan Deutsche dalam dan luar negeri. macam turunannya menghasilkan ekspansi kapitalisme dari abad VI SM hingga 1 Masehi. Saat itu telah terda- sebesar 75 persen perbankan syariah Penandatanganan kerjasama Bank dilakukan oleh Direktur Utama Sementara itu, Jamzidi Khalid dunia yang bersifat semu yang berbasis pada riba. pat beberapa jenis bunga dalam lalu lintas perda- harus mencapai aset Rp87 triliun. tersebut dilakukan dalam rangkaian BSM, Yuslam Fauzi dan Head of Is- mengatakan sebagai bank yang ber- Kondisi inilah yang sedang terjadi pada perda- gangan, sebut saja bunga pada pinjaman biasa, pinja- Sementarapada2007dengantum- kegiatan Indonesia Islamic Finance lamic Structuring non-Japan Asia pengalaman menyediakan produk gangan dunia saat ini. Perdagangan dunia memang man properti, pinjaman antarkota dan bunga perda- buhsebesar35,6persenasetperbankan Forum (IIFF) yang diadakan oleh Deutsche Bank, Jamzidi Khalid. keuanganyangsesuaisyariah,Deutsche sangat didominasi oleh praktik ribawi. Tak hanya pada gangan industri. Demikian juga pada masa Romawi syariah mencapai Rp36,5 triliun dan Kedutaan Besar RI untuk Kerajaan Sementara,penandatanganannota Bank terus mendorong pertumbuhan negera-negara sekuler tetapi juga di negera-negara (AbadV SM hingga IV Masehi). Saat itu, bunga memang pada tahun 2008 market share hanya Inggris dan Irlandia. Kegiatan diadakan kesepahaman antara BSM dan Bank industrikeuangansyariahglobal.Nota yang mayoritas Islam. Padahal, praktik perdagangan dibolehkannamundibatasidengantingkatbungatertentu, mampu menyentuh 2,08 persen. dalam rangka mempromosikan per- Mandiri (Europe) Limited London Kesepahamanyangkamitandatangani ribawi merupakan musuh setiap orang yang tanpa yakni bunga yang berlipat. Artinya, meskipun bunga Maka jika 2009 dan 2010 BI tetap kembangan keuangan Islam di Indo- dilakukan oleh Dirut BSM, Yuslam dengan BSM memungkinkan kami batas keyakinan, sebab hampir seluruh keyakinan diperbolehkan namun tidak boleh secara berlipat-lipat. optimis dalam mengejar akeselerasi nesia dan kelayakannya menjadi Fauzi dan Deputy General Manager membantu para mitra memenuhi agama-agama telah mengharamkannya secara tegas. Lebih lanjut, dua orang ahli filsafat Yunani terke- yang selama ini ditargetkan sangat sulit tempat untuk menanamkan investasi. BMEL, Brendan Battle. Penandata- kebutuhan manajemen aset dan li- Kalaupun ada orang (selain Islam) mengatakan bahwa muka, Plato (427-347) dan Aristoteles (322) sangat untuk dicapai. Dalam kegiatan tersebut BSM nganan kedua nota kesepahaman abilities, keuangan, serta investasi yang pengharaman riba hanyalah bagi orang Islam, hal mengecam praktik riba dan mengutuk orang-orang Terkait dengan hal tersebut, dia merupakan salah satu wakil lembaga tersebut disaksikan oleh Dubes RI un- efisientanpamelanggarprinsip-prinsip ini merupakan tabiat orang Yahudi untuk selalu Romawi yang mempraktikkan pengambilann bunga. tetapmemintapadabanksyariahuntuk keuangan Islam di Indonesia dalam tuk Kerajaan Inggris dan Irlandia,Yuri Islam, kata dia. memojokkan Islam dan tidak mengakui kebenaran. Plato mengecam bunga dengan dua alasan. Pertama, tetap serius untuk mengembangkan promosi tersebut. Sementara Direktur O Thamrin serta Global Market of Deutsche Bank, kata Jamzidi Pernyataan ini pernah disebutkan Allah dalam su- bunga menyebabkan perpecahan dan perasaan tidak bisnisnya dengan selalu mengedepan- Utama BSM, Yuslam Fauzi, merupa- Middle East and North Africa Deutche Khalid, telah berpengalaman dan rah Al-Nisaayat 161 Dan pengambilan mereka akan puas dalam masyarakat. Kedua, bunga adalah alat kan kualitas pelayanan dan kualitas kan salah satu pembicara pada semi- Bank, Manar Mahmassani, serta sukses melayani jasa keuangan sya- riba, pada hal sesungguhnya mereka telah dicegah golongan kaya untuk mengeksploitasi golongan miskin. produk yang ditawar kan. nar yang digelar di IIFF London terse- Direktur BSM Hanawijaya. riah global. Deutsche Bank juga aktif dari perbuatan itu. Para ahli tafsir mengatakan bahwa Sedangkan Aristoteles menyoroti bunga dari fungsi Kami rasa dengan rasa optimis- but. Dalam kesempatan itu Yuslam Nota kesepahaman antara BSM mempromosikan standardisasi pro- kalimat mencegahkan orang lain dari jalan Allah uang sebagai alat tukar. me bisa berhasil menggapainya, menguraikan tentang perkembangan dan Deutsche Bank berisi kesepa- duk keuangan syariah di dunia bermakna berpaling dari jalan hidayah ajaran agama. Menurutnya, uang bukanlah alat untuk meng- paparnya. Di sisi lain perkembangan danpotensipasarmodaldankeuangan katan untuk bekerjasama khususnya internasional dan berpengalaman Memang secara perlahan terlihat orang diluar hasilkan tambahan melalui bunga. Bunga sebagai pangsa pasar Bank Syariah Mandiri syariah Indonesia. dalam arrangement pembiayaan sebagai arranger dalam structur- Islam telah mengakui virus riba yang begitu dahsyat uang yang berasal dari uang yang keberadaannya (BSM) akan semakin meluas. Sebelumnya Direktur Utama BSM sindikasi, transaksi valuta asing, fa- ing produk investasi syariah dan juga menghancurkan sendi-sendi perekonomian, hal ini dari sesuatu yang belum pasti terjadi. Dengan demi- Tidak hanya berkembang dalam menghadiri acara The 5th Islamic silitas untuk membeli produk instru- manajemen risiko. ditandai dengan semakin diminatinya sistem ekonomi kian pengambilan bunga secara tetap merupakan negeri bank umum syariah terbesar FundsWorld di Dubai. Pada acara yang men investasi, serta di bidang trade Brendan Battle mengatakan sa- syariah di seluruh dunia. Walaupun lebih didasarkan sesuatu yang tidak adil. di Indonesia itu semakin melebarkan digelar 2-4 November 2009 itu, Dirut finance. Adapun kesepakatan antara ngat bangga bisa bekerjasama dengan faktor untung-rugi, namun ekonomi syariah telah Sedangkan ahli filsafat Cicero memberikan dua sayapnya hingga ke luar negeri, dian- BSMmerupakanpembicarasatu-satu- BSM dan BMEL adalah kesepaha- BSM. Dia mengatakan industri ke- menjadi alternatif sistem ekonomi dunia yang efektif ilustrasi yang menyatakan bunga adalah sesuatu yang taranya kawasan Timur Tengah dan nya dari Indonesia. Dirut BSM menga- man untuk bekerjasama dalam uangan syariah merupakan industri menghapus ketidakadilan ekonomi. Nah, tulisan ini hina dilakukan. Menurut Cicero bahwa perdagangan Eropa. takanpotensipengembanganekonomi bidang pembiayaan sindikasi, remit- yang menarik untuk dipelajari. Apalagi, ingin menegaskan bahwa betapa seluruh agama secara adalah suatu pekerjaan yang tentu mempunyai resiko, Belum lama ini, Direktur Utama syariah di Indonesia sangat besar. tance, dan trade finance. di Inggris industri ini juga sedang tegas mengharamkan praktik riba ini. Adapun sebagian maka memberikan pinjaman dengan bunga adalah BMS, Yuslam Fauzi telah melakukan Hal-hal yang dianggap sebagai Menurut Yuslam, kesepahaman berkembang.(m13) besar rujukan tentang pengharaman riba bagi agama- suatu yang tidak pantas dilakukan. Karenanya, agama kebanyakan penulis kutip dari Tafsir Al-Quran hukuman yang pantas adalah jika bagi pencuri didenda Ketua (FPU) Sumut Ahmad Yani bin H. Abdul Hamid karya Ulama Tiga Serangkai. dua kalimat, sedangkan pemakan bunga akan didenda Larangan Riba dalam Agama Yahudi empat kali lipat. Transparan Membuka Rahasia Ilahi, Menerobos Ternyata, kitab Taurat dipenuhi ayat yang melarang mengambil harta riba. Larangan memakan harta riba Bunga Menurut Kristen Dalam Lukas 6:34-35 terdapat sinyalemen menge- Isra Dan Miraj Tatkala Menegakkan Shalat diperoleh melalui ajaran nabi orang Yahudi. Lihat saja dalam Kitab Keluaran XXII : 25 disebutkan: Jika cam praktik pengambilan bunga. Dan, jikalau kamu meminjamkan sesuatu kepada orang karena kamu kamu memberi pinjam uang kepada umatku, yakni berharap akan menerima sesuatu darinya, apakah SATU lagi pemahaman dan pene- kepada orang misikin diantara kamu, maka jangan jasamu? Orang-orang berdosa pun meminjamkan Menjadi Modern Bersama Islam muan baru buat umat Islam Via HP kata Ahmad Yani, kita bisa merasakan Isra kamu seperti penagih hutang yang keras dan jangan kepada orang berdosa supaya mereka menerima ambil bunga dari padanya. kembali sama banyak. Tetapi kamu, kasihilah musuh- Modern dapat dipandang dari berbagai sisi: Sebagai setting waktu dan Miraj di kala kita mempergunakannya, Demikian juga dalam kitab Imamat XXV: 35-37 mu dan berbuat baiklah kepada mereka dan pinjam- modern dapat dipahami sebagai era modern dimana umat manusia bicara tentang Ilmu Ketuhanan dan Kaji juga disebutkan: Maka jika saudaramu telah menjadi kan dengan tidak mengharapkan balasan, maka upah- memasuki abad baru yang dimulai antara abad ke 17 dan 18. Modernitas Diri serta membuang kebesaran mahluk miskin dan tangannya gemetar, maka hendaklah mu akan besar dan kamu akan menjadi anak-anak dapat dipahami sebagai kondisi dan situasi kemodernan dunia yang sering di dalam hati dan memasukkan kebesaran engkau memegangnya, jikalau ia seorang pedagang Tuhan yang maha tinggi sebab iIa baik terhadap orang- disebut sebagai abad difungsikannya akal secara maksimal (the Age of Allah di dalamnya. Dimulai dari terbitnya atau orang menumpang sekalipun, bolehlah ia hidup orang yang tidak tahu berterimakasih dan terha- Reason) atau abad pencerahan (Enlightenment). Semenatara proses berita tersebut, tanggal 13 hari Jumat, bersamamu (35). Maka janganlah kamu mengambil dap orang-orang jahat pemodrenan dunia, aktualisasi pemikiran, dan upaya mengadaptasi agama sampai saat ini, penulis dihubungi, pihak bunga atau laba yang banyak, maka takutlah kamu Ayat Lukas ini memang tidak tegas mengharamkan dan budaya dengan kemodernan duniadiistilahkan sebagai modernisasi, penelepon dari Batu Bara atas nama Mu- kepada Allahmu, supaya saudaramu juga dapat hidup praktik pengambilan bunga namun sebagian besar yang dalam bahasa Arab padanannya digunakan istilah tajddatauishlh. hammad Nasir mengatakan, setelah bersamamu.(36). Jangan kamu memberikan uangmu pendeta Kristen mengharamkan bunga. Pendeta Kemodernanduniatelahmenimbulkankrisisbagi umatberagama, karena membaca tulisan Transparan MRI, dalam kepadanya dengan memakan bunga, dan makananmu Kristen menganggap orang yang memakan bunga modernitas lahir di luar gerakan dan aktifitas keagamaan. Modernitas bahkan pengakuan diri Mhd Nasir kajian tersebut pun jangan kamu berikan kepadanya dengan sebagai orang yang tidak berprikemanusiaan. Bahkan pernahberhadapandengankalanganagamawankarenadianggapmempercayai sangat bermanfaat katanya, setelah mem- mengambil untung. (37). larangan telah praktik riba ini dimasukkan dalam suatu kebenaran diluar kebenaran agama (double truth). Muncullah sekular bacanya, hatiku sejuk sedunia rasanya. Sedangkan dalam kitab Ulangan XXIII: 19 dan 29: Undang-undang. (Syafii Antonio, Bank Syariah). isme, kemodernan berjalan di luar jalur agama. Karena kemodernan dunia Padahal kata Mhd. Nasir, sebelum itu niat saya dalam dua hari ini, mau Maka tak boleh kamu mengambil bunga dari saudara- Keyakinan agama-agama tentang keharaman tersembul di luar agama, maka bagi umat beragama hanya ada dua pilihan: lari dari kampung. karena terlilit masalah. Maklumlah katanya awak ini pedagang, mu, baik bunga uang, maupun bunga makanan, baik praktik riba menunjukkan bahwa riba adalah musuh sejalan dengan modernitas atau mati. akhirnya saya jadi berjiwa besar menerima kenyataan hidup ini. bunga suatu barang yang dapat bunga. Maka dari semua manusia, terutama musuh kesejahteraan dan Krisis yang dihadapi umat beragama itu dilukiskan Joseph L. Blau sebagai Lain halnya dari penelepon yang ke dua dan seterusnya. Dalam penga- bangsa lain boleh kamu mengambil bunga, tetapi dari keadilan. Sebab riba jelas-jelas penyebab kesengsaraan berikut:Seluruhagamabesartelahmenghadapikrisissejaklahirnyaperadaban kuannya pekerjaan sebagai pelayan hotel di Padang Bulan mengantarkan pada saudaramu, maka tak boleh kamu mengambilnya. manusia itu sendiri. Kekhawatiran PBB tentang kondisi baru. Setiap agama telah mengerahkan segenap kemampuannya untuk orang masuk ke kamar untuk berbuat maksiat/mesum. Pengakuan Menurut jumhur ulama Ushul sebagian dari nabi kemiskinan dan kelaparan dunia sesungguhnya memecahkan krisis dan menghadapi kehidupan modern dengan sekularisme penelpon tersebut sedemikian tulusnya. Setelah membaca tulisan Transparan yang diutus kepada bani Israel telah melarang riba disebabkan (salah satu faktor) terbesar adalah praktik yang menempel padanya. Abad ke 19 dan 20 telah menyaksikan babak MRI pada tanggal 13 lalu, saya tersentak dan tersentuh seraya mengatakan, ribawi yang mendominasi perdagangan dunia. kepada seluruh manusia. Larangan itu tidak ditentukan baru di dalam agama-agama. Agama-agama harus memilih; Sejalan dengan saya segera akan berhenti bekerja, karena saya merasa sangat berdosa Pertanyaannya, mengapa sistem ekonomi yang hanya kepada orang Israel saja ataupun tidak kepada zaman modern atau mati. (Lihat Joseph L. Blau, 1966). selama ini. Apalagi penulis ada mengatakan pada hakekatnya diri manusia berbasis ribawi itu tetap dipakai? Wallahualam. kaum mereka saja. Nabi Daud as. juga telah menye- Sejalan dengan itu maka umat Islam harus mengadaptasi agama dan itu bagai bangkai berjalan. butkan dalam kitabnya Mazmur (Zabur) pada XV: Penulis adalah Dosen Fakultas Syariah IAIN- keberagamaannnya untuk memposisikannya secara benar. Pekerjaan besar Sungguh, sangat luar biasa respon dari pelanggan setia Waspada jumlah 5 : Maka tiada yang menjalankan uang dengan makan SU dan Sekolah Tinggi Ilmu Hukum (STIH) Graha ini didefenisikan Fazlur Rahman sebagai usaha-usaha untuk melakukan penelepon dan SMS sangat banyak. Dari Lhokseumawe, Langsa, Banda harmonisasi antara agama dan pengaruh modernisasi dan wetsernisasi yang bunga dan tidak boleh makan suap akan melawan Kirana Medan. Aceh, Rantau Prapat, Pangkalan Brandan, Tebing Tinggi, Binjai, dan lain- sedang berlangsung. (Fazlur Rahman, Islam.). lain, Medan dan sekitarnya. Pada prinsipnya sangat bermanfaat buat orang Dalam hal ini umat Islam menghadapi dua problem. Pertama, seringkali lain, khususnya para pembaca setia Waspada. Awaluddin Marifatullah: Awal banyak umat, karena ingin terlihat dan disebut modern lalu meninggalkan mengenal Agama, mengenal Allah. Dalilnya 25 Nabi yang diutus Allah di dan melanggar dan mengesampingkan agamannya. Kedua, sebagian umat muka bumi, Kerjanya Berdakwah Menyebarkan Agama (Siar). Awal-awalnya sangat lamban dalam mengadaptasi agama dan keberagamaannya. Lilihat para Nabi berdakwah mentauhidkan Allah SWT, kepada umat pengikutnya. misalnya masihadaagamawanyangmenjelaskan bahwasiapayangmenyembelih Lanjut kita ke kaji diri, empat anasir atau unsur. hewan kurban, maka hewan kurbannya tersebut akan menjadi kenderaannya Di tubuh kita ada mengandung unsur air keringat dan seterusnya. Di kelak menuju sorga. Suatu penjelasan agama yang sangat tidak relevan dengan kecanggihan teknologi saat ini. tubuh kita ada mengandung api, jika seorang manusia sedang marah, maka wajah dan matanya merah terbakar api amarah. Di tubuh kita mengandung Pemimpin Ramis Pisang Banyak ahli yang menyayangkan kelambanan itu. Hasan Hanafi, angin, bersiul, dan seterusnya. Tubuh kita mengandung tanah, jika manusia menyebutkan bahwa kekalahan kontemporer pada sasarnya adalah kekalahan rasional di samping kekalahan militer. Oleh karenanya gerakan menggosokkan tubuhnya dengan keringat yang ada, akan terjadi gempalan Oleh H. Syarifuddin Elhayat kecil, seperti daki. Syariat perbuatan, hakekat kenyataan yang hakiki, tarikat yang hakiki sekarang ini adalah gerakan pemikiran dan peradaban, yang jalan, marifat sampailah dia dengan dirinya sendiri. (Tubuh) kerjanya dalam urgensinya tidak lebih kecil dari gerakan ekonomi atau gerakan militer. Sholat Tu ma ninna/ gerakan dalam Sholat Ruku dan Sujud. Diri yang terjadi Satu kali seorang kakek ber- menerus bertahan pada posisinya, Yang amat dibutuhkan sekarang ini adalah proyek otentisitas dan modernitas (Hati) kerjanya di dalam Sholat, mentasdiqkan/ mengartikan yang dibaca. cerita pada cucunya tentang sosok tanpa mau memberikan kesem- yang sampai sekarang merupakan faktor kekalahan umat yang beturut- Diri yang terperih (nyawa) kerjanya di dalam sholat m elafaskan, pemimpin. patan pada yang lainnya, padahal turut. (Hasan Hanafi, Al-Turs wa al-Tajdd). membaca bacaan yang dibaca. Diri yang sebenar-benarnya diri, (Rahasia Kata sang kakek,Kalau jadi sesung-guhnya sang ramispun Sedianya umat Islam menjadi komunitas yang paling cepat dan banyak Ilahi) itulah yang berhubungan langsung dengan Allah, tanpa perantara. pemimpintu meskipun ada keku- sudah tak ada manfaat lagi kecuali menganmbil manfaat dari kemodernan dunia. Seperti disebut Ernest Gellner Inilah yang disebut sholatnya orang mukmin itu Miraj. Sampailah ke rangan tapi harus banyak kele- hanya menyemak. meskipun umat Islam tidak berhasil menerobos zaman dan mempelopori tingkat atas Isra dan Miraj. bihan,antara lain harus memper- Sederhana memang,-cerita umat manusia memasuki abad modern, tetapi karena watak dasar Is- Tenggelamlah kita di lautan Marifat yang fana. Antara sifat dan dzat, siapkan kader dan generasi peng- klasik yang saya rekamkan diatas, lam itu (yang sangat dinamis) kaum mslimin menjadi komunitas yang ketika kita mempergunakan sifat manusia yang lemah ini, kita akan merasai ganti, agar kepemimpinan berlanjut tapi setelah kita renung-renung, paling besar memperoleh manfaat dari kemodernan dunia. (Ernest Gellner, tidak ada apa-apanya di hadapan Allah. Kemudian sampailah kita ke tingkat langgeng, jangan jadi pemim- sangat dalam maknanya kalau Muslim Society, 1981). Dzat. Ternyata ada yang hidup tak berkesudahan dan ada yang dihidupkan pintu macam pemimpin ramis dikaitkan dengan pemimpin dan AdalahsangatmenarikbahwaRasulullahSaw.,memujiumatyangmampu dan dimatikan. Apa lagi yang mau kita sombongkan di dunia ini? Kalau pisang,. Ada beberapa pohon kepemimpinan. Sayapun coba- mengenalidanmengantisipasiperkembanganzaman,danbahkanmemimpinnya, sudah sejauh ini kepahaman kita. Orang yang berilmu banyak, orang yang yang dijadikan Allah multi man- coba melirik kebenaran cerita itu dengantetapkonsistenpadaajarankebenaran,sebagaimanasabdanya:Allah bertitel sangat banyak, tapi orang yang mau sampai ke tingkat pemahaman faat.Seperti Kelapa, hampir seluruh dengan orang-orang sekitar saya. menyayangi orang yang memelihara lidahnya, mengenal (kondisi) zamannya, apa yang ada bisa dimanfaatkan, Ada juga benarnya. Ramis ilmu ketuhanan sedikit sekali jumlahnya. dan tetap konsisten di jalan hidupnya. (H.R. Dailami). batangnya bisa buat papan, urat pisang, sejak dari muda hingga Umat Islam kenyataannya kita lihat berpecah belah, seandainya umat Oleh karenanya menjadi modern bersama Islam, mengadaptasi agama akarnya bisa jadi obat dan sapu, pelepah menjadi kayu senja bahkan sudah hampir tengge-lampun usianya Islam mau merasa bahwa kita satu ikatan, satu dzat, satu sifat dan satu rasa, dan keberagamaan agar Islam dapat memimpin kemodernan dunia, bakar, daunnya pembungkus ketupat, lidinya menjadi dari muka dunia ini, masih ada orang yang tanpa satu badan. Pastilah manusia tidak akan pernah mau merasa paling baik merupakan agenda umat paling signifikan, melebihi agenda-agenda parsial sapu, sabutnya bisa menjadi pembakar alas kaki, batok ragu bertahan untuk tetap menjadi pemimpin disatu dan paling benar. Atas kejadian itu semua, akhirnya mereka terjebak lebih lainnya . Wa Allhu Alamu bi al-Shawb. tempurungnya jadi arang, isinya jadi santan dan pohon dan tidaklah mau meng-alihkuasakan pada mementingkan organisasi daripada persaudaraan dalam Islam. Ada satu kelompokmerasakelompoknyayang palingbenar. Sesungguhnya,hatinyaorang ampasnya juga bisa berguna. Poko e tak ada yang yang lain. yang beriman, lebih senang diejek daripada di puji. terbuang percuma. Bahkan diapun berusaha menumpuk ramis-ramis Penampilan dan pemahaman hakiki umat Islam sangat dinanti oleh Sankin manfaatnya kelapa, maka okhang kam- yang lain hingga orangpun memberi gelar, waala dunia. Kita lanjutkan untuk mencapai sampai ke tingkat mengenal Allah. pungpun sekhing berpesan pada generasinya, jadilah Alihi wa shohbihi ajmain, Auma nabotulna, anggo Sebelumnya kita harus mengenal dahulu diri kita sendiri. macam kelambikh (kelapa) pokoknya (pohon) tahan inda au inda adong iAmbelah yang iyenye,kalau 99 Nama Allah. Barangsiapa yang bisa mengenalNya, bukan hanya terpaan angin, dan seluruh kelapa beri manfaat,. Begitu tak ambe tak ade tu semuo, tapi saat ditanya pro- sekedar sebuah nama. Dialah Mukmin yang sebenar-benarnya Mukmin. kata sang kakek gram,diapun njawab,inda dong i , kecuali adong Di sini pengkajian kita baru sampai ke tingkat mengenal diri. Belum lagi sampai Salah satu satu pohon yang lain adalah pohon dibuku ,mana ambe tau, ajang ambe ado dalam ke tingkat sebenar-benarnya diri. Naiknya nafas k ita itu, dua kali, yang kita pisang. Kelehlah (Lihatlah) pohon pisang nen. buku yen (tak ada sama sekali kecuali hanya dalam rasakan ketika naik Hu (Artinya Dia). Waktu turunnya nafas kita satu kali, Batangnye bisa buat tali,- umbutnye sedap disayukh, catatan saja) he-he,afwan ya Ncek, ana hanya yang kita rasakan berkata Allah. Allah Itu sendiri yang berkata-kata, tak berbunyi daun mudanya jadi pembungkus, jantungnya ngutip anekdot saja. dan tidak bersuara. Tak usah pun disebutkan Hu Allah, Dia sendirilah yang bermanfaat, buahnye tak ada yang tak mau makan, Ada figur yang ana lihat, sejak dari S-1 hingga bisa berkata-kata dengan Kalam-Nya. Itulah yang disebut, yang sebenar-benarnya palagi gokheng dan kolak.Alah-alaaah, pokoknye banyak nambah-nambah S jadi 4 S alias Senang melihat diri kita. (Rahasia Ilahi). manfaatlah. orang Susah dan Susah melihat orang Senang nya, Selama ini tanpa disadari oleh umat Islam dan umat di luar Islam. Tapi, ada satu yang tak sedap,pelepah pisang tetap bertahantenggger di papan nama bahkan hingga Sepanjang hayat di kandung badan, terus menerus Dia berdzikir menyebut- dengan daunnya yang dah tuha (tua).kata orang 3 Profnya,ampun tuan, maksud ana dengan 3 nyebut nama Allah dengan sendiriNya : Allah Hu Allah, dan seterusnya. namanya, ramis pisang, Lihatlah ramis pisang, Proftu, sejak dia pengedar Proposal,(ketika muda) Akal kita tak mampu dipergunakan di sini. Rasa lebih tinggi, dari pada akal. sejak daunnya masih muda bulat hingga terkembang jadi tenaga Profesional (karena matang) hing- Kalau Akal bisa diakal-akali. Tapi, kalau rasa tak bisa dibohongi. Siapa yang menghijau, kuning bahkan hingga merah dan menua,- ga akhirnya jadi Provokator (pemecahbelah) bilang bisa, merasa bahwa, garam itu manis seperti gula rasanya, atau sebaliknya. tidaklah mau meninggalkan batangnya.Dia akan tetap untuk mempertahankan diri agar dia tetap men- Jika sesungguhnya gula itu sendiri kita rasakan manis, Syariatnya, bertahan walau dimakan usia, ramis pisang tidak jadi ramis pisang. Layanan Haji: GM Customer Retention Management Telkomsel HelmiWahidi yang merasakan manisnya gula itu, adalah lidah sebagai alat perasa. Pada akan pernah melepaskan diri dari pohonnya, kendati Ah,sohibku,kalau ndak jadi pemimpin, yaa memasangkan rompi pada salah satu karyawan bertugas di posko pelayanan hakekatnya yang merasai manis gula adalah Dzat, dengan sendirinya memang digoncang badai, dia akan tetap bertahan, koyak-koyak itu bagus,sebab Rasulpun menyebut, Kullukum pelanggan Telkomsel di Tanah Suci. Selain menghadirkan posko pelayanan, sifat gula adalah manis. dan koyak.namun tetap berpegang di batang. Rooin wa kullukum mau ulun an roiyatihi,Setiap info layanan haji *123#, dan call center berbahasa Indonesia, pada musim Jika manusia itu sendiri telah tiada rasa dan merasai adanya Dzat-NYa Jadi, kata sang kakek, meskipun engkau bisa meniru kamu (kita) adalah pemimpin,dan kita,kata Rasul haji tahun ini Telkomsel juga memberlakukan tarif hemat hingga 70% Allah, maka meninggal dunialah manusia tersebut. Air, Api, Angin, Tanah pisang, tapi jangan sampai menjadi ramis pisang, akan mempertanggungjawabkan seluruh apa yang dari tarif normal bagi pelanggan yang sedang berada di Tanah Suci, antara pulang ke asalnya, diri yang sebenar-benarnya diri pulang dengan sendirinya. tak elok, tak beri kesempatan pada daun yang lain kita pimpin, tapi jangan-jangan jadi pemimpin lain nelpon super hemat ke Indonesia hanya Rp 5.000/menit bagi pelanggan Inna lillahi Wa inna Ilaihi Rojiun. Bagi yang ingin berkonsultasi hubungi untuk bertengger.kalau jadi pemimpin janganlah ramis pisanglah.tak elok tuan.Dahahh,Afwu prabayar, tarif layanan data Rp 47/kb, bahkan gratis terima SMS.(m09) HP 08126306400 /061-69638443. (rel) . sempat jadi pemimpin ramis pisang, yang terus minkum.- 11. 14 Mimbar Jumat WASPADA Jumat 20 November 2009 Arafah dari Marifat Al-Nafs Menuju Marifat Allah A l-Hajju Arafah. Haji itu Ara- syar atau negeri kesadaran. Di sini Oleh Azhari Akmal Tarigan fah.Puncakhajisesungguhnya ketika calon haji melaksana- mereka lalu berhenti. Ali Syariati melanjutkan, sesudah Nabi Berhaji Potong 100 Unta kan wukuf diArafah.Waktunya sangat tahappengetahuan (Arafat) berikut- singkat. Mulai dari tergelincirnya bermanfaat dan menjurus kepada nya tahap kesadaran (Masyar). Aneh- Sangat baik jika para calon haji matahari sampai terbenam matahari. perkataan atau perbuatan yang tidak kah jika pengetahuan ada terlebih yang kini berkumpul di Makkah, men- Mazhab Hanbali berpendapat, waktu- senonoh (rafast, jidal dan fusuq), dahulu daripadakesadaran ? Manu- jelang wukuf, meniru cara Nabi Mu- nya sejak terbit fajar. Sedangkan menu- mutlak dihindari. sia mengira bahwa kesadaranlah yang hammad SAW berhaji. rut mazhab Malik, keberadaan diAra- Namun lebih penting dari itu, di terlebih dahulu, tetapi sang pencipta Disebutkan,Rasulullah SAW melontar fah harus mencakup sebagian waktu rafah-sesuai dengan namanya arafa, A memperlihatkan urutan yang sebalik- siang dan malam. Bahkan di dalam nya. Adam bertemu dengan Hawa jumrah Aqabah tujuh kali dengan dise- marifat- calon haji diharapkan dapat mazhab Syafii, wukuf telah dinilai sah kembali mengenali dirinya. Menyadari (yang memiliki jenis kelamin yang lingi takbir Allahu Akbar yang dilakukan dengan keberadaan calon haji di lokasi hakikat kemanusiaannya dan meref- berbeda). Mereka bertukar pendapat dari arah BathnulWadi Mina, Rasulullah Arafah walaupun hanya sekejap (di leksikan perjalanan hidup yang telah dan akhirnya saling memahami. Kehi- SAW pergi ke tempat pemotongan hewan dalam waktu yang telah ditetapkan). dilaluinyaWukuf sesungguhnya akti- dupan individual mereka berakhir de- kurban yang letaknya tidak jauh dari Ini menunjukkan pentingnya Arafah mendengar. Jika kita terus menerus vitas berdiam diri. Berdiam bukan ngan terciptanya sebuah keluarga jumrah itu. dalam prosesi haji. beraktifitas, bergerak, bekerja, kapan dalam makna tidur. Memang saat (institusi sosial terkecil) dan suatu cinta Didalam Bahasa Arab ada perbe- kita berkontemplasi, merenung ten- wukuf,fisiktidakbekerjasepertithawaf, yang sadar. Selanjutnya; persatuan di Nah, mau tahu apa yang dipebuat daan kata arafa dengan alima(ilmu) tang diri dan alam. saiataumelemparjumrah.Saatwukuf, antara dua orang manusia bermula Nabi SAW: Tidak tanggung-tanggung, kendatikeduanyadapatditerjemahkan Oleh sebab itu wukuf di Arafah yang bekerja adalah qalbu dan akal. denganpengetahuan.Evolusipengeta- Rasulullah SAW mengurbankan 100 denganmengetahui.Kataalimadengan harus hayati sebagai kontemplasi, Kendati di Arafah, di mana seluruh huan menimbulkan kesadaran di ekor unta yang 63 ekor di antaranya di- segalabentukderivasinyasebagaimana berdiam diri, merenung dan memi- jamaah haji yang jumlahnya lebih dalam diri manusia. Kemudian lahirlah sembelih/dipotongnya sendiri, sedang- yang disebutAl-Raghib Al-Isfahaniber- kirkan tentang sesuatu agar kita kurang 2 juta orang berkumpul dalam sains yang meningkatkan pengertian kan yang 37 ekor sisanya diserah- makna pengetahuan akan hakikat se- memperoleh kearfian. Saya teringat waktuyangsamanamundisaatwukuf dan - untuk selanjutnya meningkat- suatu. Sedangkan marifah adalah dengan firman Allah di dalam surat kita harus mampu merasakan kehe- kan kesadaran manusia. Apakah aki- kannya kepada Ali bin Abu Thalib. pengetahuan yang diperoleh melalui Fushilat ayat 51 yang artinya: Kami ningan dan kesyahduan. Seolah yang batnya ? Ali Syarati berteriak, Kema- Kemudian Rasulullah SAW menyu- proses pemikiran dan perenungan akan memperlihatkan kepada me- ada di Arafat hanya Aku dan Allah. juan ilmiah!!!. (Ali Syariati , 2000: 64). ruh para sahabat mengambil sepotong terhadapgejalaataufenomenasesuatu reka tanda-tanda kekuasaan kami Kita juga tidak boleh sibuk dengan Jelas bahwa pengetahuan adalah daging dari setiap kurban unta yang dibawa Ali dariYaman itu. Selesai melaksanakan pemotongan yangdicermati.Karenaitudidalambaha- di segenaf ufuk dan pada diri mere- amalan orang lain. inti dari Arafat. Pengetahuan yang saArab,pengetahuanTuhanakanmakh- ka sendiri, sehingga jelaslah bagi Ali Syariati di dalam bukunya yang dimaksud di sini bertingkat. Pertama, hewan kurban, Rasulullah SAW kemudian mengendarai untanya meninggalkan Mina menuju luknyadigambarkandenganungkapan mereka bahwa Al-Quran itu adalah sangat fenomenal,Haji, menjelaskan pengetahuan tentang diri sendiri atau Masjidil Haram, Makkah, untuk melaksanakan tawaf Ifadah yang juga disebut tawaf rukun karena alima. Sebaliknyapengetahuanmanusia benar. Dan apakah Tuhanmu tidak dengan sangat baik makna tiga tempat yang disebut dengan marifat al- merupakan bagian dari Rukun Haji yang tidak boleh ditinggalkan. akan Tuhannya diungkapkan dengan cukup (bagi kamu). singgah,Arafah, Masyar (Muzdalifah) nafs. Pada fase ini, melalui perenu- Rasulullah SAW melakukan shalat zuhur di Masjidil Haram kemudian mendatangi dan dijamu kataarafah karena diperoleh melalui Sungguh ayat Allah begitu nyata danMina.Arafatberartipengetahuan ngan terhadap eksistensi alam raya, minum oleh Bani Abdul Muthalib yang mengurus air zamzam. perenungan terhadap tanda-tanda baik itu di jagad raya ataupun di dalam dansains. Masyar berarti kesadaran akan menghantarkannya pada penge- Bagi kita yang mampu hendaknya bisa meniru cara berkurban Nabi Besar Muhammad SAW. kekuasaannya. (Mukhlis Hanafi: 2006). diri manusia sendiri. Namun sayang- danpengertian.SedangkanMinaberar- tahuan terhadap Allah. Kedua, adalah Selama di Arafah, jamaah haji nya tidak semua orang menemukan ti cinta dan keyakinan. Ketiga Simbol pengetahuan tentang Allah (marifat Tapi, sudah adakah di antara kita (umat Islam) yang melakukannya? Hingga saat ini belum mencoba untuk wukuf dan marifat. kejelasan (tabyin)tentang hakikatnya, di atas dengan cukup mengesankan Allah). Seseorang yang berhasil me- pernah terdengar ada yang meniru cara haji Nabi SAW tersebut. Sekadar catatan: memotong 100 Wukufbermaknaberhenti.Berhentitidak sehingga ayat Allah yang tampak di digambarkanAliSyariatdenganmeng- ngenal dirinya (marifat al-nafs) akan ekor unta kalau dikalikan Rp10 juta per ekor berarti sama dengan Rp1 miliar. sajadalammaknagerak,tetapjugadalam alam ini tak menambah keimanan ungkap derama kosmis Adam dan mengenal Allah. inilah ungkapa yang [HM Iwan Gayo, Buku Pintar Haji & Umrah, penerbit Pustaka Warga Negara, 1999, Ja- arti memberhentikan hati dan pikiran mereka. Jagad raya yang terhampar Hawa. Bukankah Jabal Rahmah, men- terkenal di dalam ilmu tasawuf, man karta Timur]. dari memikirkan dunia. Wukuf juga luas saja tak membuat mereka sadar jadi saksi pertemuan Adam dan Hawa. arafa nafsah arafa rabbah (siapa bermakna bersunyi diri dalam kera- tentangal-haq, apa lagi ayat Allah yang Pertemuan yang melahirkan penge- yang mengenal dirinya akan menge- maian. Kendatipun di arafah kita tetap berinteraksi dengan banyak orang, namunharustetapmampumerasakan keheningan dan kesenyapan.Wukuf tertulis di dalam kitabnya. Merekalah orang-orang yang belum melakukan wukuf dan marifat. tahuan diri, kesadaran dan cinta. Mengapa calon haji harus wukuf di Arafat di tengah teriknya matahari pada 9 Zulhijjah ? Ali Syariati menulis- nal Tuhannya). Terkadang, di dalam hidup ini, kita tak mengenal diri kita yang sebe- narnya. Topeng yang kita kenakan Idhul Adha Dan FalsafahNya Ada satu hal yang menarik untuk sejatinya harus dimaknai dengan direnungkan. Ternyata tidak ditemu- kan di dalam bukunya, Ketetapan ini kerap membuat kita tak pernah me- ( Bagian 1 ) mendengarkan bisikan Tuhan. kan satu hadis yang valid mengenai dimaksudkan agar engkau mempero- nyadarihakikatdiri.Akibatnya,perilaku Selama ini mungkin kita termasuk amalan khusus selama melaksanakan lehkesadaran,wawasan,kemerdekaan, rafast, jidal dan fusuqa, tak terhin- Dan al Quran ini adalah kitab yang telah Kami turunkan yang diberkahi, orang yang terlalu sibuk memikirkan wukuf di Arafah. Artinya, calon haji pengetahuan dan cinta di siang hari. darkan. Ketika kita melakukan tiga membenarkan kitab-kitab sebelumnya, dan agar kamu memberi peringatan dunia. Kita terlalu mengejarnya, me- dibebaskan untuk beramal sesuai apa Begitu matahari terbenam, maka wu- bentukperbuatanterlarangitu,sesung- kepada penduduk ibu negri dan sekitar nya... Q.s. al An am ayat 92. ngumpulkan harta melebihi apa yang yang diinginkannya.Tentu saja selama kufdi rafahitupunberakhir.Taksesua- A guhnya kita sedang kehilangan kesa- kita butuhkan, memburu jabatan yang tidak ada larangan. Jamaah haji bisa tupun dapat terlihat di dalam gelap; daran eksistensial. Pada gilirannya kita sebenarnya didorong oleh nafsu ber- menggunakan momentum wukuf sebagai akibatnya di dalam kegelapan juga tidak akan pernah mengenal Allah Oleh Fachrurrozy Pulungan kuasaketimbanguntukmengabdipada untuk berdoa dengan suara hati, ber- tidak ada perkenalan dan penge- SWT. Jika demikian, bermaknakah kemanusiaan. Akibatnya kita tidak zikir, membaca ayat suci Al-Quran, tahuan ! bersama-sama dengan kehadiran kita di muka bumi ini. untuk menyatu dengan asal kejadian M pernah wukuf. Tidak pernah berdiam membaca buku yang menambah matahari Padang Arafat yang se- Penulis adalah Koordinator Tim emahami Idul Adha diri, menahan untuk tidak bicara apa pengetahuan dan ketakwaan, bahkan dang terbenam, orang-orangpun Penulis Tafsir Al-Quran Karya Ula- sama artinya menguak kita, bumi dan nabi Adam as, dan lagi beraktivitas. Sederhana saja, jika mendengarkan tausiyah dan bermu- bergerak kearah Barat. Mereka te- ma TIga Serangkai dan Dosen Fak. falsafah haji dalam Is- dari sanalah kita akan sampai pada kita terus berbicara kapan kita akan zakarah(diskusi).Perbuatanyangtidak rus berjalan hingga sampai ke Ma- Syariah IAIN-SU. lam yang membutuhkan dua pe- asal segala sesuatu, yaitu Allah SWT. mahaman yaitu; pertama, Mak- Pada tanggal 9 (sembilan) Zul- kah sebagai proses awal kehidu- hijjah jamaah haji datang dari pen- Berqurban Sebagai Sarana Taqarrub Ilallah pan dan kedua, sejarah Nabi Ibra- him as. Karena praktek-praktek ritual ibadah haji juga berkaitan juru dunia berhimpun pada tempat yang istimewa di padang Arafah. Suatu kebahagian yang mereka terima, dimana seluruh manusia dari erat dengan prilaku beliau dan ke- luarganya serta tempat-tempat belahan bumi ini, tiada kenal rupa H ari Raya Idul Qurban akan hadir kembali ditengah- tengah umat Islam. Keha- diran hari raya Idul Adha membawa Oleh Drs. H. Asad Marlan, M.Ag him AS sambil terus berdoa agar di- anugerahi keturunan yang shaleh. Doanya:YaTuhankami(Allah)berikan kabar baik dengan lahirnya anak yang penting yang mereka lalui. Menurut Abbas Qararah dalam kitabnya al Din wa Tarikhu al Hara- main al Syarifain mengtip hadis yang dan bangsa, suku dan marga, miskin dan kaya, tidak ada lagi perbedaan disini, tidak ada beda antara presiden dengan pesinden, tidak ada perbe- pesan kepada umat manusia untuk Kabah. Menyaksikan ritual al jahiliyyah berbudi luhur dan sabar (Ismail). (QS. sejenak merenungkan kemudian ini, para sahabat mengajukan per- Ash-Shaffat : 100-101). diriwayatkan oleh Ibnu Abbas dan daan antara ibu ratu dengan seorang mengambil pelajaran terhadap peris- mohonan kepada Nabi Muhammad Allah mengabulkan doa Nabi Ibnu Qutaibah-dua mufassir terkenal menyebutkan pembantu, antara jenderal dengan tukang pecal semua tiwa sejarah umat manusia yang sa- SAW, ya Rasulullah, orang-orang Ibrahim setelah beliau berusia lanjut bahwa, Makkah disebut dengan ummul qura, karena menyatu dalam tujuan yang sama menggapai Ridho ngat besar yaitu sejarah pengorbanan musyrik mensakralkan Kabah dengan (90 tahun lebih). Kemudian, Realisasi tempat itu merupakan bagian bumi yang tertua. Oleh Allaw SWT. Mereka bersatu dalam perwujudan Nabi Ibrahim AS yang telah terjadi upacara kemusyrikan. Bukankah kami doa Nabi Ibrahim sampai pada pun- karena kawasan Makkah merupakan kawasan bumi manisfestasi iman yang meggelora membara. Kalimah sejak ribuan tahun yang silam. (para sahabat) lebih berhak melaku- caknya tatkala Allah memberikan tertua maka ia disebut umm atau ibu, yakni dari thoyyibah dari insan-insan takwa secara simultan Peristiwa sejarah itu selalu aktual kannya dari mereka. Pertanyaan ini keturunan dari Ismail AS, manusia pili- sanalah awal mula proses dan munculnya bagian-bagian menggema berirama, Labaikallahumma labbaik, untuk dibicarakan dan teladan sepan- di jawab oleh Nabi SAW, bersamaan hanterbaikyangmenjadiRasulterakhir, bumi yang lain hingga seperti sekarang ini. Hal ini sejalan labbaikala syarikalaka labbaik, innal hamda, wan- jang zamana, sebab manusia tanpa dengan turunnya (surat Al-Hajj : 37) Nabi Muhammad SAW pembawa dengan firman Allah dalam surah Al Anam ayat 92, nikmata laka wal mulk, la syarikalak. kecuali, terutama manusia yang ber- yaitu firman Allah SWT: Daging-da- rahmat dan penyempurna akhlak. Dan al Quran ini adalah kitab yang telah Kami Maksudnya : Aku datang memenuhi panggilan Mu ya iman dalam menjalani hidup dan ging unta dan darahnya itu sekali- Perintah Allah agar Nabi Ibrahim turunkan yang diberkahi, membenarkan kitab-kitab Allah,akudatangmemenuhipanggilanMu.Tiadasekutubagi kehidupan ini akan selalu di uji dengan kali tidak dapat mencapai (keridhaan AS menyembelih putra satu-satunya yang diturunkan sebelumnya dan agar kamu memberi Mu, Aku sambut panggilan Mu dengan setia, siap menerima segala macam ujian dan tantangan. Allah), tetapi ketakwaan daripada yang sangat dicintainya itu adalah ujian peringatan kepada penduduk ibu negeri ini dan perintahMu,sungguhseluruhbentukpujiandansanjungan, Betapapun kecilnya ujian akan terasa kamulah yang dapat mencapainya. yang paling berat. Namun beliau tetap sekitarnya.... semua ragam kenikmatan dan segala bentuk kekuasaan dan berat dan sukar, dan hal itu hanya itu dengan seekor sembelihan yang Qurban berasal dari kata Qaraba sabar melaksanakan perintah itu Dalam seminar internasional tentang mukjizat al kerajaan adalah milik Mu, tiada sekutu bagi Mu. dapat dilalui dengan baik manakala besar. (QS. As-Shaffat: 103-107). yangartinyadekat.Ibadahqurbanyang dengan tawakkal kepada Allah. Quran dan as Sunnah yang diselenggarakan pada tanggal Berada di Arafah, padang yang luas lagi gersang yang manusia sanggup menundukkan Qurban merupakan tradisi para berarti upaya bertakarrub atau men- Nilai Sosial Ibadah Qurban 20 Agustus s/d satu September 1994 di IPTN Bandung, secara materiil tidak punya arti, seluruh jamaah wuquf/ hawa nafsu dan mengendalikan diri Nabi, para Nabi terdahulu hampir dekatkan diri kepada Allah SWT, yang Ibadah qurban memiliki dimensi para pakar geologi dunia menyimpulkan dari hasil berhenti sampai terbenamnya matahari. Mereka berhenti dari bujuk rayu syaitan. seluruhnya bermuatan pengorba- berarti inti ibadah qurban adalah me- ganda, vertikal (kepada Allah) dan penyelidikannya bahwa ternyata lapisan-lapisan bumi dari memikirkan hal-hal yang bersifat duniawi menuju Sejarah Qurban Dan nan, baik dalam bentuk hewan sem- nguji kesadaran dan sejauh mana horizontal (hubungan kepada manu- dan gunung-gunung batu di sekitar Jazirah Arab adalah marifat ilahi. Disanalahlah jamaah haji seharusnya mene- Perintah Berqurban belihan, tenaga, harta benda, pikiran segala pola pikir, perilaku kita benar- sia) secara vertikal membentuk pribadi lapisan bumi yang diperkirakan berumur lebih tua mukan pengetahuan sejati tentang jati dirinya dan akhir Peristiwa qurban Nabi Ibrahim maupun jiwa, Nabi Nuh AS setelah benar berjalan sesuai perintah Allah takwakepadaAllahdansecarahorizontal daripada bagian bumi yang lain. Artinya, diperkirakan perjalanan hidupnya nanti, serta disana pula seharusnya ini telah diabadikan Allah SWT dalam selamat dari musibah banjir besar dan menjauhi segala larangan-Nya. bermuara kepada keshalehan sosial. bahwa kawasan Makkah adalah bagian bumi tertua ia menginsyafi langkah-langkah yang telah dikayuhkannya Al-Quran yaitu : Tatkala keduanya ditempat dimana perahunya berla- Tipe orang yang dekat dengan Allah Kendatipadaumumnyasosialdibentuk diantara kawasan bumi yang ada di dunia ini. yang sebelumnya tanpa mengindahkan seruan ilahi, dan telah berserah diri dan Ibrahim mem- buh beliau berqurban. adalah orang yang sanggup melak- olehpribadi,namunaspeksosialibadah Dan dalam berbagai riwayat klasik dikatakan bahwa disana pula seharusnya ia menyadari betapa besar dan baringkan anaknya atas pelipisnya, Orang-orang musyrik dahulu sanakan segala perintah Allah dan qurbanmemangmenjadiintidisyariatkan. Jabal Qubis (sebuah gunung yang terletak di dekat Kabah) agungnya Allah Robbul Jalil, yang kepadaNya mengabdi nyatalah kesabaran keduanya. Dan ramai-ramai melakukan upacara menjauhi larangan Allah SWT. Dibuktikan dengan seruan hadits Nabi adalah permukaan gunung yang pertama kali muncul seluruh makhluk yang besar dan kecil. Itulah peragaan kami panggil dia, Hai Ibrahim, se- qurban dengan menyembelih hewan Maka qurban dalam syariat Islam tentangqurban.MisalnyaNabikonsen- dipermukaan bumi, ketika bumi masih diliputi oleh secara miniatur yang riil . Kesadaran dan keinsyafan itulah sungguhnya kamu telah membenar- di depan Kabah dan tempat ibadah merupakan bagian sarana mende- trasikan pada pendayagunaan nikmat air yang kemudian berevolusi menjadi gunung, yang mengantarkannya di padang Arafah untuk menjadi kan mimpi itu, sesungguhnya demi- lainnya tanpa melupakan ucapan katkan diri kepada Allah dan pada hari- dankontribusinyaterhadapfakirmiskin sebagaimana yang diriwayatkan dari Ibnu Abbas yang manusia arif, yakni sadar dan mengetahui. kianlah kami memberi balasan kepa- persembahan, yaitu Demi Lata Uzza hari tasyrik telah merelakan sebagian atau yang membutuhkannya. indonesianya bahwa ketika arasy masih diliputi air KarenadipadangyangtandusdangersangitupulaAllah da orang-orang yang berbuat baik. dan Hubal, darahnya mereka percik- harta yang dimilikinya sebagai realisasi Bahkan, Nabi melarang kepada dan Allah belum menciptakan langit dan bumi, lalu yang Maha Kuasa mempertemukan Adam dan Hawa, di Sesungguhnya ini benar-benar suatu kan kedinding Kabah, sementara ketaatannyakepadaperintahAllahSWT, orang-orang kaya yang enggan ber- Allah meniup angin kencang dan terpecahlah air itu bukitJabalRahmah.Allahmengampunkansegaladosamereka, ujianyangnyata.DanKamitebusanak dagingnya mereka gantung di Kiswah Allah SWT berfirman : Sesungguhnya qurban untuk bergabung dengan ja- yang kemudian muncullah tumpukan batu, yaitu batu ataspengingkaranjanjikeduanyakepadaAllah.KarenaAllah Kami telah memberikan kepadamu maah shalat Idul Adha. Rasulullah SAW yang tumbuh dari tanah di Qubah, yang lama kelamaan telahmemperingatkankepadakeduanyauntuktidakmendekati nikmat yang banyak. Maka dirikan- bersabda: Siapa saja yang mempu- tumpukan batu itu menjadi gunung, sehingga gunung pohon itu dan melarang memakan buahnya. Namun hawa Konsultasi Al-Quran lah shalat karena Tuhanmu dan ber- qurbanlah. (QS. Al-Kautsar: 1-2). nyai kelapangan (mampu) untuk berqurban tapi tidak dilaksanakan- yang pertama kali muncul adalah gunung Qubis terletak di Makkah . Fakaana awwalu jabalin wudhia fiiha dan syahwat serta syetan yang begitu kuat mempengaruhui keduanya, mereka pun lupa, pohon dan buah yang dilarang Ikatan Persaudaraan Qari-Qariah & Hafizh Hafizah Perjuangan Nabi Ibrahim AS nya, maka janganlah dia dekat-dekat abu qubaies fadzalika sumiat makkata ummul qura. itumerekahampiridanmemakanbuahnyadenganlahapnya (IPQAH Kota Medan) Sejak masa muda Nabi Ibrahim ketempat shalat kami ini. (HR. Ahmad Dengan demikian tidaklah mengherankan kalau Allah .Allahpunmurka,lalumenurunkanmerekadarisurgatempat AS adalah pejuang yang selalu me- dan Ibnu Majah). Swt. mendirikan rumah tertua untuk tempat manusia yang mulia, penuh dengan segala fasilitas kehidupan yang KONSULTASI AL-QURAN adalah tanya jawab sekitar Al-Quran, yang ngesakan Allah (Tauhid). Sosial masya- Ibadah qurban juga mengandung beribadah, yaitu Kabah, sebagaimana firman Allah dalam hakiki,ketempatyangjauhdengansegalasesuatuyangterbatas meliputi: tajwid, fashohah, menghafal Al-Quran, Ghina (lagu) Al-Quran, surah Ali Imran ayat 96 Sesungguhnya rumah yang lagi fana, itulah bumi . Hukum dan ulumul Al-Quran. Kontak person. 08126387967 (Drs. Abdul rakat dan lingkungan sekitarnya mayo- ibadah sosial yang tinggi. Betapa tidak Wahid), 081396217956 (H.Yusdarli Amar), 08126395413 (H.Ismail Hasyim, ritas musyrik penyembah berhala. pada saat itu daging qurban yang diba- mula mula dibangun untuk tempat beribadah manusia Pertemuan dibukit Jabal rahmah itu keduanya lalu MA) 081375238649 (Mustafa Kamal Rokan). Nabi Ibrahim mengajak mereka me- gi-bagikan kepada fakir miskin yang ialah Baitullah yang di Makkah yang diberkahi dan bermohon kepada Allah; Robbana zolamnaa, amfu- ninggalkan sesembahan yang menye- mungkin sepanjang tahun belum per- menjadi petunjuk bagi semua manusia . sanaa, wa illam tagfirlanaa, watarhamnaa lanakuu- Assalamualaikum Wr.Wb. Disamping Baitullah, rumah ibadah yang paling satkan itu untuk menyembah Allah nahmemakandagingkarenahidupnya nannaa minal khoosiriin. (al-Araf 23) .Ya Allah, sungguh Al-Ustaz, Dari 114 Surat dalam Al-quran, berapa banyak surat yangtidakadasekutubagi-Nya.Namun tidak mampu untuk membeli daging, tua , di Makkah terdapat pula manusia pertama, yaitu kami telah menganiaya diri kami sendiri, ampunkanlah Makiyah dan berapa banyak surat Madaniyah ? Mohon penjelasan. ajakan itu tidak disambut dengan baik, kini mereka bisa merasakan nikmatnya Adam as bersama istrinya Hawa. Menurut berbagai kami dan rahmatilah kami, jika tidak Engkau ampunkan Dari H. Zainuddin, Sampali. tetapi justru malah ditentang dan daging tersebut. Dengan berkorban riwayat yang shahih, keduanya bertemu di Makkah, dan rahmati kami, alangkah ruginya kami ini. Jawab : juga mampu meredam berbagai gejo- di sebuah bukit yang bernama Jabal Rahmah dalam Bentuk pengakuan dan penyesalan diri keduanya dianggap subversif. Mereka tetap ingin Terimakasih atas pertanyaanya. Berbeda pendapat Ulama tentang lakkecemburuanitumunculmanakala kawasan Arafah. Dan dari keduanya pulalah kemudian diterima Allah dengan terbuka, sesungguhnya Allah memper-tahankanagamadanbudaya jumlah surat Makiyah dan Madaniyah, ada yang berkata jumlah surat kita tidak peduli atau tidak memper- manusia bekembang dengan kehendak Allah . Maha menerima taubat hambaNya dan Allah Maha nenek moyang mereka. Allah SWT Makiyah ada 94, Madaniyah 20, ada lagi yang berkata makkiyah ada hatikan umat lain yang sedang dilanda sebagaimana firman Nya: Tuhanmu yang telah Penyayang terhadap makhlukNya. Dan dengan sebab 84 dan Madaniayah 30. Ada pula yang berkata, Surat-surat Al-quran berfirman: Berkata mereka (kaum musyrikin) kami mendengar pemuda musibah atau kekurangan makanan. menciptakan kamu dari diri yang satu dan daripadanya wuquf di padang Arafah tersulutlah proses marifah, yang disepakati para ulama sebagai surat Makiah ada 82 dan yang disepakati Seandainya saja orang-orang yang Allah menciptakan istrinya, dan daripada keduanya dan dengan marifah menjelmalah insan arif. sebagaisuratMadniyahada20sedang12suratlainnyamasihdiperselisihkan menyebut-nyebut (mencerca) sembah- an kami (berhala) ia bernama Ibra- mampu, sadar akan eksistensi dari Allah memperkembangkan laki-laki dan perempuan Ibnu Sina seorang filosof dan ahli tata negara Islam status Makiyah atau Madaniyahnya. yang banyak . (an Nisa 1). mengatakanApabilakearifantelahmenghiasidiriseseorang, him. (QS. Al-Anbiya: 60). ibadahqurbanitutentulahkesenjangan Perbedaan ini disebabkan adanya sebagian surat yang seluruh ayat- Sebagaimana kita imani, bahwa proses kejadian maka anda akan menemukan orang itu ceria senantiasa, Rintangan dan cobaan yang diha- sosial itu dapat diatasi. ayatnya Makiyah atau Madaniyah, ada pula surat yang Makiyah tetapi Adam as adalah dari unsur tanah fainnaa kholaq- senyumnya selalu terukir di bibirnya, karena hatinya telah berisi sedikit ayat madaniyah atau sebaliknya. Oleh karena itu dari segi dapi Nabi Ibrahim AS semakin gencar Penutup dan berat. Beliau dimusuhi bahkan Setiap Idul Adha, umat Islam naakum min turoob (al Haj 5). Dan kita akui bahwa salah gembirasejakiamengenalAllah,diberbagaitempatiamelihat Makiyah dan Madaniyah ini Al-quran terbagi Kepada 4 bagian: satu unsur asasi dari tubuh manusia antara lain adalah satu saja, melihat yang Maha Suci itu. Semua makhluk 1. Surat Madaniyah yang ada berisi ayat makiyah, ada 6. Yaitu: oleh keluarganya sendiri. Dan akhirnya menyembelih hewan qurban untuk sampai pada klimaksnya beliau diba- disedekahkan kepada fakir miskin, berasal dari tanah. Segala yang kita makan semuanya dipandangnya sama, karena semua sama membutuhkan Al-Baqarah, Al-Maidah. Al-Anfal, At-taubah, Al-Hajj, Muhammad. berasal dari tanah, segala yang kita pakai, dan tempat Allah.Iatidakakanmengintip-intipkelemahanataumencari- 2. Surat Makiyah yang ada berisi ayat Madaniyah, ada 32, yaitu: kar hidup-hidup. Namun api yang bahkanibadahqurbanyangdianjurkan berkobar menjilat-jilat itu tidak di- dalam syariat Islam tentunya bukan kita berlindung pun semua nya berasal dari tanah, kayu, carikesalahanoranglain,iatidakmudahtersinggung,iatidak Al-Anam, Al-Araf, Hud,Yusuf, Ibrahim, Hijr, An-Nahl, Isra, Kahfi, Maryam, besi, batu bata, semen dan sebagainya, serta ketika kita cepat naik darah dan mudah marah, karena jiwanya selalu Thaha, Furqon, Syuara, Qashahsh, Ankabut, Ar-Ruum, Lukman, Sajdah, izinkan oleh Allah membakar dan saja dalam bentuk hewan ternak saja. menyakiti Nabi Ibrahim AS. Hal ini Tapi dalam semua aspek kehidupan meninggal dunia pun kita dikembalikan ke dalam tanah. diliputi oleh rahmat dan kasih sayangnya Allah. Saba,Yaasin, Zumar, Syuura, Zukhruf, Ahqaf, Qoof, An-Najm, Al-qomar, Karena itulah, kehadiran setiap orang dari jamaah dijelaskan Allah SWT: Wahai api, manusia. Hidup adalah perjuangan, Maka sebenarnya, kedatangan kaum muslimin di Waqiah, Al-qalam, Muzammmil, Al-Mursalat, Al-Maun. haji sangat terkait dengan awal kejadian dan perjalanan menjadi sejuklah engkau dan aman maka mustahil perjuangan tanpa Makkah sebagai pemenuhan panggilan Allah yang diku- 3. Madaniyah Murni, Surat yang kesemua ayatnya madaniyah. hidupnya. Dan didalam berbagai amalan dan ibadah, ada 18 Surat,Yaitu: Ali-Imran, An-Nisa, An-Nur, Al-Ahzab, Al-Fath, hujarat, bagi Ibrahim (QS. Al-Anbiya : 60). pengorbanan. Perlu instropeksi dan mandangkan oleh Nabi Ibrahim as dan peneladanan Nabi Ibrahim sebagai pejuang bertanya pada diri masing-masing, kita selalu diperintahkan menghadap ke arah Kabah. Setiap beliau. Demikian pula menziarahi maqam Rasulullah Hadid, Mujadalah, Hasyr, Mumthahanah, Shaff, Jumah, Munafiqun, yang mempunyai rasa tanggung- sudah sejauh mana telah rela ber- saat, dimana saja manusia berada kita diperintahkan SAW dengan hati yang ikhlas teruntai kata Assalamu Thaqabun, Thalaq, Tahrim, Zalzalah, Nasr. jawab terhadap masa depan bangsa- qurban untuk agama Allah, negara, menghadapkan wajah kita ke arah Kabah, ketika shalat, alaika ya Rasulullah, asslamu alaika ya Habiballah, 4. Makkiyah Murni. Surat yang kesemua ayatnya Makiyah. Ada nya beliau sempat cemas sebelum masyarakat, keluarga dan umat ma- berdoa, hendak tidur, bahkan ketika mayat di dalam kubur assalamu alaika ya Shofwatalloh , merupakan penga- 58 Surat, yaitu (karena tempat terbatas nama-nama suratnya adalah kelebihan dari nama yang sudah kami sebutkan). (lihat Ahmad Djalal. mendapatkan keturunan yang nan- nusia lainnya. Wallahu alam. pun wajahnya dimiringkan menghadap Kabah. kuan atas jasa Nabi-Nabi tersebut serta pernyataan Ulumul Quran. Ha; 99-100). Wallahu Alam. tinya diharapkan dapat melanjutkan Penulis adalah: Guru MAL IAIN Demikianlah, Kabah di kota Makkah sebagai pusat penghormatan kepada mereka. Tidakkah penghor- estafet dawah dan perjuangannya. dan Dosen Fakultas Tarbiyah IAIN- dan ibu bumi yang dijadikan Allah sebagai tumpuan matan yang diberikan kepada orang lain adalah satu Al-Ustadz H. Ismail Hasyim, MA arah dan simbol . Dengan berhaji ke Makkah kita diajak cabang dari akhlakul karimah. Wallahu alam. Disamping terus berjuang,NabiIbra- Sumatera Utara. 12. WASPADA Jumat 20 November 2009 Mimbar Jumat 15 5 Syiar Islam Di Bulan Zulhijjah (Puasa Arafah Simbol Persaudaraan) Peluang HajiMabrur Membesar Untuk bisa naik haji sekarang ini D iantara syiar Islam yang pa- ling unik dari sekalian syiar- syiar Islam adalah ibadah haji. Keunikan syiar ibadah haji ini (Bagian 2 bene merupakan siang hari yang pal- ing mulia dalam satu tahun adalah tenggang rasa terhadap saudara- saudara kita yang sedang melakukan semakin sulit mengapa? Karena harus nampak jelas di saat datangnya bulan jihad diri dan harta di medan perang menunggu 2-3 tahun lamanya. Hampir haji melibatkan semua tingkatan masyarakat, mulai dari rakyat biasa Oleh H.M. Nasir, Lc, MA melawan musuh-musuh manusia merata di seluruh Indonesia mereka yang yaitu nafsu, setan, dan ketamakan. hingga pejabat, mulai dari lebai-lebai Pesan penting dari puasa arafah berniat naik haji harus menunggu lama. kampung hingga kiyai-kiyai besar, tempat-tempat suci tersebut. Dengan adalah solidaritas umat Islam sedu- Artinya, kalau kita membayar Rp20 juta mulai dari kuli-kuli kasar hingga demikian orang-orang yang me- nia, yang dapat mengalahkan segala hari ini, dapat porsi, maka baru bisa tenaga profesional, semuanya ikut ngerjakan haji dan tidak menger- bentuk paham qaumiah (kesukuan) berangkat paling cepat pada tahun 2012. ambil bagian, paling tidak ikut men- jakan ibadah haji ikut mendapat bahkan syabiyah (kebangsaan) jika Di satu sisi kita bersyukur karena doakan dan mengantarkan tamu- pahala dan rahmat dari Allah Swt. umat Islam menghayati secara men- amalan haji semakin diminati, berarti tamu AllahSwt. yang dilepas dari secara bersamaan. Dengan kata dalam makna yang terkandung di semakin meningkat keimanan umat Is- tempat kediamannya. lain puasa arafah bukan hanya seba- dalamnya, tentu kita tidak akan ber- lam Indonesia. Dengan semakin sulitnya Sedemikian tingginya daya tarik gai ibadah sunat dalam artian men- pangku tangan melihat umat Islam syiar ibadah haji untuk menyemai cari pahala dan menghapus dosa di Palestina sedang diinjak-injak hak bisa naik haji karena menunggu kuota bibit kebaikan di hati kaum musli- yang lalu dan akan datang, akan asasinyaolehzionisyangbiadab.Pada- haji kita pun bisa memperoleh pelajaran min. Lihatlah ketika seseorang be- tetapi puasa arafah juga merupa- hal jumlah umat Islam di dunia ini jauh dan manfaatnya, yaitu masa persiapan rangkat ke tanah suci Makkah secara kan syiar ukhuwah (simbol per- lebih besar dari jumlah orang yahudi haji semakin panjang sehingga kita bisa tersirat akan termotivasi hati kita saudaraan) umat Islam. yang dapat mengobrak abrik kesucian lebih sempurna melaksanakan segala untuk mengikuti jejaknya, paling tidak Oleh sebab itu dari sisi teknis mesjid Al Aqsha tanah haram umat rukun dan wajib haji. Ingat! Wajib haji minta doakan di tempat-tempat saudara kita sedang berwukuf di pelaksanaan puasa arafah merujuk Islam yang ketiga setelah Masjidil hanya sekali. Kalaupun ada rezeki haji yang mustajab agar dapat berangkat padang Arafah pada tanggal 9 Zul- kepada pelaksanaan wukuf. Artinya Haram dan Masjid An-Nabawi. berikutnya hanya dihitung sunat. pada tahun-tahun berikutnya. Tidak hijjah. Rasul Saw. bersabda : Puasa puasa arafah sebaiknya dilaksanakan Lihatlah bagaimana persauda- Bagi yang melaksanakan ibadah haji seperti ibadah lainnya, katakanlah pada hari wukuf di Arafah diperhi- ketika jamaah haji sedang melak- raan Islam yang dibangun oleh Nabi ibadah shalat yang merupakan tiang tungkan oleh Allah Swt. dan bahwa sanakan wukuf di Arafah, dengan saw., ibaratkan satu tubuh, satu sama tahun 2009 diharap sudah mempersiapkan segalanya dengan semaksimal mungkin untuk mendapatkan agama, ketika dikerjakan baik secara Allah akan mengampuni dosa-dosa alasan bahwa Rasul Saw. menyebut lain ikut merasakan senang dan su- haji mabrur. Bagi yang harus menunggu 2-3 tahun peluang meraih haji mabrur semakin besar. sendirian atau berjamaah, belum setahun yang lalu dan satu tahun puasa tersebut adalah puasa arafah sah secara bersamaan. Sebagian Nabi Muhammad SAW mengingatkan tentang kemungkinan mendapatkan haji mabrur dalam tentu membuat orang lain termotiva- sesudahnya. (HR. Muslim). Sedang- bukan puasa sembilan Zulhijjah, umatIslam yang mengerjakan iba- satu hadits diriwayatkan oleh banyak perawi hadits: Ahmad, Baihaqi, Ibu Majah, dan Ibnu Abbas sbb: si untuk mengikutinya meskipun kan bagi orang-orang yang hadir karena boleh jadi terjadi perbedaan dah haji, berwukuf di Padang Ara- Bagi siapa yang ingin berhaji, hendaknya disegerakannya, karena kemungkinan tertunda karena jatuh shalat adalah pilar terpenting dari di Arafah ketika itu tidak dianjurkan dari sisi penetapan tanggal 1 Zulhij- fah seluruh umat Islam di dunia sakit, hilang kendaraan atau terbentur hajat lainnya. pilar-pilar agama Islam itu sendiri. untuk melaksanakan puasa sunat jah dan konsekuensinya akan berbe- ini dianjurkan untuk melaksana- Barangkali itulah sebabnya ketika arafah. Rasul Saw. bersabda: Dila- da pula waktu jatuh 9 Zulhijjah ber- kan puasa arafah, meskipun hukum Oleh karenanya, mari kita usahakan agar perjalanan rohani menuju rumah Allah (Kabah) Allah Swt. Membicarakan masalah rang berpuasa arafah bagi orang dasarkan perbedaan letak geografis puasa itu sendiri tidak wajib, karena ini bisa berlangsung dengan baik dan lancar, serta berharap ibadah kita mendapat ridha-Nya, syiar, lambang-lambang simbol yang hadir di Arafah. (HR. Ahmad suatu negara. Adapun arafah tidak yang ditampilkan di sini bukan sekadar mendapatkan haji mabrur sebagaimana sabda Rasulullah: Haji yang mabrur tiada ganjarannya Islam lebih banyak mengarah kepada dan Ibnu Majah). Dan menurut para ada duanya di dunia ini. Oleh sebab rutinitas sebagai hari peringatan yang sesuai melainkan surga. (HR Tabrani dari Ibnu Abbas). pelaksanaan ibadah haji. Tidak ada ahli Fikih, yang dimaksud dengan itu, lebih baik berpedoman kepada arafah sekali setahun lebih penting [HM Iwan Gayo, Buku Pintar Haji & Umrah, penerbit Pustaka Warga Negara, 1999, Ja- maksud untuk mengecilkan kewaji- hadir di Arafah adalah orang-orang pelaksanaan wukuf ketimbang kepa- dari semua itu bagaimana menso- karta Timur]. ban shalat sama sekali, akan tetapi yang wukuf di Arafah, sebagai salah da penanggalan kalender hijriah ma- sialisasikan hari arafah menjadi syiar setiap rukun Islam mempunyai kele- satu rukun haji. sing-masing negara. persaudaraan di dalam agama Islam. bihan dan keunikan tersendiri, malah Dari teks hadis di atas dapat dipa- Meskipun terjadi perbedaan Akhirnya, syiar puasa arafah Memetik Hikmah Qurban jika dinilai dari sisi bobot kewajiban, shalatmerupakankewajibanyangtidak bolehditawar-tawar,danwajibdiqadha hami bahwa puasa arafah mempu- nyai hikmah persaudaraan yang teramat mendalam yaitu agar orang- waktu sekitar 4 jam antara Saudi Arabia dengan waktu Indonesia, paling tidak pelaksanaan puasa merupakan simbol persaudaraan dan solidaritas umat Islam, yang dianjurkan kepada umat Islam untuk bila ditinggalkan tanpa uzur syara. orang yang tidak mengerjakan haji arafah mendapatkan saat-saat wu- mempuasakannya, dan menghayati Oleh Ahmad Sabban Rajagukguk Keunikan lain dari syiar ibadah dapat menanamkan solidaritas kuf baik di awal wajib wukuf, yaitu makna yang dikandungnya secara haji adalah menanamkan rasa per- persaudaraan dan tenggang rasa mulai tergelincir matahari atau mendalam, sehingga puasa arafah saudaraan (ukhuwah) antara sesa- lewat puasa arafah yang mereka di akhir waktu wajib wukuf yaitu tidak hanya mengharapkan imbalan S uatu peristiwa agung yang perlu kita teladani pada musim haji ini adalah per- juangan Nabi Ibrahim. Pengor- dupsuburkan salah satu sunnah yang dicontohkan oleh Nabi- yullah Ibrahim AS yang menda- patkan perintah melalui mimpi ma muslim, bukan saja persaudaraan antar sesama orang yang terlibat langsung mengerjakan ibadah haji, orang-orang yang tidak ikut serta lakukan. Sekaligus ikut memikirkan saudara-saudara mereka yang sedang berada di perkumpulan akbar di Padang Arafah, memenuhi pang- terbit fajar tanggal 10 Zulhijjah, yang perlu digaris bawahi puasa arafah ada hubungannya dengan pelaksanaan wukuf di Arafah. pahala puasa, akan tetapi juga membesarkan syiar Islam. Walla- hualam . (Bersambung) Penulis adalah : banan Nabi Ibrahim menjadi wa- untuk menyembelih anaknya mengerjakan dalam ritual yang sakral gilan Allah Swt. seraya meminta Jika dipahami makna filosofi dari - Pimp. Pondok Pesantren Tahfiz risan ibadah yang disyariatkan yang sangat disayangi dan dicin- ini pun ikut dilibatkan. Oleh sebab ampun serta rahmat daripada Allah puasa arafah, tentu tidak akan ada Alquran Al Mukhlisin Batu Bara kepada kaum muslimin. Ibadah tainya, yaitu Nabiyullah Ismail AS. itu Rasul Saw. menganjurkan bagi Swt., sehingga orang berpuasa yang mempersoalkan perbedaan tek- - Pembantu Rektor IV Univer- yang dimaksud adalah ibadah ha- Karena ketundukannya kemu- orang-orang yang tidak mengerjakan arafah tersebut akan tumbuh rasa nis pelaksanaan puasa arafah, karena sitas Al Washliyah (UNIVA) Medan ji dan penyembelihan hewan kur- dian Allah menggantikan Ismail ibadah haji untuk melaksanakan persaudaraan dan menimbulkan tujuan yang mendalam dari puasa - Anggota Komisi Fatwa MUI ban bagi orang-orang yang me- dengan seekor kibas yang terus ber- puasa sunat arafah, yaitu di saat-saat rasa rindu untuk berkunjung ke sehari dalam setahun ini yang nota- Medan miliki ekonomi mapan. lanjut sampai akhir zaman. Seba- Tanggal 10 Dzulhijjah meng- gaimana diungkapkan kisahnya ingatkan kita kepada sejarah yang dilakoni keluarga Nabi Ibrahim as. Dari sejarah itu dapat diambil dalam Alquran surat Ash Shaffat ayat 102-111. Ketiga, menghidupkan makna Ibadah Qurban Dalam Kontribusi Sosial H pelajaran bahwa semakin kuat iman seseorang, takbir, karena pada hari raya Idul Adha, dari tgl ari raya Idul Adha merupakan prediketdanpengakuansebagaihamba semakin berat cobaan dan ujian yang diha-dapinya. 10 hingga 13 Dzul Hijjah, yakni hari nahar (pe- peristiwayangcukupbersejarah Oleh Watni Marpaung, MA yang taat dan patuh kepada Allah Swt. Ibarat sebuah pohon, semakin tinggi pohon itu nyembelihan) dan hari-hari tasyriq. Syariat agama bagi umat Islam di seluruh Sisisosialyangterlihatdaripelaksa- semakin keras pula angin yang menerpanya. kita menggariskan, bahwa pada setiap hari raya, penjurudunia.SehinggaIdulAdhatidak naan ibadah qurban ini adalah tercip- Dalam perjalanan hidup Nabi Ibrahim as, telah baik Idul Fitri maupun Idul Adha, setiap Muslim pernahterlewatkandariaktivitasibadah tenaga, bahkan nyawa sekalipun dikor- tanyasolidaritas,rasasalingmembantu berkali-kali beliau mendapat ujian dari Allah Swt., diperintahkan untuk mengumandangkan takbir. ritual tahunan menyembelih hewan bankan. Kendati pun, sikap kemauan dan berbagi antara satu dengan yang dan kali ini juga Nabi Ibrahim kembali di uji oleh qurban. Pada hakikatnya Ibadah ini umat Islam untuk melakukan pengor- lainnya, sebagai contoh dapat kita lihat Hal ini memberikan isyarat kepada kita, bahwa keba- mengingatkan kita kembali kepada banan dalam bentuk hewan qurban dengan adanya pembagian daging Allah. Ia bermimpi, Allah memerintahkannya untuk hagiaan yang hakiki hanya akan terwujud, jika manusia sejarahNabiIbrahinasyangdiujiuntuk sudahmenjadisatuindikasisikapuntuk qurban kepada para tetangga dan fa- menyembelih Ismail putra tunggal yang amat di dengan setulusnya bersedia memberikan pengakuan membuktikankecintaannyakepadaAllah berkorban terhadap Islam. kir miskin yang salah satu hikmahnya, cintainya. Sehari sesudah mimpi itu, nabi Ibrahim dan fungsi kehambaannya di hadapan Allah Swt. dengan bentuk menyembelih anak Ibadah Qurban Dan Kontribusi Sosial mungkinbagisebagiansaudarakitayang mere-nungkan apakah mimpinya itu benar-benar Di samping itu semua, Hari Raya Qurbanpun tercinta Ismail as. Sekalipun perintah Ibadah qurban yang setiap tahun fakirdanmiskinadayangjarangmakan datang dari Allah atau bukan. merupakan Hari Raya yang berdimensi sosial ke- tersebut terasa berat namun Ibahim dilakukanumatIslammerupakansalah daging dalam sebulan atau setahun. Karenanya hari itu disebut yaumut tarwiyah masyarakatan yang sangat dalam. dengan ikhlas tetap melaksanakannya satu ibadah yang punya kontribusi Maka pada saat idul adha paling hari perenungan. Pada hari ke-dua, barulah ia yakin Hal itu terlihat ketika pelaksanaan pemotongan sesuai dengan tuntunan Allah. terhadapsosialkemasyarakatan. Namun, tidakdiadapatmerasakandagingyang bahwa mimpi itu benar-benar datang dari Allah hewan yang akan dikorbankan, para mustahik yang SecarapendekatanbahasaQurban terkadang cukup disayangkan masih masih segar dari qurban saudara-nya. yang dinamakan yaumul arafah hari mendapat akan menerima daging-daging kurban itu ber- berasal dari bahasa Arab dari kata banyakorang-orangkayayangkhawatir Sekalipunyangmenjaditujuanqurban pengetahuan dengan sadar. Akhirnya pada hari kumpul. Mereka satu sama lainya meluapkan rasa qaraba,yaqrabu,qurbananyangartinya akan berkurang hartanya dengan bukan hanya daging qurban tersebut ketiga, Nabi Ibrahim mengambil keputusan de- gembira dan sukacita yang dalam. dekatataumendekat.Sedangkansecara melaksanakan ibadah qurban. tetapiuntukmelatihparapequrbanber- ngan keyakinan bulat yaumun nahar yaitu hari Yang kaya dan yang miskin saling berpadu, ber- istilah dipahami sebagai ibadah yang punyasikap yang sama di dalam hati Padahal,diatidakmenyadaribahwa sikapmemberi,membantusaudaranya melaksanakan penyembelihan. interaksi sesamanya. Luapan kegembiraan di hari dilakukanpadabulaniduladhaberupa bahwa seandainya pun diminta un- harta yang dimilikinya adalah amanah yanglaindenganberbagaibentukyang Banyak hikmah yang dapat dipetik dari peristiwa itu, terutama bagi orang miskin dan fakir, lebih-lebih penyembelihan hewan qurban untuk tuk memperjuangkan agama Allah dari Allah yang harus didistribusikan dilakukanpadabulan-bulanyanglainnya. agung yang dilalui Ibrahim dan anaknya. Di anta- dalam situasi krisi ekonomi dan moneter yang mendekatkan diri kepada Allah Swt. sekalipun yang menjadi konseku- kepada orang banyak supaya mereka Melihat begitu besarnya manfaat Oleh sebab itu, dapat kita pahami ensinya disembelih seperti hewan juga dapat merasakan nikmat yang kita ibadah qurban bagi orang yang ber- ranya adalah: dialami sekarang ini, sangat tinggi nilainya, ketika bahwapemotonganhewanqurbanyang kurban maka kita harus pasrah dan dapatkan.Sehinggasikapsepertidemikian qurban dan masyarakat merupakan Pertama, untuk mendekatkan diri kepada Allah mereka menerima daging hewan kurban tersebut. dilaksanakan setelah shalat Idul Adha tunduk sepenuhnya kepada Allah. dikecam Rasul dalam sebuah hadisnya sebuah motivasi yang harus dipahami atas segala kenikmatan yang telah dilimpahkan- Dengan syariat qurban ini, kaum muslimin sampaidenganberakhirpadaharitasyriq Mungkin sifat-sifat seperti inilah yang diriwayatkan Abu Hurairah, Ba- dan ditumbuhkembangkan umat Is- Nya yang jumlahnya demikian banyak, sehingga dilatih untuk mempertebal rasa kemanusiaannya, merupakansimbolsebuahketaatandan yang dimiliki para sahabat Nabi dalam rangsiapa yang mempunyai kemam- lamsebagaisebuahbentukkepedulian tidak seorangpun dapat menghitungnya. Hikmah mengasah kepekaannya dan menghidupkan hati kepatuhankepadaAllahSwt.Jadi,bukan memperjuangkanagamaAllahsehingga puan tetapi ia tidak berkurban, maka sosial dan kepekaan kita terhadap ling- secara eksplisit dan tegas tentang ibadah qurban nuraninya. Ibadah qurban sarat dengan nilai ke- sekedar acara yang sifatnya seremonial mencapaikeberhasilanyangluarbiasa janganlahiamendekati(menghampiri) kungan sekitar. Inilah yang seharusnya ini, telah diungkapkan dalam Alquran: Dan telah manusiaan dan mengandung nilai-nilai sosial yang untukmenunjukkanbahwasiapayang dalam sejarah manusia yang mana tempat shalat kami. tercipta dan diaplikasikan umat Is- Kami jadikan untuk kamu unta-unta itu sebahagian tinggi. Oleh karenanya kaum Muslim yang tidak berkorban, atau untuk menyaksikan merekapunyapemahamanmendalam Namun, perlu dicatat bahwa yang lam yang mempunyai kemampuan dari syiar Allah, kamu memperoleh kebaikan yang mampu mewujudkan nilai-nilai kemasyarakatan, secara bersama-sama hewan qurban dankonsekwensekalipundihina,disiksa, sampai kepada Allah bukanlah daging untuk melakukan ibadah qurban. banyak padanya, maka sebutlah olehmu nama Allah dianggap sebagai pendusta agama. itu disembelih, tetapi pada hakikatnya bahkan dibunuh orang-orang kafir. qurban, namun yang dimaksud adalah Penutup ketika kamu menyembelihnya dalam keadaan Jadi jelaslah bagi kita, bahwa yang perlu ditinjau penyembelihanyangdilakukantersebut BagaimanakitamelihatBilalbinRabah, nilaiketakwaanyangterkandungdalam Ibadah qurban yang setiap tahun- berdiri (dan telah terikat). kembali adalah tentang eksistensi kita sebagai punya makna yang dalam dan harus Khabbab binArat dan sahabat-sahbat pengorbanan tersebut. Hal inilah yang nya dilaksanakan umat Islam meru- Kemudian apabila telah roboh (mati), maka makhluk yang berketuhanan dan makhluk sosial. diresapitidakhanyaorangyangberqurban yang lainnya adalah bentuk-bentuk ditegaskan Allah Swt dalam al-Quran pakansebuahibadahyangtidakhanya Pengorbanan apakah yang telah kita berikan tetapijugasemuaorangyangmenyaksikan pengorbanan yang hakiki. surat al-Hajj ayat 37, Daging-daging memilikidimensiibadahsemata,tetapi makanlah sebahagiannya dan beri makanlah orang demi terwujudnya cita-cita hidup sebagai hamba penyembelihanhewanqurbantersebut. Padadasarnyapengorbananseperti unta dan darahnya itu sekali-kali tidak juga memiliki dimensi sosial yang yang rela dengan apa yang ada padanya (yang tidak DariperistiwapenyembelihanDiha- Allah yang Muslim dan Mukmin. Untuk itu, hikmah demikianyangakandapatmenghantar- dapat mencapai (keridhaan)Allah, memberikan nilai positif terhadap meminta-minta) dan orang yang meminta. Demi- rapkan hewan qurban tersebut dapat kanIslamkepadakemajuanbukanhanya tetapi ketakwaan daripada kamulah dari peristiwa qurban yang dialami Nabi Ibrahim masyarakat luas. kianlah Kami telah menundukkan untua-unta itu meningkatkan keimanan dan rasa per- terbatas pada bentuk simbol penyem- yang dapat mencapainya. Penulis adalah: Dosen Fakultas kepada kamu, mudah-mudahan kamu bersyukur. merupakan suatu pelajaran yang perlu diteladani. juangan yang tinggi untuk kepentingan belihan hewan qurban semata, tetapi Ayat di atas menegaskan bahwa Syariah IAIN-SU Medan & Pengurus Kedua, hikmah menyembelih hewan kurban Penulis adalah: Praktisi Perbank Syariah dan agama Allah. Pada saat hewan qurban pengorbanan yang apabila ia diminta hewan qurban yang akan kita sembelih Lembaga Baca Tulis Sumatera Utara pada hari raya haji juga adalah untuk menghi- Dosen PTN PTS Medan. disembelih seharusnya kita semua demi kepentingan Islam maka harta, merupakan sarana untuk mencapai (LBT-SU) Daarul Maarif Jl. Damar Raya No. 8 Sidorukun H. Sofi Monang Rkt., Lc, M.Th MEDAN TUNTUNGAN Al-Hidayah Kel.Tg.Marulak Hilir Lingk.03 (Kp.Keling) Drs. Ngetiran, MBA Muttaqin Jl. Pasar III No. 40 Glugur Darat I Nasiruddin, S.Ag Al-Hidayah Jl. Jend. Ahmad Yani No. 50 Kel. Durian Salman Rasyidi, S.Pd.I Nurul Yaqin Jl. Bukit Barisan I No. 74 Drs. H. Abdul Aspan, MA Ar-Rahman Griya Nusa Tiga Lingk. 03 Tg. Selamat Drs. H.U. Sitepu Al-Hasanah Jl. Kartini No. 16-A Zulkarnain, S.Ag Nur Chadidjah Komp.Wartawan Jl. Letter Press No.51 Musohur Siregar, S.Ag Al-Amin Jl. Pala Raya Perumnas Simalingkar Prof. dr. H. Achmad Effendi Al-Mukhlis Jl. A. Yani/Sakti Lubis Khoinuddin Noor Hasibuan, S.Ag Syuhada Jl. Budi Pengabdian No. 03 P. Brayan Drs. M. Ridwan Al-Hasanah Jl. Teh 10 Perumnas Simalingkar Drs. Rosidin Bina, M.Ag Al-Muthmainnah Lingk. I Kel. D.Sundoro H. Wijaya, D. Taqwa Jl. Sutomo Ujung Gg. A No. 47 Kel. Durian Sarmin Tambunan, S.Ag, S.Pd.I Al-Ikhlash Jl. Nilam 11 No. 1 Perumnas Simalingkar H. Ali Imran, S.Ag Al-Maryam Jl. Darat Lingk. VIII Kel. Rambung M. Ilyas, S.Ag Taqwa Kampus UMSU III Jl. Kapt.Mukhtar Basri No.3 Drs. Hasanuddin, MA Al-Muttaqin Jl. Jamin Ginting Km. 14 Kel. Sidomulyo Drs. M. Yusup Arhad. Al-Musyawarah Jl. Abd. Rahim Lubis No. 48 A Haji Ibnu Kassim Lubis Taqwa Jl. Rakyat/Lr. Maninjau No.6 Sidorame Timur Mustapa Lubis Al-Muhtadin Jl. Kemiri Raya I No. 1 Blok-G H. Solihin Adin, S.Ag Al-Haq Kel. Deblot Sundoro Kec. Padang Hilir Drs. H. Akhyar Nasution Taqwa Jl. Bilal Gg.Keluarga No.74 Kel.P.B. Darat II Drs. Faisal Lubis Al-Muhajirin Jl. Kopi Raya II Blok A Ir. H. Nazaraini Anwar Darul Jannah Jl. Bhakti LKMD Lingk. I Kel. Lalang Drs. Usman Amin Taqwa Jl. Pelita II No. 3/5 Sidorame Barat Drs. H. Nizar Idris, MA Al-Razzaq Jl. Sakura Raya Kel. Tanjung Selamat Drs. H. Amrin Siregar, S.Ag Farida Jl. H. Ahmad Bilal Kel. Damar Sari Drs. Jafaroni, SH Taqwa Jl. Mustafa No. 1 Glugur No. 1 Kp. Dadap Drs. Burhanuddin, MA Iklab Jl. Letjend. Jamin Ginting Km. 12,5 No. 100 Cadangan Jami Jl. Batu Bara Kel. Satria T. Azmi, S.Ag Taqwa Ubudiyah Jl. Bambu III Kel. Durian Khairul Saleh, S.Ag Baitul Rahman Jl. Rami II Simalingkar Drs. Hasbi Yunus Nurul Hidayah Jl. G.Martimbang II Kel. Rantau Laban Ramadan Lubis Nurul Hayat Kel. Kemenangan Tani Akmal Harahap Syuhada Jl. Iskandar Muda No. 70 Drs. A. Yasir Nainggolan MEDAN TEMBUNG Nurul Iman Jl. Irigasi No. 12 Kel. Mangga Drs. Maat Rais Taqwa Jl. Prof. H.M.Yamin Kel. Sri Padang Kp.Keling Asnawi Mangkualam, SHI Akbar Baitus Sujud Jl. Metrologi Raya Gg.Karya No.1 Muhammad Al-Farabi, M.Ag Silaturrahim Jl. Kapas 13 No. 49 Perum. Simalingkar Keskarnaen, S.Ag Taqwa Jl. Sawit Raya Perumnas Simalingkar Drs. Tarmizi Lubis INDRAPURA Ar-Ridho Jl.Tuasan Gg.Sukun No.10 Kel.Sidorejo Hilir H. Sabaruddin S., S.Ag Ar-Ramli Jl. Sidorukun Ujung/Jl. Surya Lingk. XII Abdul Roni Hasibuan, S.Ag JamiIndrapura Kota H. Muslim Ismail DELI SERDANG Ash-Shobirin Jl. Pukat Banting II (Mestika) Kel.Bantan Drs. Irwan Nasution KISARAN At-Tawwabin Jl. Pimpinan No. 1 H. Fahrurrozy Pulungan, SE Amal Islamiyah Kel. Lubuk Pakam Pekan M. Nur, S.Ag Al-Anwar Jl. Willem Iskandar Kel. Indra Kasih Drs. H. Abu Bakar Adnan Srg.,MA Ainul Yaqin Jl. Pembangunan IV No. 30 Drs. Muchsin Nasution Ar-Rasyidin Jl. Sei Asahan No. 42 Kel. Tegal Sari H. Usman Effendi, Lc Al-Falah Jl. Pukat Banting IV No. 10 Karimuddin, S.Ag Al-Furqon Perumahan Bumi Tuntungan Sejahtera DSC Ismail Munthe, S.Pd.I Al-Husna Simpang 6 Kel. Kisaran Barat Zainal Abidin, S.Ag Al-Hidayah Jl. Letda Sujono No.62 Kel. Bdr. Selamat Sori Monang Harahap, Lc Al-Hidayah Jl. Kongsi Gg. Syukur No. 307 Marindal I Drs. H. Djamaluddin Srg., MA Nurul Yaqin Jl. K.H. Agus Salim Pasar Lama Drs. H. Ibrahim Marpaung Al-Hikmah Jl. Letda Sujono Gg. Amal No. 5B Syarifuddin Umar Al-Hafiz Desa Hamparan Perak Kec. Hamparan Perak H. Zulkarnain Nurul Huda Jl. Malik Ibrahim No. 37 Drs. Imran Mahdin, M.Ag Al-Huda Jl. Tuasam Gg. Aman Gazali Ahmad, S.Ag Al-Iskhlas (YAMP) Komp. Perkant. Pemkab L. Pakam Drs. H. Senan Sulaiman, MSI LABUHAN BATU Al-Ikhlas Lingkungan II Kel. Bandar Selamat Drs. H.M. Yahya Zakaria Al-Muttaqin Jl. S.M.Raja Km.12 Gg.Rasmi T.Morawa Drs. Ilyas Purba Al-Ikhlash Jl. Pukat V Kel. Bantan Timur Drs. Nadran Jamal Nasution Al-Muttaqien Gg. Kolam Deli Tua A. Fuad Sinaga, SHI An-Nur Desa Kuala Bangka Syahrul Efendi Al-Istiqomah Komplek Veteran Medan Estate Drs. H. Nasrun Zakaria Baiturrahman Jl. Merica Raya Blok F Kec.Pancur Batu Ahmad Bardan Baiturrahman Kamp. Masjid Kec. Kualuh Hilir L.Batu A. Darwis Asdani Al-Ijtimaiyah Jl. Letda Sujono No. 152 Drs. Amiruddin Batubara Baitussalam Dagang Kerawan-Tg. Morawa Drs. Ngadimin BATU BARA Al-Muhajirin Jl. Garuda II Kel. Kenangan Baru Drs. M. Iqbal Siregar Baitul Mukmin Jl. Medan-Binjai Km.15,5 Kec.Sunggal Drs. Mohd. Yusuf, AR Al-Muslimun Jl. Pertiwi No.94 Drs. Kasto Nader Jami Jl. Pantai Labu Dusun Masjid Desa Beringin Risan, S.Pd.I Ar-Rahman Dusun II Desa Pasar Lapan Zainal Arifin, S.Pd. Al-Muqorrobin Jl. Pukat II No. 52 Bantan Timur Drs. Amrin Siregar Jami Asysyakirin Delitua Jl. Medan-Delitua Km.11,5 Teguh Iman Jami Al Mukhlisin PT. Moeis Kel. Perk. Sipare-Pare S.M. Ruslan Sueb Al-Muhtadin Jl. Bantam No. 15-A Lingk. III Drs. Solahuddin B.Bara, MA Jami Jl. Irian No. 79 Kel. Pekan Tanjung Morawa H. Akhiruddin, Lc Nurul Iman Dusun V Pasar Lapan A. Hadi Nur Baiturrahman Jl. Willem Iskandar Psr V Medan Estate Burhanuddin Siagian, M.Ag Khairul Fatihin Dusun II Tg. Morawa-A Ibnu Ali, AS Nurul Hudadesa Tanah Tinggi Kec. Air Putih Ratno Darul Amin Jl. Letda Sujono Ujung No. 1 Lingk. I Alwin Ramli Lubis Nurul Ikhwan Jl. H.A. Dahlan No. 38 DR. H.Ramli Abd.Wahid, MA Syuhada Sukaraja Desa Sukaraja Kec. Air Putih Syahrin Umar Ikhwaniah Jl. Tuamang No. 47 Kel. Sidorejo Hilir Drs. Zainal Arifin Purba, MA Nursaadah Jl. Medan-Tg. Morawa, Km. 12 H. Yazid Syamsuddin, Lc Quba Tanjung Kubah Drs. Saiful, M.SI Jami Nurul Ihsan Jl. Durung No. 134 Kel. Sidorejo Drs. Syamsul Rizal Pulungan Raya Lubuk Pakam Jl. T. Raja Muda No. 26 K.H. M. Husin Kasim PEMATANG SIANTAR Nurul Iman Jl. Pertiwi Ujung Kel. Bantan H.A. Sori Monang, Lc Taqwa Jl. Diponegoro No. 1 Lubuk Pakam Drs. Nazaruddin Al-Ikhlas Jl. Nagur No. 45 Kel. Martoba Hisbullah Chan, S.Ag, S.Pd.I Raya Muslimin Jl. Pukat I No. 9 Kel. Bantan Timur Drs. Kosren Gozali Hasibuan TEBING TINGGI Ubudiyah Jl. Mandala By Pass No. 110 Drs. Helmy Walid RANTAU PRAPAT Ulul Albab Jl. IAIN No. 1 IAIN-Sumatera Utara Dr. H. Ahmad Zuhri, MA Amal Muslimin Kampung Rao Nusri Batubara Al-Qodar Jl. Torpisang Mata Atas Drs. H. Sofyan Sauri, SH Taqwa Jl. Belat No. 76B Ummul Aiman, S.HI Ash-Sholihin Jl. Badak Lingk. I Kel. Bandar Utama Rahmad Halim, B. Taqwa Jl. Tangkul II No. 128-A Drs. Suprapto An-Namirah Perum.Griya Prima Ling.II Kel.Tg.Marulak H. Aguszul Khoir, S.Ag D A I R I Taqwa Jl. Enggang Raya No. 85 Junaidi, S.Pd.I, M.SI Al-Falah Jl. Ksatria Kodim-0204/DS Endang Hartono Al-Muhajirin Perumnas Kalang Simbara Abdul Yajid Lingga, S.Ag Taqwa Jl. Kolam No. 01 Kampus I Medan Estate H. Ismet Junus, LMP, SDE Al-Falah Jl. Ir. H. Juanda Lingk. I Kel. Karya Jaya Abdul Yazib, S.Ag Telaga Zam-zam Kecamatan Sidikalang H.M. Taher Nasution, SH 13. 16 Daftar Khatib Shalat Jumat WASPADA Jumat 20 Nopember 2009 MEDAN AREA Amaliah Jl. Amaliun Gg. Bandung Kota Maksum II Ismail Malik Al-Chairat Jl. A.R. Hakim Gg. Sederhana No. 22 Muhammad Basri, M.Ag Al-Hidayah Jl. A.R. Hakim Gg. Sukmawati Drs. H. Zulham Efendi Batu Bara Al-Huda Jl. Gedung Arca Gg. Jawa No. 46 Drs. H. Kamidin Selian Al-Ihsan Jl. Bromo Gg. Sukri No. 2 Kel. Tegal Sari II Drs. H. Sempurna Silalahi Al-Ikhwanul Wathan Jl. A.R. Hakim Gg. Langgar Drs. Muhammad Yani Al-Ikhlash Taqwa Jl. Medan Area Selatan No. 129 Satiman Al-Ikhwaniyah Jl. Utama/Amaliun Gg. Tertib Nol 15 Drs. Badaruddin Munthe, SH Al-Makmur Jl. A.R. Hakim Gg. Langgar No. 25 Drs. Usman Batubara Al-Misbah Jl. A.R. Hakim Gg. Langgar/Dame No. 27 Hartono MK, S.Sos.I Chalid Ibnul Walid Jl. Rakhmadsyah No. 366 Drs. Zainal Arifin Gunawan Istiqlal Jl. Halat No. 53 Drs. H. Darwansyah Simanjuntak Jamik Jl. M.A. Selatan No. 289 Kel. Surakamai-I Drs. H. Muhiddin Gurning Jamik Jl. Sutrisno Gg. Damai I No. 6 Kel. Komat I Drs. Abdul Razaq Jami Darul Ikhlas Jl. Batu No. 13 DR. H. Pagar Hasibuan, MA Jami Taqwa Jl. A.R. Hakim Gg. Langgar No. 8A Maulana Siregar, MA Khairiyah Jl. Rahmadsyah Gg. Subur 192 Drs. H. Zainal Abidin Zen Muslimin Jl. Selam II No. 47 Usman Batu Bara, S.Ag Muslimin Jl. Dr. Sun Yat Sen No. 71 Kota Matsum I H.M. Nasir, Lc, MA Muslimin Jl. Gedung Arca Gg. Jawa No. 3 Drs. H. Abdul Halim Siregar Perguruan Ketuhanan Jl. Puri Gg. Perguruan No. 4 Drs. H. Efnedi Arief, MA Silaturrahim Jl. Emas No. 10 Drs. H. Saleh Umar Silaturrahim Jl. Bromo Gg.Silaturrahim Kel. T.Sari III Aminullah Siregar Syekh Hasan Maksum Jl. Puri Gg. Madrasah Mukhlis Muaz, SHI Taqwa Jl. Bromo Gg. Taqwa No. 11 Drs. Tenerman Taqwa Jl. Megawati Drs. Marwan Tanjung Taqwa Ar-Rahim Jl. Utama Gg. Ampera I No.240AR Drs. M. Riadi Lubis Taqwa Jl. Demak No. 3 Drs. H. Lukman Hakim, M.Pd Taqwa Lawang Jl. Gedung Arca Gg. Sehat No. 8 Drs. Azwilman MEDAN AMPLAS Amaliyah Jl. K.H. Rivai Abdul Manaf Nasution No.83 Drs. H.M. Idrus Yusuf Al-Hidayah Mapolda SU Jl. S.M.Raja Km.10,5 No.60 Drs. H. Azhar Sitompul, MA Al-Hilal Asrama Widuri Eks Brigif 7 Jl. S.M. Raja Drs. Sarawi Muhamjis Al-Muhajirin Jl. Bajak II H Gg. Nasional No. 100-D H. Arief Mhd. Erde, Lc Al-Waqif Jl. Sempurna Kel. Sudirejo I Drs. Sahlan Nasution Hijratur Ridho Jl. Selamat Ujung Gg. Subrah No. 12 Edi Zuhro W. Pane, SH Ikhwanul Muslimin Jl. Swadaya Lingk. XVI Marindal Drs. M. Tholib Harahap, MA Jami Harjosari Jl. S.M. Raja Km. 6,5 No. 21 Drs. Syahrul Effendi Siregar Kampus UNIVA Jl. S.M. Raja No. 10 Komp. UNIVA H.M. Syukur Abrazain, BA Nurul Islam Jl. M. Nawi Harahap Baharuddin Ahmad, SH Nurul Iman Jl. S.M. Raja Km. 09 Timbang Deli Drs. M. Nuh, SH, MH Nurul Barkah Jl. Selambo IV No. 29 Drs. Sofyan Ahmad Nurun Nabatiyah Jl. S.M.Raja Komp.Kantor Kehutanan Drs. H. Abdullah, M.Si Ramadhan Jl. Pertahanan No. 37 Kel. Timbang Deli Rusli Effendi, S.Pd.I Salman Jl. STM. Kel. Sitirejo II Drs. H. Jahiruddin Nasution Raya Taqwa Jl. S.M.Raja Km.5,5 No.1 Kel.Harjo Sari Ishak Jar Taqwa Jl. S.M. Raja Gg. Pulau Harapan No. 1 B Rafdinal, S.Sos. MEDAN BARU Agung Jl. Pangeran Diponegoro No. 26 H. Sutan Syahrir Dlm., S.Ag Al-Amanah Komplek GKN Jl. P.Diponegoro No. 30-A Marajaksa, S.Ag Al-Hasanah Jl. Letjend. Jamin Ginting No. 314 Drs. H. Darwis Nasution Al-Ikhlas Jl. Sei Padang No. 129 Drs. Nazaruddin Lubis Dakwah Jl. Dr. Hamzah No. 2 Kampus USU Prof.Dr.H.M.HasballahThaib,MA Muslimin Jl. Batang Serangan No. 93 H. Nadzrul Fachri Hamyar Nurul Muslimin Jl. DR. TD. Pardede No. 42 Prof.DR.H.M.HasballahThaib,MA Nurul Huda Jl. Djamin Ginting Km. 8 Kwala Bekala Drs. Usman Nurul Huda Jl. Sei Serayu No. 38 H.R. Taufiq Nurul Huda Jl. K.H. Wahid Hasyim Asrama Brimob Drs. H.Suparmin Taqwa Kampus II Jl.Setia Budi No.79-B/Jl.Sei Serayu H. Mahdar Haris Lubis, S.Ag MEDAN BARAT At-Taqwa Jl. Puteri Hijau No. 14 Drs. Abdul Majid Syam Al-Furqan Jl. Karya II Kompleks Ex Kowilham Kel.K.B. Drs. Indra Budiman Al-Hasanah Inna Dharma Deli Jl. Balaikota H.A. Iqbal, Lc Al-Istiqomah Jl. Putri Hijau No. 01 Komp. Deli Plaza Drs. Masdar Syahban Al-Jihad Jl. Kom. Laut Yos Sudarso/Jl. Pertempuran Drs. H. Ahmad Sanusi, Lc, M.Ag Al-Muttaqin Jl. Karya No. 41 Kel. Sei Agul H. Chairuddin Pulungan Al-Massawa (Arab) Jl. Temenggung (Arab) No. 2,4,6 H. Azwaruddin Nasution Baitus Syifa RS. Tembakau Deli PTP Nusantara-II H.M. Darwin Zainuddin, MA Haji Maraset Jl. Sei Deli No. 139 Drs. Muhammad Nasution Jami Jl. Merdeka No. 3 Pulo Brayan Kota Drs. Abd. Majid Jami Jl. Kejaksaan Ujung Drs. H. Yulnaldi Jami Ash-Shalihin Jl. S.M. Raja No. 178-A Harianto, S.S. Nurul Hidayah Jl. Danau Singkarak Gg.Masjid Lingk. I Suwardi Nurul Islam Jl. Karya Lk.VIII No.203 Kel.K.Berombak Irham Taufiq, S.Ag Lama Jl. Mesjid Gg. Bengkok No. 62 Kel. Kesawan H. Choliluddin Usman Rabithatul Muslimin Lingk. 14 Kel. Glugur Kota Drs. Ky. Najaruddin Panjaitan Syuhada Komp. Trikora Jl. Danau Toba No. 2 Syafruddin Syam, MA Taqwa Jl. Karya Gg. Madrasah No. 24 Drs. Parman Siagian, MA MEDAN BELAWAN Al-Aqabah Jl. Taman Makam Pahlawan G. Arang Mansyur, S. Jami Belawan Jl. Selebes Belawan Drs. M. Yusuf, A.G. Namiroh Asrama Haji Embarkasi Medan Drs. H.M. Arifin Umar Al-Hasanah Jl. Teratai No.17-A Lingk.V Kel.Sari Rejo Drs. Rusli Tanjung Nurul Aldys Jl. Karya Bakti No. 34 Pkl. Masyhur Abd. Wahab, SHI Baitussalam Kosek Hanudnas III Mashur Utama Hsb., Sos., S.Pd.I MEDAN DELI Nurul Falah Jl. Eka Rasmi 42 Kel. Gedung Johor Drs. H. Rusli, MR Bakti Jl. Mongonsidi Baru I No. 11 Drs. Usman Hasibuan, SH Amalyatul Huda Jl. Nusa Indah No.22-A Kel.Tg.Mulia Drs. Elisman Silaturahmi Jl. Brigjen Zein Hamid Ling. XVI G.Wakaf H. Parsaulian Siregar, Lc Dirgantara Lanud Jl. Imam Bonjol No. 52 Drs. Syahroni Husin Ar-Ridho Komplek TNI AL Barakuda Tg. Mulia Hilir Sarman Sunnah Rabithah Jl. Karya Darma Pkl. Masyhur Syahril Artha Hidayatullah Jl. DC. Musi Lingk. I Kel. Sukadamai Drs. Abu Bakar Ar-Rakid Jl. Kol. Laut Yos Sudarso Iqrar Anshori Silaturrahim Jl. Antariksa No. 64 Kel. Sari Rejo Drs. Sariman Alfaruq MEDAN KOTA Taufiq Jl. Pendidikan Gg. Taufiq No. 17-D Drs. M. Kasim Yusuf As-Saadah Jl. Aluminium IV Gg.Tawon Tg. Mulia H. Asad Marlan, MA Al-Amanah Jl. K.L.Yos Sudarso Km. 6,8Kel.Tg.Mulia Abdul Kadi Hasibuan Al-Hidayah Jl. Saudara Kel. Sudirejo-II Drs. Ali Imran Sinaga Al-Hasanah Jl. Tanjung Bunga II Kel.Sudirejo II Drs. H.M. Ali Kasirin MEDAN SELAYANG Al-Ikhlas Jl. Aluminium III Kel. Tg. Mulia Fahrul Rizal, M.SI Al-Ikhlas Complek Deli Raya Kel. Titi Papan H. Bustami, Lc Al-Huda Jl. Kemiri III No. 28 Ir. Abu Ismail Al-Arif Kompl. Tm.Setia Budi Indah II Blok III No.136 Drs. Abdurrahim Gea, M.Ag Al-Munawwarah Jl. Pulau Batam No. 1 Drs. H. Sokon Saragih, MA Al-Ikhlas Jl. Salak No. 09 Drs. M. Zainuddin Al-Ghufron Jl. Bunga Wijaya Kesuma Pasar IV Feri Syahbudin, SHI Al-Mustaqiem Kel. Tg. Mulia H. Parmohonan Nasution Al-Mashun Medan Deli Jl. Sisingamangaraja Drs. H. Abd. Rahim, M.Hum Al-Ghufron Jl. Suka Baru No. 21 Kel. P.Bulan Syarifuddin Sinaga, S.Ag Al-Syarifah Jl. Metal Gg. Rukun Ling. 18 Tg. Mulia Ahd. Yunan Siregar, S.Ag Baiturrahim Jl. Pelajar Timur Gg. Darmo No. 5 Mansyur Hidayat, S.Pd.I Al-Ikhlas Jl. Raharja No. 25 Kel. Tg. Sari Drs. Syaid Marqum Jamik Jl. K.L. Yos Sudarso Km. 6,2 Sofyan, MS Dawah Jl. Sakti Lubis Gg. Amal No.5 Kel. Sitirejo-I Drs. H.M. Basyir Yahya Al-Ikhlas Pasar VII, P. Bulan H. Abdul Jamil Jamiiyyatush Shoolihiin Jl. Almunium I Lk. XIII Drs. H. Norman, S. Muslimin Jl. Air Bersih Lingk. III Kel. Suderejo I Drs. Jamaluddin Batubara, Lc Al-Istiqomah Jl. Sei Asahan Gg. Masjid No. 3 Drs. A. Wahab Kalimantan Nurul Iman Jl.Sidomulyo Ujung Lingk. XXVI Tg.Mulia Soman Batu Bara Muallimin Jl. S.M. Raja Kp. Keluarga No. 33 Drs. H. Kemal Fauzi Al-Muttaqin Jl. Setia Budi Gg. Tengah No. 11 H. Syamsuddin Trg., Lc, S.Pd.I Maul Hayah PDAM Tirtanadi Jl. S.M. Raja No. 1 DR. H. Ahmad Zuhri, Lc, MA Al-Muhtadun Jl. Karya Sembada No. 179 Drs. Hakimuddin MEDAN DENAI Islamiyah Jl. Jati 3 No. 85 Teladan Timur Drs. H. Yusdarli Amar Jami Jl. Psr I Lingk. VIII Tg. Sari Drs. Lukman Hakim Arafah Jl. Boromo Ujung/Jl.Selamat Gg.Mulia No. 3 Drs. Nasruddin Thola Jami Teladan Jl. Teladan/Gembira No. 2 A. Syafii Harahap, S.Ag Muslimin Jl. Setia Budi Kel. Tg. Sari H. Qosim Nurseha, Lc Ar-Ridha Jl. Camar 18 Perumnas Mandala Drs. Munirruddin, MA Jamik Jl. Air Bersih Gg. I Kel. Sudirejo-I Drs. B. Amin Nasution Nurul Mukmin Jl. Bunga Kantil 18 Psr VII Pd. Bulan H. Hasan Basri Al-Ansor Jl. Raya Tenggara Gg. Ansor Drs. Junaidi Pahlawan Muslim Jl. Pencak H. Darwin Zainuddin, MA Nurul Mukmin Jl. Bunga Mawar No. 46 Drs. Arfiansyah Al-Fajar Jl. Harapan Pasti No. 50 Kel. Binjai H. Naziruddin Idris, Lc Ridho Bakti Jl. Air Bersih Lingk. IX Kel. Sudirejo-I Drs. H.M. Rayhan Nst., MA Nurul Mukminin Jl. Kenanga Raya No. 10 Tg. Sari Zainal Arifin, S.Ag Al-Hidayah Jl. Menteng Indah VI H Blok D7 H. Abu Bakar Adnan Raya Pusat Pasar Prof.Dr.H. Hasyimsyah Nst., MA Nurussalam Jl. Bunga Cempaka No. 53 P.B.S. II Drs. H. Harianto Efendi Al-Hidayah Jl. Bromo Gg. Masjid Al-Hidayah Drs. H. Anil Bakhtiar Silaturrahim Jl. Pelajar No. 58 Kel. Teladan Timur Drs. Ahmad Suhaimi, MA Nurul Huda Jl. Bunga Asoka No. 117 Asam Kumbang Drs. H.M. Nasib Selmi Al-Hasanah Jl. Merpati I No. 1 Kel. Kenangan Baru Harmein Lubis Setia Amal Jl. Sakti Lubis Gg. Pegawai Kel.Sitirejo Fahrial Tanjung, S.Ag Salamiyah Jl. Bunga Wijaya Kesuma, 58 D Pasar IV H. Zainuri, S.Ag Al-Mukhlishin Jl. Bromo Ujung/Jl.Selamat Kel. Binjai Drs. H. Abdul Muthalib Taqwa Jl. Mahkamah K. 36-C Kel. Masjid Drs. Ruskan Nawawi Taqwa Jl. Setia Budi Pasar I/Abd. Hakim No. 2 Drs. H. Dalail Ahmad, MA Al-Mukhlishin Jl. Enggang I Perumnas Mandala Drs. Syahrun Purba Tarbiyah Simpang Limun Drs. Hamdan Manurung, MA Taqwa Jl. Bunga Wijaya Kesuma Psr IV Gg. M.Taqwa Dedi, S.Ag Al-Muslimun Jl. Bromo (Rawa Sembilang) Gg.Kurnia Drs. H. Nurman Almi Thawalib Jl. S.M. Raja Gg. Isa No. 7 H. Muhammadin Angkasah, Lc Taqwa Jl. Sembada No. 25/33 M. Arif, M.Ag Al-Quba Jl. Denai/Rawa No. 233B Kel. Tegalsari I Ahmad Humaidi MEDAN LABUHAN MEDAN SUNGGAL Baiturrahman Jl. Medan Tenggara VII No. 42 Drs. Zulkifli Nasution Jannatulalim Jl. Pancasila/Rawa Cangkuk IV No. 1 H. Mhd. Hafiz, Lc Ash-Shobirin Jl. Pancing V Lingk. III Kel. Besar Munawwir, S.Ag Ar-Rahmat Jl. Mesjid No. 20 Dusun III Desa Helvetia Syamsul A. Adnan Nurul Iman Jl. Rawa Lr. Sedar Muhayyan, S.Pd.I, S.HI Al-Husein Jl. Raya Griya Martubung Kel. Besar Drs. H. Sugiman, S. Ar-Ridha Jl. Darussalam No. 52-A Kel. Babura H. Suhaidi Arfan, Lc Nurul Hidayah Jl. Tangguk Bongkar II No. 28 H. Musdar Bustamam Tambusai, Lc Al-Mukarramah Kampung Besar Darat Kel. Martubung Drs. M. Syafii, MS Ar-Ridha Jl. Tut Wuri Handayani Perkamp.Kodam I/BB Hakimuddin, S.Ag Nur Hidayah Jl. Datuk Kabu Gg. Masjid No. 11-C Drs. Ade Mustahdi Aly Baitul Ikhwan Jl. T. Lestari 12/198 Griya Martubung H. Irwansyah, SH Al-Basyir Jl. Garuda No. 78B Sei Sikambing B Maksum Harahap, S.Sos.I Taqwa Jl. Bromo Gg. Aman Drs. H. Tarmizi, Lubis Nurul Ikhwan Jl. Helvetia By Pass Gg. Masjid No.234 Nasrun Saragih, BA Al-Badar Jl. Binjai Km. 6,8 Medan Drs. Burhanuddin Harahap Taqwa Jl. Mandala By Pass No. 140 Drs. Adri, K. Nurul Hidayah Jl. Veteran Lr. Sukoharjo No. 27-A Zulfikar, S.Pd.I Al-Falah Jl. Murni No. 27 Tg. Rejo Drs. Marasalim Hasibuan Taqwa Jl. Pancasila Gg. Masjid No. 1 Kel. T.S.M.III K.H. Munawar Chalil Nurul Khairiyah Jl. Veteran Ujung Pasar X Drs. Paino Al-Hasanah Jl. Stasiun No. 4 Dusun I Tg. Gusta Drs. Mahadi MEDAN HELVETIA MEDAN MAIMON Al-Huda Jl. Perjuangan No. 44 Tg. Rejo Drs. H.M. Syafriddin Al-Hikmah Jl. Kiwi No. 7 Sei Sekambing B. Drs. Moh. Shaleh Rambe As-Syarifah Jl. Pembangunan Komp. Pondok Surya Drs. Budiman ACC Jl. Palang Merah No. 2 Drs. M. Ali Hasibuan Al-Hafiiz Jl. Pinang Baris No. 142 Bustami, HS Attholibin Husni Jl. Veteran Gg. Utama Pasar 5 Diauddin Tanjung Abidin Jl. Brigjen Katamso Km.III No.420 Kel.Kp.Baru Drs. H. Nurman Almy Al-Ikhlas Jl. Binjai Km. 16.5 Dusun I Aman Damai Zainuddin, S.Ag Al-Amal Jl. Banten Gg. Amal Dusun X Zulfikar, S.Pd.I Al-Husna Jl. Teratai M. Hasbi Almawardi Lbs., S.Ag Al-Ikhwan Eks Komplek PTP III Desa Lalang Drs. Poniman, S. Al-Falah Jl. Cendana Blok 17 Perumnas Helvetia Zulfan Effendi P. Harahap, S. Al-Muhajirin Jl. Letjend. Suprapto No. 2 H. Mhd. Samin Pane Al-Islamiah Jl. Binjai Km.14,5 Gg.Gembira Diski Drs. Ibrahim Nasution Al-Falah Jl. Palem Raya Perumnas Helvetia Bukhari, S.Ag Al-Mujtahidin Jl. Brigjen Zein Hamid Gg.Lori Kp.Baru H. Irfan Batubara Al-Istiqomah Jl. Raya Medan-Binjai Km.11,5 Dusun I M. Yusrizal, S.Pd.I Al-Furqoan Jl. Kemboja Raya No. 02 Perum Helvetia Zulkifli Rangkuti Darul Ali Jl. Brigjen Katamso Gg. Nasional No. 20 Drs. Darfikri, MD. Al-Irma Jl. Rajawali Sei Sikambing-B Drs. Edy Purnomo Al-Hidayah Jl. Bakti Luhur No. 21 Kel. Dwikora Ponidi Sabari Jami Ash-Sholihin Jl. Brigjen Katamso No. 208 H.Fajar Hasan, MA Al-Jihad Jl. Sunggal No. 129 Drs. Syarifuddin Al-Ikhlas Jl. Klambir Lima Gg. Bahagia Drs. H. Amran Bahrum Jami Kamp. Baru Medan Jl.Brigjen Katamso No.53 Drs. H. Azwardin Nasution Al-Jariah Jl. Gagak Hitam No.117 Sei Sikambing-B Drs. H. Mahmuddin Sirait Al-Ikhlas Jl. Pembangunan Gg. Melati No. 16 Drs. H. Tahlak Mahmud Jami Aur Jl. Kampung Aur Kel. Aur H. Yusri Indra, Lc Al-Muttaqin Jl. Hanura No. 10 Kel. Tanjung Rejo H.M. Yanis, BA Al-Ikhlas Jl. Jongkong No. 1A Komp. Dolog Drs. H. Amran Tanjung Muslimin Jl. Brigjen Katamso Lingk. II Pantai Burung M. Nur Fahmi KH, S.HI Al-Muttaqin Jl. Masjid No. 51 Lingk. II Helvetia Amirwan, S.Ag Al-Ikhlas Jl. Teratai II Blok 18 Perumnas Helvetia Dai Paidi PT.Bank Negara Indonesia (Persero) Jl. Pemuda No.12 Azwani Ramidi, Lc Al-Muhtadin Jl. Setia Budi No. 29 Tanjung Rejo Drs. Lili Suheri Al-Ishlah Jl. Kapten Muslim No. 54-A Drs. H. Adlan Rifai Sirait Thoyyibah Jl. Multatuli Lingk. V No. 64 H. Chairuddaoin Al-Muhajirin Kompl. BBLKI Jl. Gatot Subroto Km.7,8 Drs. Amiruddin, Z. Al-Jihad Jl. Veteran Pasar 8 Helvetia Manunggal Drs. H. Ahmad Nasution, M.Pd. MEDAN MARELAN Al-Musabbihin Jl. Masjid Al Musabbihin Blok C TSI Drs. H. Sudarno Al-Mustaqim Jl. Kapten Muslim No. 226 K.H. Mhd. Abd. Syukur Al-Muawanah Jl. Puskesmas I/Jl. Seroja Suharianto Al-Mukhlisin Jl. Bakti Utara No. 21 Tg. Gusta Umar Hasibuan, S.Ag Al-Muslimin Jl. Masjid Pasar V Kel. Rengas Pulau Drs. Yusril Fuad Al-Munir Jl. Karya Baru No. 07 Tanjung Rejo Drs. Muhammad Nasution Al-Muhajirin Perumahan Bumi Asri Helvetia I Drs. H. Mukhtar Baijuri Ar-Ridha Jl. Platina Raya Lingk. 21 Kel.Rengas Pulau Mhd. Rusli Nasution, S.Ag Darul Huda Jl. Kasuari No. 53-55 Sei Sikambing-B Drs. Soritaon Siregar Al-Masturah Jl. Binjai Km 7,8/Jl. Sekolah No. 29 Bustami Taqwa Jl. Marelan Raya Pasar 3 Timur Drs. Hisyam Dalimunthe Istiqomah Jl. Binjai Km. 7.2/Perwira No. 20 Achmad Syukri N., S.Sos Darussalam Jl. Asrama No. 11 H. Roqib Mas MEDAN PERJUANGAN Istiqamah Jl. Dr. Mansur No. 155 Kel. Tg. Rejo Drs. H. Azhari Akmal Trg., MA Istiqomah Jl. Amal Luhur No. 86 Drs. H. Hazrat Ibrahim Istiadah Jl. Amal No. 4 Kel. Sunggal Drs. Marasonang Siregar Nurul Iman Jl. Bambu No. 37 Pasar IV H. Chairuddin, Lc Ar-Rahmah Jl. Gurilla Gg. Melati No. 5 H. Ali Azmi Nasution, MA Jamik Jl. Pinang Baris No. 19 Kel. Lalang H. Zainal Arifin, Lc Ubudiyah Jl. Klambir Lima Lingk II Tg. Gusta Zainuddin, S.Pd.I Al-Amin Jl. Prof. H.M. Yamin SH, 482 Drs. Saparuddin, MA Jamik M.Jayak Jl. Gatot Subroto Km. 5,5 No. 184 Drs. Isman Rambe Shilaturrahmi Jl. Gaperta Gg. Sekolah, 120 Drs. H. Irham Hasibuan Al-Aminin Jl. Pahlawan/Sakti Kel. Pahlawan Drs. M. Fadhli Said Mukhlisin Jl. Darussalam/ Sei Rokan Drs. H. Legimin Sukri Taqarrub Jl. Darussalam No. 24 Drs. H.M. Anwar Sayuti Al-Falaah Jl. Ibrahim Umar No. 3 H.M. Suwandi Harun, SH Nurul Huda Jl. Garuda No. 29 Sei Sikambing-B Hasanul Arifin, S.Ag Taqwa Sukadono Jl. Pemasyarakatan Gg. M.Taqwa Drs. H. Azhar Razak Lubis Al-Huda Jl. Malaka No. 117 H. Mari Muh. Sitorus, S.Ag Nur Rukiah Jl. Pungguk No. 42 Kel. Sei Sikambing-B M. Labib Maulana, BA Taqwa Tanjung Gusta Jl. Setia No. 30 Asrizal Tanjung Al-Ikhlas Jl. Setia Jadi Gg. Masjid Drs. Aspan Abdullah Sianipar Nurul Amaliyah Jl. Jend. Gatot Subroto Km. 9 Drs. Ridwan Thohar Taqwa Helvetia Jl. Kamboja Raya no. 319 Blok 4 Syahrul, AS Al-Muslim Jl. Pelita VI Gg. Serayu No. 10 Drs. Armia Yusuf Riyadussholihin Lingk. XIV Kel. Sei Sikambing-B DR. H. Amnas N, SH Taqwa Jl. Kapten Sumarsono, Gg. Safar Jailani, S.Ag Al-Muslimin Jl. Gerilya No. 1 Bulian Mulfa Purba, SHI, S.Pd.I Shafiyyatul Amaliyyah Jl. Setia Budi No.191 Tg.Rejo Prof. DR. H. Asmuni, MA Taqwa Jl. Kapten Muslim Gg. Jawa Drs. Matsyeh, MG Al-Majidiyah Jl. Prof.H.M. Yamin SH Gg. Belimbing Yahya Ishak, Lc Syuhada Jl. Balam Lingkungan XIII Sei Sikambing-B Drs. Asman Ali Nur Harahap MEDAN JOHOR Hidayatul Ihsaniyah Jl. Sentosa lama Gg. Aman No.5 Drs. H. Akhiruddin Muhid Silaturrahim Jl. Perintis Kemerdekaan D.SeiSemayang Drs. Armianto Istiqomah Jl. Bambu Runcing/Pahlawan Drs. Ngatman Azis Taqwa Jl. Merpati Gg. Mushollah Sei Sikambing-B Sutan Syahrul Amanah Jl. Eka Bakti Ujung Lingk. IV Kel. Gd. Johor Fakhrurrozi, S.Pd.I Ikhwaniyah Jl. M. Yacub No. 3 Drs. H. Umar Khatib Taqwa Jl. Garuda Sei Sikambing-B Drs. Bahrin Manik Arrahman Jl. Brigjen Zein Hamid Kel. Titi Kuning Drs. Sugeng Wanto, MA Ikhsaniah Jl. Gurilla No. 31-A Kel. Sei Kera Hilir-I Drs. Ramli Nur, MA Taqwa Jl. Taqwa Gg. Pendidikan Tg. Rejo Drs. M. Nurdin Amaliyah Perumahan Citra Wisata Drs. H. Khairuman Arsyad Ibnu Sina RSU DR.Pirngadi Jl. Prof.H.M.Yamin No.47 Drs. Ajran Tanjung Assyafiiyah Jl. Suka Tari No. 9 H.M. Yusri Indra, Lc Jamik Ubudiyah Jl. Pelita-I Gg. Tangga Batu 11 Drs. Ikhsan Asri, MA MEDAN TIMUR Ar-Raudhah Komplek Risva I Blok V Fachruddin R., S.Ag Jami Sentosa Jl. Sentosa Lama Gg. Perwira No. 1 Drs. Ali Amnar Tambunan Ainul Iman Jl. Eka Warni I Kel. Gedung Johor Sofwan Harahap, S.Ag Malikus Saleh Jl. Gurilla No. 10 Kel. Sei Kera Hilir Drs. H. Amhar Nasution, MA Amal Jl. Ngalengko Lr. Saudara No. 11 Salamuddin SL, M.Ag Annazhirin Jl. Karyawisata Gedung Johor Drs. H. Khaidir Lubis Syuhada Jl. Pahlawan No. 11 Kel. Pahlawan H. Ahmad, K.S. Amal Ridha Jl. Cemara P. Brayan Bengkel Baru Drs. H.T. Yusuf Al-Amin Jl. Eka Surya Gg. Eka Kencana Azman, SHI Thaharah Jl. Pelita II No. 29 Kel. Sidorame Barat Drs. Ahmad Harahap Amaliyah Jl. Perwira II Pulo Brayan Bengkel Drs. A. Hakim Al-Badar Jl. Karya Dharma No. 19 Kel. Pkl. Masyhur Fachruddin Rokan, S.Ag Arrahim Jl. Purwosari Gg.Puskesmas P.Brayan Bengkel Drs. Soeparlan Al-Hidayah Jl. Karya Jaya Gedung Johor Drs. Fahror Rozi MEDAN PETISAH Ash-Sholah Jl. Pendidikan No. 39 Kel. Glugur Darat I Drs. Bustami, HA Al-Huda Jl. Eka Surya Psr V Gg. Sidodari Ged. Johor Mhd. Husni, S.HI Annas Komplek Diskes Jl. Ibus Raya/Jl. Rotan Zulfikar Hajar, Lc Al-Ala Jl. Pembangunan I No.46 Krakatau Kel.Glugur Alirman, S.Ag, MA Al-Ikhlas Jl. STM Suka Ikhlas Drs. Arifin Umar Ar-Ridhwan Jl. Abd. Hamid No.28 Kel. S.P. Tengah M. Jafar As-Shogir, S.Ag Al-Barkah Jl. Setia Jadi Kel.Glugur Barat I Drs. H.M. Samin Pane Baiturrahman Komp Perum Johor Indah Permai I Drs. H. Nazaruddin Hasibuan As-Syahaadah Jl. Sikambing Belakang No. 18 Drs. Irwansyah Putra Al-Furqoan Jl. Asahan No. 78 Kel. Sidodadi Drs. H. Ibrahim Isa Al-Ikhlas Jl. Eka Suka Lingk. XIII Gedung Johor Drs. Asrorudin Saidi Asy-Syura Jl. Surau No. 16 Kel. Sei Putih Timur-I Drs. Darfikri Emde Al-Hidayah Jl. Jawa No. 3 Kel. Gg. Buntu Drs. H. Askelani Pulungan Al-Ikhlas Jl. Karya Tani Lingk. VIII Pkl. Masyhur H. Burhanuddin Parinduri Al-Hidayah Jl. Periuk Gg. Masjid No. 2 H. Usman Lubis Al-Iman Jl. Sidang Raya, Komp. DPRD Tk. I P.B.B. Ali Sinaga, S.Ag Al-Issyah Hakim Jl. Karya Jaya/Namo Rambe Psr IV Drs. Aswan Efendi Nasution Al-Ihsan Jl. PWS No. 48 Kel. Sei Putih Timur II Drs. Abdul Majid Al-Ikhwan Jl. Prajurit No.28 Gg.Bali Kel.Glugur Darat Drs. Khairudarain, M.Ag Al-Muslimin Jl. Suka Luhur Kel. Suka Maju Dr. H. Ramlan Rangkuti, MA Al-Mukaram Jl. Sikambing Gg. Citarum No. 58 Drs. Slamet, S.Pd.I Al-Ihsan Jl. Jemadi No. 34 H.M. Azir Lubis, Amd Al-Muhsinin Jl. Pintu Air Simp. Pos Ahmad Junaidi Nurul Hidayah Jl. Tinta No. 69 Kel. Sei Putih Barat H. Rokib Mas Al-Ikhlas Hubdam-I/BB Jl. Timor No. 23 Zainal Arifin, MA Al-Muharram Jl. Eka Budi Gedung Johor Drs. A. Jalil Husein Nurul Haq Jl. Listrik No. 12 Drs. H. Nazrul Fahri Al-Ikhlas Jl. Umar No. 71 Kel. Glugur Darat I Drs. M. Solihul Amri Al-Mahmudiyah Jl. Brigjen Hamid Km.5 Kel. T.Kuning H. Rusli Tanjung Istiqamah Pasar Petisah Drs. H. Hamdan Yazid Al-Ikhlash Jl. Madiosantoso No. 197 Lingk. 14 Drs. Muhammad Yusuf, MS Baitul Iman Jl.Karya Jaya Asrama Arhanud P.Masyhur Drs. H.M. Syuaib Saragih Istiqomah Jl. Abdul Hamid No. 70 H.M. Nurhadi Sayuti Al-Muslimin Jl. Brigjend Bejo/Cemara Gg. Rambutan Syarwan Nasution, S.Ag Baiturrahmah Jl. Karya Jaya No. 101 Pkl. Masyhur H. Zulkifli Lubis Raya Aceh Sepakat Jl. Mengkara No. 2 DR. Faisar Ananda, MA Al-Mukhlishin Jl. G.B. Josua No. 8 Drs. Saukani Muda, MA Baitussholihin Jl. Karya Bakti No. 71 H. Parlin Bancin, Lc Ubudiyah Jl. Kebun Bunga/Jl. Jend. S. Parman H.M. Bakri Nasution Al-Maruf Jl. Sidorukun/Wartawan No.99 P.B.Darat II Drs. H.M. Yusuf Said, MA Fajar Ramadhan Komplek Perum.Johor Indah Permai II H. Ahmad Faisal Nasution, M.Ag Al-Waritsiin Jl. Bilal No. 71 Kel.Pulo Brayan Darat I H. Ali Imran Zakaria, Lc Muslimin Jl. Karya Jaya No. 120 Kel. Pkl. Masyhur Drs. Ali Imran Rokan MEDAN POLONIA Al-Quddus Jl. Pukat Harimau d/h Jl. Aksara No. 136 Drs. H. Syahminan Hasibuan Muslimin Jl. Eka Surya Pasar V Drs. H. Syarifuddin Hasan Amaliyah Jl. Balai Desa Gg. Amal No. 43 Drs. Syamsuri Baiturrahman Jl. Gaharu Komplek PTPN-II H. Yazid Syamsuddin, Lc Muttaqiin Jl. Luku I No. 42 Kel. Kwala Bekala Drs. Yusuf Asady Al-Hidayah Jl. Starban Kel. Sari Rejo Drs. Basyirun Bustanul Huda Jl. Perwira I Lingk. VIII Drs. M. Labib Maulana 14. WASPADA Jumat 20 November 2009 Sumatera Utara 17 Kota Zhuhur Ashar Magrib Isya Imsak Shubuh Syuruq Kota Zhuhur Ashar Magrib Isya Imsak Shubuh Syuruq Kota Zhuhur Ashar Magrib Isya Imsak Shubuh Syuruq Kota Zhuhur Ashar Magrib Isya Imsak Shubuh Syuruq Medan 12:11 15:33 18:11 19:22 04:42 04:52 06:09 Langsa 12:13 15:36 18:12 19:23 04:45 04:55 06:13 Sabang 12:24 15:46 18:21 19:32 04:57 05:07 06:25 Tarutung 12:10 15:32 18:11 19:22 04:38 04:48 06:06 B. Aceh 12:24 15:46 18:21 20:33 04:57 05:07 06:25 L.Seumawe 12:17 15:39 18:15 19:26 04:50 05:00 06:17 Pandan 12:10 15:32 18:12 19:23 04:39 04:49 06:06 T.Tinggi 12:09 15:31 18:09 19:20 04:39 04:49 06:07 Binjai 12:11 15:34 18:11 19:22 04:42 04:52 06:10 L. Pakam 12:10 15:30 18:10 19:21 04:41 04:51 06:08 Sibolga 12:10 15:32 18:12 19:23 04:39 04:49 06:06 Panyabungan 12:07 15:29 18:10 19:21 04:34 04:44 06:02 Bireuen 12:19 15:41 18:16 19:27 04:51 05:01 06:19 Sei Rampah12:09 15:31 18:09 19:20 04:40 04:50 06:08 Sidikalang 12:12 15:34 18:12 19:24 04:41 04:51 06:06 Teluk Dalam12:14 15:36 18:18 19:29 04:41 04:51 06:09 B. Pidie 12:18 15:40 18:17 19:28 04:50 05:00 06:18 Meulaboh 12:21 15:43 18:20 19:31 04:52 05:02 06:20 Sigli 12:21 15:44 18:19 19:30 04:54 05:04 06:22 Salak 12:12 15:34 18:13 19:24 04:41 04:51 06:09 G. Sitoli 12:15 15:37 18:17 19:29 04:43 04:53 06:10 P.Sidimpuan12:08 15:31 18:11 19:22 04:36 04:46 06:04 Singkil 12:14 15:36 18:16 19:27 04:43 04:53 06:11 Limapuluh 12:08 15:30 18:08 19:19 04:38 04:48 06:06 K. Jahe 12:11 15:34 18:12 19:23 04:42 04:52 06:09 P. Siantar 12:09 15:31 18:10 19:21 04:39 04:49 06:07 Stabat 12:11 15:33 18:11 19:22 04:42 04:52 06:10 Parapat 12:10 15:32 18:10 19:22 04:39 04:49 06:07 Kisaran 12:07 15:29 18:08 19:19 04:37 04:47 06:05 Balige 12:09 15:31 18:10 19:22 04:38 05:48 06:06 Takengon 12:18 15:40 18:17 19:28 04:50 05:00 06:17 GunungTua 12:07 15:29 18:09 19:20 04:35 04:45 06:03 Kutacane 12:14 15:36 18:14 19:25 04:45 04:55 06:12 R. Prapat 12:06 15:28 18:08 19:19 04:35 04:45 06:02 T.Balai 12:06 15:29 18:07 19:18 04:36 04:46 06:04 Sibuhuan 12:06 15:29 18:09 19:20 04:34 04:44 06:02 Dihisab oleh: Tim Ahli Badan Hisab dan Rukyat (BHR) Sumut Tapaktuan 12:17 15:37 18:17 19:28 04:47 04:57 06:15 Lhoksukon 12:16 15:38 18:14 19:25 04:49 04:59 06:16 Miliki 2 Paket Kenalan Bikin Heboh SS Dibekuk STABAT (Waspada): Dalam sepekan terakhir Kajari Stabat Maju Ambarita, SH kebanjiran tamu di ruang kerjanya. Hal TELUKMENGKUDU (Was- itu dikarenakan dia baru bertugas di Kab. Langkat mengganti- pada)Karenakedapatanmemiliki kan pejabat lama Febrie Adriansyah, belum ada 10 hari. sabu-sabu sebanyak 2 paket kecil Seiring dengan banyaknya tamu yang berkunjung dari WD alias Acien,31,warga Dusun kalangan pejabat, heboh sejumlah pimpinan SKPD diperiksa Suka Makmur,Desa Sei Buluh, penyidik, padahal menurut Kasi Intel Kejari Gloria Sinuhaji, Kec.Teluk Mengkudu, Kab. Ser- tidak ada pejabat Kab. Langkat yang diperiksa dalam pekan dang Bedagai diamankan buser ini. Mereka hanya ingin berkenalan dengan Kajari, tuturnya, Sat Narkoba Polres Sergai Selasa Rabu (18/11). (17/11) sekira pukul 20.00. Pada dasarnya, lanjut Kasi Intel, Kajari sangat terbuka Keterangan yang Waspada bagi siapa saja yang berkunjung ke kantornya ingin berkenalan, peroleh,Rabu(18/11), penangka- bahkan salah seorang dari empat tersangka dugaan korupsi pan tersangka berkat informasi yang belum ditahan, beberapa hari silam datang berkenalan dari warga. Petugas kemudian dengan Kajari di ruang kerjanya. Walau demikian kunjungan itu jangan disalahartikan melakukan penggerebekan ter- akan adanya keringanan atau pengaburan penanganan kasus hadap tersangka. saat petugas tindak pidana korupsi. Penyelidikan dan agenda pengusutan hendak menggerebek tersangka kasus yang telah dibahas tetap berlanjut. (a38) yang saat itu berada di arena biliar di kediamannya mencoba menghi-langkan barang bukti Warga Batubara Tewas dengan cara menelan serbuk putih. Laka Lantas KabagBinaMitraPolresSergai PERBAUNGAN (Waspada): Kecelakan maut yang mene- melalui Kasat Narkoba Iptu Irsol waskan seorang pengendara sepeda motor kembali terjadi membenarkan. (a07) di Jalinsum Medan Tebingtinggi di Km 38-39 persisnya di Dusun I, Desa Pematang Sijonam, Kec. Perbaungan, Kab. Serdang Bedagai, Selasa(17/11) sekira pukul 19:15. Korban Polisi Amankan adalah Andi Sinaga, 22, warga Desa Tanjung Sari, Kec. Sei Suka, Kab. Batubara. CEMARI SEI PADANG : Limbah karet dari PT Dharmasindo Inti Karet di Jalan Ir H Djuanda, Kel. Karya Jaya, Kec. Rambutan, Kota Tebingtinggi, terlihat Waspada/Abdul Khalik Agen Togel Keterangan yang dihimpun Waspada, Rabu (18/11) mencemari aliran sungai Padang. Air limbah karet itu, masih menghitam mengotori bagian sungai. Sedangkan tumbuhan yang ada di sekitar tepian sungai, BINJAI (Waspada): Sat Res- dikepolisian menyebutkan, korban mengendarai sepeda terlihat mengering. Foto direkam, Rabu (18/11). krim Polresta Binjai dipimpin motor Yamaha RX King BK 6752 QD seorang diri datang Kanit Jahtanras Ipda Ade Candra, dari arah Medan menuju Tebingtinggi. Rabu (18/11) pukul 14:00 berhasil Karena Pasfoto Berjilbab, Setibanya di TKP diduga korban ditubruk oleh kendaraan , mengamankan N, 61, agen togel dari arah yang sama yang mengakibatkan korban tersungkur dan tewas di TKP Hasil olah TKP petugas unit Laka Polres . (totogelap)Singapura,wargaDu- Sergai menyimpulkan korban ditubruk dari belakang. sun Batu Gajah, Desa Mancang, Kasat Lantas Polres Sergai AKP Ir Jagani Sijabat, SH melalui Kec. Selesai. Tersangka agen diri- Kapos Sejenggi Aiptu Jamal S. Pane kepada wartawan mem- benarkan peristiwa tersebut korban. Akibat luka memar dibagain tubuh dan mengeluarkan darah segar dari mulut korban akhirnya tewas di TKP. (a07) Gagal Ikuti Ujian CPNS Di Karo ngkus dari salah satu warung di DusunSebenang,DesaMancang, Kec. Selesai. Petugas selain mengaman- kan agen juga uang sebanyak Rp KABANJAHE (Waspada) : hal itu setelah menerima surat Kamis (19/11), di Kabanjahe. juga dia memakai jilbab seba- karena memakai jilbab. Ini Wabup DS Terima PT Jamsostek Seorang, warga Jalan Siki pemberitahuan yang ditanda Alumni IAIN Fakultas Tarbi- gaimana yang diwajibkan dalam hanya urusan duniawi saja. Saya 35.000 diduga hasil penjualan kupon togel, 1 lember kertas beri- tangani Sekdakab Karo Ir Mak- yah tahun 1999 ini mengatakan, ajaran agama yang dia anut. akan tetap menjaga akidah dan LUBUKPAKAM (Waspada): Wakil Bupati Deli Serdang Kabanjahe,Siti Aisyah,34, mur Ginting mengatas namakan ia mengajukan lamaran menjadi Saya tak menyangka ter- melaksanakan ajaran agama kut angka tebakan togel bersama H Zainuddin Mars, menerima pejabat PT Jamsostek (Persero) gagal mengikuti ujian CPNS Bupati Karo melalui jasa pos, CPNS untuk menjadi tenaga nyata karena pasfoto yang ber- saya untuk menutup aurat dari jumlah uang pasangan dan satu Kanwil I Sumut bersama Kacab Jamsostek Tanjungmorawa Pemkab Karo. Dia Rabu (18/11). Dalam surat, dije- guru Pendidikan Agama Islam jilbab, saya gagal mengikuti non muhrim yang notabene unit handphone merk Nokia de- berkaitan dengan pemantapan kerjasama dengan Pemkab laskan, dirinya gagal dalam di Pemkab Karo tertanggal 12 ujian. Padahal, jilbab itu murni urusan dunia dan akhirat yang ngan tulisan nomor tebakan be- Deliserdang,Rabu ( 18/11). dinyatakan tidak lulus serta jumlah uang pasangan, di seleksi berkas sebagai peserta November dan cap pos 13 No- ajaran agama yang diwajibkan tak bias ditawar-tawar lagi, Hadir mendampingi Kadis Naker Deliserdang Drs HA dalam seleksi berkas CPNS karena melampirkan vember lalu. dan pelaksanaannya telah jelas pungkasnya. dalam handphone tersebut tidak Rukman Pane, Kadis Ciptakarya Ir Donald P Lumbantobing disebabkan hanya karena pasfoto yang menggunakan Siti mengaku tahu tentang dijamin undang-undang, Salah seorang panitia Drs hanya nomor tebakan juga film dan Pl Kadis Infokom Maiber Sitompul SE. dirinya bersikukuh untuk jilbab. adanya syarat yang menyatakan tuturnya. Daud Sembiring yang juga Ka- porno dengan beberapa adegan. Rombongan PT Jamsostek (Persero) terdiri dari Kanwil Dalam surat itu dinyatakan, pasfoto yang dilampirkan da- Menurut Siti, kebijakan bid Diklat pada Badan Kepe- Kapolresta Binjai AKBP I Sumut Mas ud Muhammad, S Simarmata SH Kacab Jam- mengenakan jilbab di penyebab kegagalan saya karena lam berkas tanpa penutup ke- seperti ini akan membuat mus- gawaian Daerah Karo saat dite- Robets Kennedy melalui Kasat sostek (Persero) Tanjung Morawa beserta staf. Audiensi bertu- pasfotonya. mengirimkan pasfoto hitam pala. Namun, ia merasa hal itu limah kehilangan hak sebagai mui mengatakan, ketentuan Reskrim AKP HM Taufiq ketika juan untuk memantapkan kerjasama dengan Pemkab Deliser- putih ukuran 3 x 4 cm yang me- bukan bersifat mutlak dan me- warga negara yang konsisten berlaku secara nasional. Kalau dang dalam mensukseskan program PT Jamsostek tersebut dikonfirmasi Kamis (19/11) nggunakan penutup kepala, milih untuk mengirimkan pas- terhadap syariah yang diwajib- ada di kebijakan berbeda di ke depan. (a05) Menurut pengakuan Siti ke- membenarkan. (a04) aku Siti yang didampingi sua- fotonya yang mengenakan kan agama. daerah lain, itu kami tidak tahu, pada wartawan, dia mengetahui minya, Tuah Aman, SAg. SH, jilbab. Karena kesehariannya Saya tidak menyesal gagal ujar Daud. (c06) Pameran Pembangunan Di Binjai Tiga Penjudi BINJAI (Waspada):WakilWalikota Binjai H.Anhar A Monel Banyak Bangunan Di T. Tinggi Melanggar Perda Ditangkap Selasa ( 17/11) membuka pameran pembangunan di GOR Jalan Jambi. T. TINGGI (Waspada): Ba- Perda Penataan Ruang Kota 3 tahun dan denda Rp3 miliar. ranya, kata dia, gudang di Jalan Sementara, salah satu peru- TELUKMENGKUDU (Was- Anhar berharap pameran pembangunan selama tiga nyak bangunan di Kota Tebing- Tebingtinggi 2009-2029 yang Sedangkan poin kedua dengan AMD, Kel. Bulian, rumah tanpa sahaan pengolahan padi di Jalan pada): Polsek Teluk Mengkudu hari hendaknya dijadikan sosialisasi hasil dan program tinggi melanggar peraturan, saat ini tengah dipersiapkan. akibat kerugian harta benda bisa IMB di Jalan Gn. Leuser berdam- Sudirman berdampingan de- berhasil meringkus tiga penjudi pembangunan di masa mendatang. khususnya Perda SIMB. Pada- Dikatakan, UU Penataan mendapat hukuman 8 tahun pingan dengan kantor Kel. Tj. ngan Plaza Ramayana, diperki- jenis tujuh luwit di salah satu Kabag Humas Pemko Binjai H.Asnawi menyebutkan hal, kata Kabid Tata Ruang Dinas Ruang Nasional saling berkaitan kurungan dengan denda Rp1,5 Marulak. rakan telah melanggar peruntu- warung kopi di kawasan Dusun pameran pembangunan diikuti 30 peserta, 26 dari instansi Pekerjaan Umum, pelanggaran dengan Perda Tata Ruang Pro- miliar. Bahkan, bila pelanggaran Yang lebih serius dari itu, kan tata ruang KotaTebingtinggi. V Sidodadi, Desa Pematang Strak, pemerintah dan swasta. (a03) Perda itu berdampak pada pe- vinsi dan Perda Tata Ruang Ka- tata ruang menyebabkan ke- ungkap Rege, beberapa bangu- Perusahaan penggilingan padi Kec. Teluk Mengkudu, Kab. Ser- langgaran UU No. 26 Tahun bupaten/Kota. Itu sebabnya, matian, hukumannya mencapai nan di Jalan SM Raja, Kel. Bandar itu harus sudah direlokasi, ka- dang Bedagai, Kamis (19/11) 2008 tentang Penataan Ruang lanjut dia, jika terjadi pelanggaran 15 tahun penjara dengan denda Sono juga melakukan pelang- 131 SD Di Langkat Terima Dana DAK Nasional, dengan hukuman terhadap peruntukan SIMB, su- Rp5 miliar. Rege menegaskan, garan peruntukan SIMB, yakni rena nantinya tak sesuai dengan tata ruang kota, kata Rege. pukul 12:30. Selain meringkus ketiga pidana serius. dah tentu terjadi pelanggaran pelanggaran Perda SIMB akan Istana Mobil, ruko di samping STABAT (Waspada): Dana Alokasi Khusus (DAK) TA 2009 Ir Muharman Rege, Kamis terhadap Perda Tata Ruang Kab/ berdampak pada pelanggaran pekuburan Jl. SM Raja yang di- Ir Muharman Rege juga tersangka petugas juga berhasil untuk rehab SD sebanyak 131 paket di Kabupaten Langkat (19/11), di ruang kerjanya, men- Kota, Perda Tata Ruang Provinsi UU Penataan Ruang. ubah jadi perbengkelan. Demi- menyesalkan melempemnya mengamankan barang bukti tahap pertama telah dicairkan Badan Pengelola Keuangan deteksi sejumlah bangunan bahkan UUTata Ruang Nasional. Terkait itu, Kabid Tata Ruang kian pula dengan komplek pe- aparat penegak Perda Pemko berupa satu set kartu joker dan dan Aset Daerah (BPKAD) masing-masing 30 persen dari yang telah melanggar peruntu- Dalam UU No. 26 Tahun Dinas Pekerjaan Umum itu, rumahan Citra Harapan. Ba- Tebingtinggi. Banyak hunian uang tunai Rp74 ribu. jumlah anggaran, sejak Rabu (18/11). kan surat izin mendirikan ba- 2008, Pasal 69 Poin 1, 2 dan 3, mendeteksi sejumlah bangunan nyak bangunan di komplek yang melanggar Perda SIMB Ketiga pemain judi yang di- Pencairan dana langsung ditransfer ke rekening sekolah ngunan, sehingga dikhawatirkan pelanggaran atas penataan yang melakukan pelanggaran perumahan itu tak mengurus No.25 Tahun 2000, tapi tidak tangkap itu, Sur, 35, warga Ling- yang bersangkutan melalui Bank Sumut, kata Ka BPKAD ke depannya akan melanggar ruang dapat dihukum maksimal Perda SIMB. Beberapa di anta- IMB, kata dia. ditindak aparat, kata dia.(a08) kunganV, Kel. Tualang, Kec. Per- Drs H Taufik didampingi Kabag Humas H Syahrizal di Stabat, baungan, Kab. Serdang Bedagai, Kamis (19/11). Untuk dana DAK Sekolah Dasar di Langkat tercatat angga- ran sebesar Rp31,6 miliar, ujarnya seraya menambahkan Peralatan Rusunawa T. Tinggi Bernilai Jutaan Rupiah Hilang Zul alias Zul, 29, warga Dusun I, Desa Liberia, Kec.Teluk Mengku- pencairan tahap berikutnya menunggu permintaan Dinas T. TINGGI ( Waspada): Rp1,5 juta, terang Rege. Meski belum bekerja karena persoalan lokasi bisnis dan atau fasilitas eksekutif dan yudikatif yang du, Kab. Serdang Bedagai dan P & P setelah memantau penggunaan dana DAK tahap pertama. Rumah susun sederhana cara diakui, pihaknya telah menem- kepemimpinan, persetujuan umum, tarif sewa Rp1.000/M2/ menginginkan dapat menyewa MSP22,warga DusunII,Sidodadi, , (a01) sewa alias Rusunawa Kota patkan satpam di komplek itu DPRD belum bisa diperoleh, kata hari. Lantai II dengan peruntukan hunian itu. Poning aku, tolong Desa Liberia, Kec. Teluk Meng- Tebingtinggi,kinikondisinyamulai untuk menjaga aset yang ada, dia. hunian, disewakan Rp2.500 per kalian awasi pemanfaatannya, kudu, Kab. Serdang Bedagai. mengkhawatirkan. Pasalnya, sebelumdigunakan.Soalinisem- Selainituunitpelaksanateknis kalau tidak alamat kacau semua, Kapolsek Teluk Mengkudu Panwaslu Binjai Dinilai banyak peralatan bangunan ber- pat ditanyakan Asisten Men- daerah (UPTD) juga telah hari khususnya bagi penyewa berusia 51 tahun ke atas. pinta dia. AKP Robert Simbolon didam- nilai Rp12 miliar itu, hilang karena sesnegwaktuberkunjungkemari, diusulkan kepada Walikota. Gagal Tangani Pilleg pencurian, bahkan nilainya kenapa belum dimanfaatkan, Namun hingga kini, keputusan Hunian lantai III untk penye- wa berusia 46-50 tahun disewa- Rusunawa yang merupakan hibah Dipertemen Pekerjaan pingi Kanit Reskrim Aiptu Sima- nungkalit membenarkan adanya mencapai jutaa rupiah. Padahal, ungkap Rege. itu belum juga keluarga. Akibat- Umum RI itu, bertujuan untuk BINJAI (Waspada): Terkait pemilihan calon anggota kan Rp2.000 per hari.Untuk lantai penangkapan tiga tersangka Rusunawa itu bersisian dengan Diterangkan, hingga kini nya, pasca bangunan selesai di- Panwaslu Kota Binjai menjelang pelaksanaan pemilihan kepala IV dengan penghuni 31-41 tahun, membangun perumahan yang pemianjudijenistujuhluwit.(a07) Mapolsek Padang Hilir. usulan untuk pemanfaatan Rus- buat, belum ada kejelasan pe- daerah (Pilkada) Kota Binjai mendatang harus selektif. Pejabat Pembuat Komitmen nawa itu, telah disampaikan ke ngelolaan dan berujung terlan- disewakan Rp1.500 per hari dan menampung warga kurang mampu di bantaran sungai, khu- Demikian Ketua Partai Gerakan Indonesia Raya (Gerindra) Kota Binjai, Azrai menilai kinerja Panwaslu Kota Binjai tidak Dinas Pekerjaan Umum Kota Tebingtinggi Ir Muharman Rege, Walikota. Walikota juga sudah mengeluarkan Peraturan Wali- tarnya bangunan itu selama beberapa bulan belakangan, kata lantai V untuk penghuni usia 30 tahun disewakan dengan harga susnya sei Bahilang dan sei Empat Pengguna mampu untuk mengaspirasikan tuntutan partai. Yang pada kenyataan di lapangan dan rapat pleno KPUD Binjai dinyata- Kamis (19/11) mengatakan, banyakperalatankecilsepertibola kota dan Peraturan Tarif Sewa Rusnawa. Kedua peraturan itu, Kabid Tata Ruang Dinas PU itu. Berdasarkan usulan Tarif Rp1.000 per hari. Diakui Rege, hingga kini Padang serta warga yang tidak memilikirumah.Belumdiketahui, Ganja Ditangkap kan sebagai pemenang dan berhak mendapatkan kursi di lampu, seng pagar bangunan dan aku Rege, sedang dimintakan Sewa Rusunawa, bangunan ter- banyak kalangan yang tertarik berapa banyak warga prioritas TG. BERINGIN(Waspada): DPRD Binjai. kranair,raibakibataksipencurian. persetujuannya ke DPRD. Na- diri dari 198 pintu itu, disewakan dengan Rusunawa itu. Bahkan, yang mengajukan diri menda- Empat pengguna ganja kering Gerindra kini telah melayangkan banding atas putusan Nilainya, bisa mencapai mun, karena hingga kini dewan bervariasi. Untuk lantai I sebagai banyakdiantaraaparatdilegislatif, patkan hunian itu. (a08) ditangkap Satnarkoba Polres Mahkamah Konstitusi (MK) dan meminta agar MK melakukan Sergaidisalahsatulokasilapangan Peninjauan Kembali (PK) atas laporan berita acara pelaksanaan dan perolehan suara di Kec. Binjai Utara. Sementara itu Ketua Panwas Kota Binjai Fadillah Hutri, Ratusan Warga Demo Ke DPRD Langkat olahraga Dusun I, Desa Pekan Tg. Beringin, Kab. Serdang Be- SH ketika dikonfirmasi wartawan baru-baru ini seputar kasus STABAT (Waspada): Ratusan Samapta Poldasu Kombes Joko Menanggapi hal itu Kapolres pukul 15:30, ratusan warga masih pengolahan kayu yang bernaung dagai, Kamis (19/11) sekira pukul antara Partai Gerindra dan PPP ia mengatakan kasus ini , masyarakat Langkat Hulu meli- Purbo Susanto dan Dir Intel Pol- Langkat AKBP Mardiyono me- bertahan di depan pagar gedung di usaha pengolahan kayu milik 13:00. sudah basi, ucapnya.(a04) puti Kec. Bahorok, Salapian, Ku- dasu sempat meninjau gedung ngatakan, penahanan Setiabudi DPRD dan memblokir pintu rakyat.Namundalamprekteknya Keempat tersangka yang tambaru dan Kec. Kuala berun- DPRD Langkat sebelum aksi oleh Poldasu diduga terkait il- utama keluar. Polisi tetap berjaga belum dapat dipastikan apakah ditangkap berinisial MY alias US, jukrasa ke gedung DPRD Lang- unjukrasa dimulai. legal logging dan tidak mungkin untuk mengantisipasi adanya keseluruhan kayu yang diolah 21,MAaliasAfiq,20,AD,17,ketiga- Pencuri Besi Pertamina Dibekuk kat, Kamis (19/11). Ratusan warga tidak diper- ditahan tanpa dasar dan bukti. tindakan anarkis. Banyak pihak murnimilikrakyat,ataujeniskayu nya penduduk Dusun I Keramat Mereka meminta rekomen- bolehkan masuk ke gedung de- Selain itu saya tidak menangani menduga unjukrasa tersebut yang dilindungi negara. Asam, Desa Pekan, Kec. Tanjung PANGKALANSUSU(Waspada):PolsekPangkalansusu,Selasa dasi DPRD dan Kapolres Langkat wan untuk mengantisipasi hal- masalah karena penangkapan dikoordinir oknum-oknum pe- (17/11) sekira pukul 18:30 menangkap seorang pria berinisial, Dalam penggrebekan Beringin, dan JG alias Jansen, 19, agar salah seorang warga Boho- hal yang tidak diinginkan. Mereka dan perkara wewenang Poldasu. milik kepentingan dalam praktek kemarin diperkirakan ada 100 ton warga Dusun 11 Desa Firdaus, Sy, 35, warga Jalan Ronggowarsito, Kel. Bukit Jengkol, Kec. rok yang terduga pelaku dugaan hanya berorasi di luar pintu ger- Jadi perwakilan warga yang me- dugaan penebangan liar sejak Pangkalansusu, karena diduga melakukan pencurian besi pipa kayu, tetapi sebagian besar ba- Kec. Sei Rampah, Kab. Serdang illegal logging ditangkap Poldasu bang sambil membawa poster. rasa tidak terima dengan penang- beberapa tahun terakhir. Bedagai. milik perusahaan migas PT Pertamina EP Field Pangkalansusu. rang bukti masih berada di sana lima hari silam, dibebaskan. Sementara lima perwakilan di- kapandapatmenempuhjalurhu- Dari tersangka polisi berhasil Dari tersangka petugas menyita barang bukti, yakni satu Kedatangan pengunjukrasa perbolehkanmasukdanberdialog kumataumenyampaikanaspirasi 100 Ton Kayu Diamankan karena Polres Langkat hanya unit sepeda motor Shamo BK 6169 XL dan 6 batang besi pipa membantu pengawalan tim Pol- mengamankan barang bukti ke gedung dewan yang menggu- dengan anggota dewan juga apa- langsung ke Poldasu, harap Sementara itu aparat Poldasu ukuran 4 inci dengan panjang 80 cm. Kepada penyidik tersangka nakan puluhan truk mendapat ratur Pemkab Langkat. Kapolres. dibantu personil Polres Langkat dasu, ujar Kapolres Langkat se- berupa satu puntung rokok, dua berkilah, besi pipa dibeli dari seseorang, namun siapa orang kawalan ketat tidak hanya dari Menurut perwakilan peng- Mendengar sambutan itu menyita 100 ton kayu hutan di saat sebelum unjukrasa dimulai. paket kecil daun ganja kering. yang dimaksud, Sy, tidak dapat menjelaskan identitasnya. jajaran kepolisian Resor Langkat, unjukrasa, Darwin, tidak jelas perwakilan massa merasa kurang sebuah tempat pengolahan kayu Hinggakiniditambahkannya, Keempat tersangka lalu diboyong Kapolsek AKP Amir Muslim dikonfirmasi Waspada, Kamis melainkan dari Poldasu, Polresta dasar penahanan Setiabudi PA puas dan mengkordinir ratusan di Dusun Sapu Padang, Kec. puluhan aparat gabungan Polda/ keMapolresSergaiuntukdimintai (19/11) mengatakan, pengakuan tersangka yang mengatakan Binjai dan dua kompi Sat Brimob di kawasan Lapangan Merdeka warga untuk tetap bertahan di Bahorok, Rabu (18/11). Polres masih berada di sana keterangan. pipa tersebut dibeli dari seseorang tidak dapat dipercaya Binjai. Binjai lima hari silam oleh aparat gedung dewan hingga Setiabudi Informasi yang diperoleh, untuk penyelidikan mendalam Kabag Binia Mitra Polres begitu saja. Karena itu, katanya, tersangka tidak hanya dijerat Pengamanan sangat ketat itu Poldasu. Jika seandainya terkait dibebaskan.Merekamengancam penyitaan itu merupakan pe- dan mengosongkan jalur masuk Sergai AKP Syamsul Bahri Lubis, pasal 480 KUHP sebagai pertolongan jahat (penadah), tapi didasarilaporanpenggerakmassa usaha pengolahan kayu di Boho- akan berdiam di sana berhari- ngembangan pasca penahanan ke Dusun Sapo Padang Bohorok STsaatdikonfirmasimelaluiKasat yang bersangkutan dilapis pasal 363 KUHP tentang tindak yang mengatakan akan menu- rok, ada izinnya dari Dinas hari. Setiabudi.Polisimendugaadanya terkait penyitaan 100 ton kayu. Narkoba Iptu Irsol, Kamis (19/ pencurian dengan pemberatan. (a02) runkan ribuan warga, bahkan Dir Kehutanan Sumut. Pantauan Waspada hingga aksi penebangan liar hingga (a38) 11) membenarkan.(a07) 15. 18 Sumatera Utara WASPADA Jumat 20 November 2009 Proyek Asal Jadi, Kadis PU Tanjungbalai Terkesan Buang Badan TANJUNGBALAI (Waspada) : Kepala Dinas Pekerjaan Umum Polisi Amankan Warga Asing Di T. Tinggi Kota Tanjungbalai, Abdul Aziz, terkesan buang badan saat T. TINGGI (Waspada): luarsa atau over stay selama dikonfirmasi tentang pekerjaan proyek pembangunan yang diduga empat puluh lima hari, akan asal jadi. Belum tahu saya, nantilah saya suruh PPTK mencek Seorang warga negara asing tetapi dari hasil pemeriksaan proyek itu ke lapangan, kata Aziz kepada Waspada, Selasa (17/ (WNA) diamankan petugas warga asing ini mengaku dibawa 11). Polresta Tebingtinggi dari EL anak BS ke Kota Tebingtinggi Proyek pembangunan yang diduga asal jadi itu, yakni satu tempat di kawasan guna memperkenalkannya ke- pemeliharaan lapis permukaan dengan konstruksi hotmix serta pada keluarganya, bahwa me- pelebaran jalan di Jalan Mesjid, Kec Tanjungbalai Selatan. Jalan Gatot Subroto, Kel. reka sudah menikah di Malaysia Proyek itu diduga asal jadi karena ketebalan hotmix sangat Pabatu, Kec. Padang Hulu, sembilan bulan lalu. Bahkan diragukan sesuai bestek yang ditentukan. Selain itu, proyek senilai Tebingtinggi berikut pemilik saat ini EL tengah mengandung Rp 802 juta itu, aspal hotmix di badan jalannya, banyak yang 6 bulan. rumah, Rabu (18/11) malam terkelupas, lubang pori-porinya cukup besar. Hal ini terjadi diduga Usai menjalani pemeriksa- akibat minimnya volume hotmix untuk melapisi badan jalan. sekira pukul 19:00. an petugas Samran menurut Demikian juga dengan dasar atau pondasinya yang tidak kuat, rencananya akan diserahkan ke sehingga mudah retak. Selain itu, aspal hotmix di badan jalan Kantor Imigrasi Pematangsian- tidak rata alias bergelombang sehingga ketika dilintasi akan WNA asal negara Malaysia tar guna proses lebih lanjut. Se- menimbulkan ketidaknyamanan pengguna jalan. (a37) itu diamankan petugas karena mentara BS hingga kini masih Visa kunjungan yang diguna- dalam pemeriksaan petugas. BS kannya sudah habis masa Pelarangan Tigor P Siregar berlakunya. diduga telah melanggar pasal 60 UU RI No 9 tahun 1992 ten- Kapolresta Tebingtinggi Bertugas Tidak Terkait Politik AKBP Robet Haryanto W ketika tang keimigrasian di mana se- tiap orang yang memberi ke- dikonfirmasi saat itu membe- sempatan menginap kepada RANTAUPRAPAT(Waspada):DilarangnyadrHTigorPanusunan narkan pihaknya mengamankan orang lain dengan tidak mela- Siregar SpPD bertugas di Rumah Sakit Umum (RSU) Rantauprapat tidak terkait dengan politik, melainkan karena tidak memenuhi seorangWNA bernama Samran porkannya dikenakan saksi hu- harapan pimpinan RSU dimaksud. bin Amri warga asal Kampung kuman setahun penjara. Direktur RSU Rantauprapat dr H Rusman Lubis, SpB menyam- Karamunting, Jalan Batu Sapi Sementara itu berdasarkan paikan itu, Senin (16/11) dalam temu pers di ruang pertemuan Borneo Malaysia. Berikut se- catatan di kepolisian sejak awal RSU setempat. orang pemilik rumah BS karena tahun 20009 ini sudah dua kali Direktur RSU R.Prapat itu menjelaskan, dr Tigor yang sebelum- memberikan tumpangan tanpa warga asing diamankan petugas, nya menjabat Kepala Badan Pengelola RSU R.Prapat sesuai dengan memberitahukan kepada pertama terjadi sekira Mei lalu, PP No. 41/2007 diangkat menjadi Staf Ahli Bidang Kesehatan petugas. tujuh warga WNA asal negara Pemkab L.Batu. Dengan demikian dia tidak lagi sebagai kepala Diamankannya Samran se- Zimbawe ditangkap di Hotel Waspada/Agusdiansyah Hasibuan rumah sakit tersebut. butnya, karena Visa kunjungan Buluh Pagar karena tidak mem- JALAN TAK LAYAK: Ruas Jalan Perupuk - Gambus Laut, Kec.Limapuluh,Kab.Batubara, yang merupakan lokasi perkantoran Kemudian pimpinan RSU R.Prapat dijabat dr Rusman Lubis, yang dimilikinya sudah kada- punyai dokumen.(a09) Pemkab yang kontroversi di masyarakat Batubara kerap direndam air saat musim hujan. Lokasi perkantoran di Desa SpB dengan nama jabatan Direktur RSU R.Prapat. Selanjutnya Prupuk ini kerap mendapat sorotan warga, khususnya Limapuluh yang menilai penetapannya tidak sesuai dengan harapan. dr Tigor secara lisan menanyakan kepada Rusman Lubis apakah dirinya diperbolehkan berpraktik di RSU. Selundupkan SS 1,011 Kg, Foto direkam, Kamis (19/11) Oleh Rusman Lubis, permintaan itu disetujui pula secara lisan dan jadwal praktek Tigor pada hari Rabu dan Sabtu , sedangkan empat hari lainnya ditangani oleh dr Chairil Anwar Situmorang Penumpang Ditangkap Kekondusifan Daerah Tidak dan dr Pinem. Namun, setelah delapan bulan berlangsung, jadwal TANJUNGBALAI (Waspa- mencurigakan dari barang- praktek itu tidak dapat dipenuhi dr Tigor, sehingga dia tidak diperkenankan lagi bertugas di RSU. Beliau hanya masuk pada hari rabu saja. Hari Sabtu dr Tigor da) : Lagi, petugas Bea Cukai Pelabuhan Teluk Nibung Kota barang yang dibawa tersangka, kata Saragih. Terlepas Peran Ulama Dan Umaro Tanjungbalai menggagalkan Dan, pemeriksaan lebih masuk-masuk. Hari Rabu saja pun kadang-kadang beliau tidak penyelundupan narkoba jenis lanjut, kata Saragih, ternyata PERBAUNGAN (Waspada): denganbaik,niscayasuasanaakan Musda II MUI Kab. Serdang Be- tokoh agama, tokoh masyarakat bertugas. Tentu saja ini tidak memenuhi harapan saya. Ini saya shabu-shabu seberat 1,011 kilo- kecurigaan petugas terbukti Sebagai kabupaten baru kita aman dan tentram tanpa mem- dagai yang diselenggarakan sela- serta undangan lainnya. jelaskan agar semua menjadi jelas bagi rekan-rekan wartawan, gram dengan nilai diperkirakan dengan ditemukannya lima benar benar bersyukur karena bedakan warna kulit dan etnis ma sehari di Wisma Amerta Dikatakan bupati, atas papar Rusman Lubis. (a27/c01) miliaran rupiah, Rabu (18/11) bungkusan berisi serbuk kristal sudah 4 tahun 8 bulan saya dan semuanya saling menghormati Adolina, Kec. Perbaungan, Rabu nama pemerintah Kab. Serdang sekira pukul 19:00. yang dicurigai narkoba jenis pak Soekirman memimpin Ser- dan menghargai. Untuk itu diha- (18/11) pagi. Bedagai pihaknya sangat me- dang Bedagai,namun suasana- rapkan peran ulama dapat mem- Turut hadir Dandim 0204/ nyambut baik dengan terlaksa- Tim Penyelenggara CPNSD Shabu-shabu itu berasal dari Malaysia, dan pelakunya se- sabu-sabu disimpan di dalam termos air milik tersangka. nya didaerah ini tetap kondusif. berikan kesejukan kepada warga DS, Kapolres Sergai AKBP Drs nanya Musda II MUI Kab. Kekondusifan itu terjadi tidak Kab. Serdang Bedagai, bersikap Eri Safari, Kakandepag Sergai Serdang Bedagai sekaligus juga Labusel Bagikan Tanda Peserta orang wanita berinisial Su Binti Yus, 35, warga Desa Batee Iliek, Penemuan itu kemudian kita tindaklanjuti dengan membawa terlepas adanya peran serta independen, tanpa memihak M. Asbi, Ketua MUI Sumut Prof. mengucapkan terimakasih baik Kecamatan Samalanga, Kabu- tersangka dan barang bukti ke ulama untuk memberikan kese- kepada suatu golongan tertentu. Dr H Abdullahsyah, MA, Kapol- kepada seluruh peserta dengan KOTAPINANG (Waspada): Tim Penyelenggara Penerimaan jukkan kepada masyarakat. Demikian Bupati Serdang sek Perbaungan AKP Syahrial harapan seluruh tahapan dalam CPNSD Kabupaten Labuhanbatu Selatan (Labusel) Tahun 2009 paten Bireuen. Modus yang di- kantor untuk pemeriksaan lebih gunakannya dengan cara di- lanjut dengan pengujian Nar- Bila ulama, umaro dan pe- Bedagai HT Erry Nuradi dalam SH, para camat, Ka KUA, para pelaksanaan Musda dapat diikuti bagikan Tanda Peserta Seleksi CPNSD kepada semua pelamar merintah dapat bekerjasama pidatonya pada pembukaan Kepala Dinas Pemkab Sergai dengan tertib. (a07) di Kab Labusel. sembunyikan di dalam termos kotest, dan hasilnya, serbuk kris- Demikian Tomi Harahap Kamis (19/11) Kabag Kepegawaian air. tal yang dibawa tersangka me- Pemkab Labusel. Menurut Tomi, tanda peserta seleksi untuk kelompok tenaga kesehatan diberikan Rabu (18/11) di Puskesmas, Kepala Kantor Bea Cukai Pelabuhan Teluk Nibung Eko rupakan shabu-shabu seberat 1,011 kilogram, kata Saragih. Tersangka Su Binti Yus, Stok Obat Di Puskesmas Dan Pustu Binjai Kurang untuk tenaga teknis diberikan Kamis (19/11) di depan Kantor Darmanto melalui Kasi P2 BINJAI (Waspada): Kepala dan Puskesmas pembantu dise- obat-obatan dari Dinas Kese- risiko yang bisa melanggar ke- Tuahman Saragih menjelaskan, mengatakan kepada Waspada, Bupati Labusel dan untuk tenaga pendidikan pada Jumat (20/ dia tidak mengetahui barang Dinas Kesehatan Binjai HT babkan Dinas Kesehatan Binjai hatan Provsu. Bantuan Diskes tentuan, tegas Fuad. 11) di halaman SMAN-1 Jl.Bedagai Kotapinang. sabu-sabu kristal bening itu Murat El Fuad mengakui obat pada 2009 tidak ada melakukan Sumut menurut Fuad, diterima ditemukan saat petugas, salah haram itu disimpan di dalam Walau sedikit mempeng- MenurutTomi, jumlah pelamar 6.351 orang, terdiri dariTenaga termos air. Dan, dia juga berdalih di Puskesmas dan Pustu berku- pembelian obat. sudah tiga kali. aruhi pelayanan kesehatan di Teknis 3.720, Tenaga pendidikan (guru) 1.489 orang dan untuk satunya salah satunya anggota seluruh barang bawaannya ter- rang. Begitupun pelayanan ke- Dikatakan Murad, Dinas Kadis Kesehatan Binjai CNT Bea Cukai Teluk Nibung Puskesmas dan Puskesmas Tenaga Kesehatan 1.142 orang, sedangkan jumlah alokasi yang sebut, termasuk termos air ber- sehatan masyarakat di Puskes- Kesehatan hanya mengan- menjelaskan, tidak dilakukan diterima 524 orang, berarti bakal tersingkir 5.827 orang. Sedangkan Hery Supomo, memeriksa ba- isi shabu-shabu, milik rekannya mas dan Puskesmas pembantu dalkan bantuan obat dari dana pembelian obat dengan berba- pembantu, masih dapat diatasi jadwal seleksi seluruhnya diadakan 25 Nov 2009. rang bawaan penumpang yang sesama TKI di Malaysia berinisial tidak berkurang . Bantuan Daerah Bawahan gai alasan. Terutama proses ten- dengan adanya dana bantuan Tomi mengatakan tempat lokasi di gedung sekolah yang ada baru tiba di Pelabuhan Teluk Nur. Dr HT Murad El Fuad men- (BDB) dari provinsi Sumatera der dan harga obat harus stan- daerah bawahan dan obat- di Kotapinang, namun daya tampung hanya berkisar 4.700 orang, Nibung dari Port Klang, Malaysia. Wanita pemilik nomor pas- jelaskan, Kamis (19/11), ber- Utara Rp260 juta yang masih dar dengan harga ditentukan obatan dari Dinas Kesehatan sisanya di sekolah yang ada di Kecamatan terdekat yakni Desa Ketika petugas melakukan por T 504798 itu, menjalani pe- kurangnya obat di Puskesmas diproses. Kemudian bantuan Depkes. Saya tidak mau ambil Provsu. (a03) Asamjawa, Kecamatan Torgamba. (c05) pemeriksaan rutin melalui alat meriksaan intensif di kantor Bea Pelamar CPNS Tinggi Di Batubara sensor X-ray, ditemukan benda Cukai Teluk Nibung. (a37) Massa KAMPUS Kembali LIMAPULUH(Waspada):Tingginya angka pelamar CPNS Palsukan Surat Tanah, Kades Datangi Kantor DPPKA Asahan mencapai puluhan ribu di Kabupaten Batubara perlu menjaga kondisi agar tetap nyaman dan kondusif. Alang Bon-bon Asahan Diadili KISARAN (Waspada) : Pulu- Kami meminta seluruh peserta baik berasal dari luar dan han mahasiswa tergabung dalam TANJUNGBALAI (Waspada): Umum itu, Penasehat Hukum dalam daerah untuk tetap menciptakan suasana kondusiif yang Kesatuan Aksi Mahasiswa Peduli Kepala Desa Alang Bon-bon, terdakwa menyatakan meminta selama ini telah terbina dan terpelihara secara baik, sebut Ketua Idealis (KAMPUS) Asahan, Kamis Kecamatan Aek Kuasan, Kabu- waktu selama satu minggu untuk dan Sekretaris Konsersium LSM Kab Batubara Ahmad Yani, SH (19/11) kembali mendatangi kan- paten Asahan, OPS alias Ojak, memberikan tanggapan. Akan dan Muhammad Sukri Shi dalam pernyataan sikapnya diterima tor Dinas Pendapatan Pengelo- diadili di Pengadilan Negeri Kota tetapi,MajelisHakimmenolaknya Waspada, Kamis (19/11). laan Kekayaan dan Aset (PPKA), Selainitutidakmelakukanprovokasiterhadappanitiapenerimaan Tanjungbalai dengan dakwaan dan hanya memberikan waktu membuat dan menggunakan hingga 24 Nopember 2009. Oleh terkait pencairan dana proyek CPNS yang akhirnya berdampak terhadap kinerja yang sebesar Rp. 5,8 miliar lebih. dilakukan.Begitu pula halnya bagi anak daerah untuk tidak patah surat tanah palsu untuk mengua- sebab itu, Majelis Hakim kemu- sai lahan orang lain, Kamis (19/ dian menunda sidang dan Dalam orasinya, Korlap semangat dalam mengikuti seleksi dan dinyakini hasilnya nanti Massa KAMPUS Asahan M. Isa tidak pesanan dari siapapun. (a11) 11) sore. melanjutkannya kembali Selasa Sidang perdana yang dipim- (24/11) untuk mendengarkan Anshori mendesak Kajari Kisaran pin Ketua Majelis Hakim Asad eksepsi atau tanggapan terdakwa segeramemanggildanmemeriksa Mahasiswa STAI Bahriyatul Rahim Lubis dibantu Hakim atas dakwaan JPU. Kadis PPKA Asahan karena terindikasi melakukan tindak Anggota Egi Novita dan Oloan Sebelumnya, Kepala Desa Ulum Pandan Demo E Hutabarat dengan Jaksa Pe- Alang Bon-bon itu, ditahan oleh pidana korupsi dalam pencairan anggaran 4 paket proyek di Dinas nuntut Umum Rudi Parhusip, pihak Kejaksaan Negeri Kota PANDAN (Waspada) :Puluhan mahasiswa STAI (SekolahTinggi beragendakan pembacaan Tanjungbalai pada 22 Oktober PU Asahan itu. Waspada/Nurkarim Nehe Agama Islam) Bahriyatul Ulum Pandan menggelar aksi damai dakwaanterhadap OPSaliasOjak, 2009, dan dititipkan di LP Pulo Berdasarkanhasilinvestigasi ORASI : Puluhan massa KAMPUS melakukan aksi unjuk rasa sambil berorasi di depan gerbang ke Pemkab Tapteng Kamis (19/11) sekira pukul 15:00. warga Desa Alang Bon-bon, Simardan. Kasus itu kemudian danbukti-bukti,kamimensinyalir kantor Dinas PPKA Asahan, terkait dugaan korupsi pencairan dana 4 paket proyek TA 2008 Aksi menuntut pihak yayasan lengser yang dinilai mahasiswa 4 paket proyek perencanaan di Dinas PU Asahan, foto direkam Kamis (19/11). Kecamatan Aek Kuasan. dilimpahkanke PengadilanNegeri paling bertanggung jawab terhadap kelangsungan perkuliahan teknis TA 2008 itu fiktif, karena Dalam dakwaannya, JPU Kota Tanjungbalai. tidak ada dalam pengumuman wardy dan Kadis PU Asahan Ir SH di Aula kantor Kajari Kisaran. kan investigasi dan penyelidikan serta status dan akreditasi kampus mereka. Karena mereka tak menjelaskan, atas perbuatannya Dan, informasi dihimpun SyafaruddinNasution,selanjutnya Dalam pertemuan itu, Mus- atas kasus dugaan tindak pidana ingin nantinya setelah lulus, ijazahnya tak diakui saat melamar tender lelang pada 2 Juni 2008, membuat dan menggunakan Waspada, pemalsuan surat ungkap Anshori. mendesak BPK, Kajari, Kapolres tapa menyebutkan, Kajari Kisa- korupsi di PPKA Asahan. Jadi, pekerjaan. Aksi itu mendapat perhatian dari warga yang dilewati surat tanah palsu untuk mengua- keterangan tanah itu terbongkar dan Inspektorat Asahan mema- ran telah menyurati BPK dan me- mari sama-sama kita tunggu, dan tetap mendapat pengawalan dari para petugas PolresTapteng. Uniknya, lanjut Anshori, da- sai lahan seluas 3 hektar milik berawal ketika OPS alias Ojak lam proyeksi APBD TA 2008 dan nggil dan melakukan pemeriksa- minta tim melakukan audit ke ungkap Mustapa. 7 Perwakilan bertemu dengan Wakil Bupati Tapteng Ir HMA Hj Rumiyem, 45, warga Link III, menjalani sidang di Pengadilan anterhadapkeduanya,tukasnya. PPKA Asahan terkait kasus Setelah mendengar penjela- Efendi Pohan didampingi Kepala Kantor Departemen Agama LKPJ Bupati Asahan, dana ang- Desa Aek Loba Pekan, Kec Aek NegeriTanjungbalai dalam kasus garan 4 paket proyek diduga fiktif Usai menyampaikan orasi- dugaan korupsi pencairan dana san Kasi Pidsus Kajari Kisaran itu, Tapteng Drs Dur Brutu , Kadis Pendidikan Drs M Rumapea dan Kuasan, Asahan, terdakwa me- penggarapan tanah tanpa izin nya, massa beranjak ke Kantor anggaran4paketproyekperenca- massa KAMPUS Asahan akhir- telah dicairkan oleh Drs Suwardi sejumlah Pejabat Pemkab lainnya dengan jubir pada pertemuan langgar pasal 263 ayat 1 subsidair milik Hj Rumiyem, 45, warga Link selaku Kadis PPKA Asahan. Kajari Kisaran dan kembali me- naan teknis TA 2008. nya membubarkan diri dengan itu Rosmatua Syahputra Pasaribu yang juga Ketua Senat Mahasiswa. pasal 263 ayat 2 tentang pemal- III, Desa Aek Loba Pekan, Kec Atas dugaan itu, kami me- nggelar aksi demo. Delegasi Kami telah menyurati dan tertib di bawah pengawalan ketat Wakil Bupati Tapteng Ir H MA Efendi Pohan menghargai suan surat keterangan tanah. Aek Kuasan, Asahan pada 2008 minta Bupati Asahan segera Massa KAMPUS akhirnya diteri- masih menunggu kedatangan petugas kepolisian dari Polres adanya aksi dan penyampaian aspirasi dari para mahasiswa AtasdakwaanJaksaPenuntut lalu. (a37) mencopot Kadis PPKA Drs Su- ma Kasi Pidsus Mustapa Kamal, tim audit dari BPK untuk melaku- Asahan. (a10) Wakil Bupati Tapteng menyatakan, aspirasi dari mahasiwa tersebut, tak bisa direalisasikan sesuai tenggat waktu tuntutan dari para mahasiswa itu seraya menyebutkan akan memanggil pihak terkait membicarakan hal itu. Secara terpisah KetuaYayasan Daud Batubara saat dikonfirmasi MA Kuatkan Kemenangan Supriyanto didampingi Ketua STAI BU Jabaluddin Harahap mengatakan, MEDAN (Waspada): DR Dagang Kerawan, Kecamatan ngan nomor:1242/Pid.B/2006/ Ini suatu kepastian keputu- Syukuran Bersama STAI Bahriyatul Ulum telah terakreditasi dengan Nilai C oleh Badan Supriyanto yang dikenal sebagai Tanjungmorawa seluas 78,16 ha PN-LP pada 29 Maret 2009. san hukum yang kuat dan Masyarakat Akreditasi Nasional (BAN) Perguruan Tinggi dengan Keputusan tokoh masyarakat di Tanjung- yang sebagian besar sudah Kemudian Mahkamah membuktikan apa yang dilaku- Ratusan elemen masyara- BAN no.15/BAN-PT/Ak-XII/N/2009. (a34) morawa dan pemuda pelopor diratakan. Agung menguatkan putusan kan pimpinan YPNA benar kat dari berbagai kalangan, nasional mengucapkan syukur Kepada semua pihak mulai vonis bebas tersebut pada 30 sesuai dan tidak bertentangan seperti para pemuka masyara- Guru Asahan Lomba Model atas keluarnya putusan Mahka- mah Agung yang memenang- dari masyarakat, kepala desa, camat, bupati, BPN, DPRD Desember 2008 dengan no- mor:800 K/Pidsus/2007 yang dengan hukum, sehingga semua pihak harus mematuhi putusan kat/agama, anggota dewan dan anak yatim-piatu tampak mela- Dan Penulisan Artikel kannya dalam perkara. Dia menggelar syukuran bersama Deliserdang hingga gubernur dan instansi lainnya harus diterima oleh DR Supriyanto 6 November 2009. MA tersebut, tegas Jumono, SH. kukan upah-upah sambil membawakan Shalawat KISARAN (Waspada) : Sedikitnya 70 tenaga pendidik di masyarakat setempat di ke- mendukung rencana pemba- Keputusan penetapan hu- Menyinggung langkah- Badhar sebagai ungkapan rasa Kabupaten Asahan, mengikuti perlombaan guru model dan diamannya. ngunan perluasan KotaTanjung- kuman bebas murni terhadap langkah yang akan ditempuh syukur atas dibebaskannya penulisan artikel di SMP Negeri 9, Kamis (19/11). Mahkamah Agung (MA) morawa sebagai Kota Satelit DR Supriyanto itu sangat tepat berikutnya, karena Supriyanto Supriyanto dari kasus hukum. Perlombaan guru model dan penulisan artikel itu, dilaksanakan menguatkan putusan Penga- yang sudah mendesak di- dan adil, karena pembeli yang sebelumnya pernah ditahan Suasana haru dan gembira oleh Musyawarah Kerja Kepala Sekolah (MKKS) SMP Negeri dan dilan Negeri (PN) Lubuk Pakam, kembangkan. beritikat baik dan mengikuti pihak kepolisian dan kejaksaan. terlihat dari wajah Supriyanto, Swasta se Kabupaten Asahan. Untuk perlombaan guru model, Kabupaten Deliserdang dengan Termasuk kepada semua aturan wajib dilindungi undang- Pengacara senior di Medan ini para keluarga dan masyarakat pesertanya berjumlah 30 guru, dan 40 lagi mengikuti perlombaan menetapkan putusan bebas ter- pihak yang menempati lahan undang, tegas Jumono, SH nampaknya cukup bijaksana setempat yang menghadiri penulisan artikel. hadap DR HM Supriyanto seba- itu dan tidak memiliki hak, harus yang didampingi stafnya dan yang penting proyek pe- sukuran di rumah bertingkat Seorang peserta, Amriza, guru SMP Negeri III Simpang Kawat gai pengembang dalam ganti- mengosongkan lahan yang ber- Ilhamsyah, SH. ngembangan Kota Tanjungmo- empat milik pimpinan YPNA tampak santai menyampaikan materi Bahasa Inggris kepada para rugi eks lahan PTPN II Tanjung- kliennya dimenangkan dalam dasarkan hukum secara sah di- YPNA akan membangun rawa terlaksana. yang terletak arah Desa Bangun siswa model dari SMP Negeri 6. Berperan sebagai guru model, morawa seluas 78,16 hektare. putusan MA atas kasasi dari kuasaiYPNA, yang telah melaku- dan mengembangkan Kota Sebagai kuasa hukum, Rejo. Beberapa tokoh pemuda, Amriza sesekali memberikan pertanyaan dengan intonasi dan Kuasa hukum DR Supri- pihak Kejaksaan Negeri (Kejari) kan ganti-rugi lahan sesuai Tanjung Morawa, lanjut Jumo- mereka akan melihat situasi dan agama dan pemuka masyarakat gaya bahasa Inggris fasih. Dan, dengan tangkas pula, beberapa yanto, Jumono, SH (foto) ketika Lubuk Pakam. prosedur hukum. no guna membantu program kondisi sesuai perkembangan, setempat, mengharapkan siswa menanggapinya dengan vokal Bahasa Inggris yang tak jauh di-konfirmasi, Selasa (17/11) Dengan putusan MA terse- Pengadilan Negeri Lubuk pemerintah seperti membuka karena putusan bebas dari MA Pemerintah Kabupaten, DPRD beda dengan sang guru. tentang turunnya putusan MA but, maka menurut Jumono, Pakam, dalam kasus pidana lapangan pekerjaan baru, mem- membuktikan apa yang dilaku- dan instansi terkait di Deliser- Ketua MKKS SMP Negeri dan Swasta Se Kabupaten Asahan, terhadap kliennya yang juga pihak YPNA berhak dan sah se- dugaan korupsi memvonis be- bangun berbagai fasilitas umum kan pimpinan YPNA terhadap dang harus mendukung upaya Mukhlis, S.Pd mengatakan, perlombaan itu merupakan program Pimpinan Yayasan Pendidikan cara hukum menguasai kepe- bas DR Supriyanto bersama dan pusat perbelanjaan sesuai lahan tersebut tidak melanggar DR Supriyanto untuk mem- kerja rutin guna memotivasi guru SMP meningkatkan kompetensi Nurul Amaliyah (YPNA) Tan- milikan lahan eks PTPN II Masdin Sipayung, Sukardi dan dengan Rencana Umum Tata hukum atau merugikan negara bangun perluasan Kota Tan- sebagai guru professional. (a37/a36) jung Morawa itu, membenarkan perkebunan kelapa sawit di Desa Indro Suhito dari PTPN II de- Ruang Kota (RUTRK). daniniperludiketahuimasyarakat. jungmorawa. (m03) 16. WASPADA Jumat 20 November 2009 Sumatera Utara 19 Penerimaan CPNS Di Madina Jangan Jadi Ajang KKN PANYABUNGAN (Waspada): Proses penerimaan/pengadaan SD Penerima DAK Di Batang Angkola Rawan Bencana CPNSD 2009 di Madina harus dapat berjalan dengan baik, adil dan transparan tanpa dikotori praktek-praktek KKN (korupsi, kolusi dan nepotisme). Demikiansalahsatupointdaripadapernyataansikapdaripuluhan mahasiswa tergabung dalam Pegerakan Mahasiswa Islam ( PMII) Madina yang mereka sampaikan secara damai ke gedung DPRD Kab. Mandailing Natal, Rabu (18/11). BATANG ANGKOLA bagian dalamnya telah ditimbun Rp 345 juta, dan SD 101120 Huta Mereka mendatangi gedung dewan sekaitan dengan adanya (Waspada): Sejumlah SD tanah, masih sangat rendah Tonga Rp 367 juta. beredar isu pelaksanaan penerimaan/penyaringan CPNSD 2009 dibanding badan jalan yang ada Meskipun sebagian sekolah Negeri penerima bantuan di depan halaman. adayangmembuatbesinyasesuai di lingkungan Pemkab Madina, harus bayar puluhan juta rupiah. Aksi damai ini kami lakukan guna menggugah para hati anggota pembangunan dari Dana Ruang kelas yang sedang dengan di RAB, namun banyak DPRD Madina, dan hal ini juga merupakan salah satu agenda penting Alokasi Khusus (DAK) bidang dibangun itu dikhawatirkan akan jugasekolahyangkualitasbesinya reformasi yang disuarakan mahasiswa tahun 1998 yang silam yakni menjadi langganan banjir, karena sangat lunak.Sehinggaditakutkan Pendidikan tahun 2009 di penyelenggaraan negara yang besih dari segala bentuk praktik korupsi, jika hujan deras, air dari pemuki- tidak mampu menahan beban Kecamatan Batang Angkola, man warga dan badan jalan akan atap rangka baja, dan cor plang kolusi dan nepotisme, ujar Ahmad Rijal Lubis, Ketua Umum PMII Madina kepada wartawan di gedung dewan setempat. (cpin/a24) Kab.Tapanuli Selatan, rawan mengalirmenujubangunanyang atas. banjir, rubuh, dan tak selesai posisi tanahanya lebih rendah SDN 101040 Pangaribuan itu. sangat rawan rubuh, karena kete- 4 Tersangka Kasus Narkoba sampai tenggat waktu yang ditetapkan. Sementara di SDN 101160 rikatakan plafon dengan rangka Muara dengan jumlah dana Rp atap sangat minim. Sekolah itu Diringkus Polres Dairi DemikianmonitoringKomisi 253 juta,tukangnyaterkesaningin sudah selesai hamper 80 persen mencuriketinggianlantai.Karena meskipun pencairan dana baru SIDIKALANG (Waspada): 4 tersangka kasus penyalahgunaan III DPRDTapsel ke 21 SD peneri- di rencana anggaran biaya (RAB), 35 peren. Karena bangunannya narkoba ditangkap Polres Dairi, Senin (16/11) malam di dua lokasi ma DAK di Batang Angkola, ketinggian lantai 30 centimeter, diborongkan kepada kontraktor. terpisah. Kamis (19/11). Suyatmo Siregar sedangkan yang dibuat mereka Kondisirawanrubuhitudike- Tiga orang di antaranya tertangkap basah saat memakai barang (Golkar), M Ike Taken Hasibuan hanya 10 Cm dari tanah. Padahal tahui setelah IkeTaken Hasibuan, haram tersebut di kamar nomor 5 Hotel AR Jalan Nusantara Sidikalang. (Demokrat) dan Robi Agusman halaman sekolah itu akan selalu naik tangga bangunan dan me- Mereka masing-masing LS,25, warga Jalan Pakpak, A br R,25, Harahap (PKPI) ditugaskan ke tergenang bila hujan lebat, karena meriksa bagian atas plafon dari warga JalanTapanuli dan Briptu EH ,23, warga Asrama Polisi Sumbul. sana . di pinggir sawah. celah teras. Pemborong bangu- Sedang penyedia berinsial Brigadir NP diciduk di kediamannya ,33, Disebut rawan banjir, karena PantauanWaspada,Suyatmo nanfisikyangharusnyadikerjakan di Jalan Sisingamangaraja Sidikalang. lantaisekolahyangberadadi wila- SiregardanMIkeTakenHasibuan swakelola itu, telah mencuri Demikian Kapolres Dairi AKBP Marzuki MM melalui Kepala yah langganan hujan lebat itu sangat kecewa melihat kondisi ukuran plafon/triplek.Yang digu- Satuan Narkoba Ipda Pol Jamaluddin Nasution, Rabu (18/11) petang. terlalu rendah. Dari beberapa pembangunan sekolah yang tiap nakan berketebalan 3 mm, pada- Ketika operasi digelar, ketiga tersangka ditemukan sedang sekolah yang ditinjau tim moni- hari dipantau kepala sekolahnya hal di RAB harus 4 mm. Waspada/Sukri Falah Harahap menggunakan dengan barang bukti 1 buah bong, 1 buah mancis toring, rata-rata kepala tukang itu. Banyak hasil pembangunan SDN 101160 Muara paling dan shabu-shabu seberat 0,4 gram. mencuriukurancorpondasidan PERIKSA: Anggota Komisi III DPRD Tapsel, M Ike Taken Hasibuan, memanjat tangga untuk mereka yang lari atau melenceng rawan rubuh, karena banyak Dari pengusutan itu, Kapolres membenarkan dua diantaranya tidak tahu membaca gambar melihat kondisi bagian atas plafon ruangan SDN 101040 Pangaribuan yang ditakutkan cepat dari perencanaan dan kualitas dinding bangunan lama yang adalah oknum polisi. Briptu EH bertugas di Bapolsek Sumbul perencanaan. rubuh, karena tidak terikat dengan bantalan rangka atap, Kamis (19/11). bangunan terkesan tidak kuat. retaktidakdigantidanhanyaditu- sedang Brigadir NP bekerja di Basatlantas Polres Pakpak Bharat. Saya tidak tahu, darimana Disebut rawan rubuh, karena tupi pakai semen cair. Tiang yang kontraktor. Karena tanpa pen- selesai sekitar 25 persen. Padahal belajar di ruangan yang tidak Dua tersangka lainnya adalah warga sipil. Penyidik telah melakukan parakepalatukangini mengambil konstruksi penyangga bangunan seharusnya melebar dibuat me- cairan danapun, kontraktornya sudah dikerjakan sebulan lama- layak. tes urin dan disimpulkan hasilnya positif. titik dasar 0,0 nya untuk menen- sekolah penerima DAK di Batang manjang. Cor plang atas sangat siap menggunakan dana pribadi nya dan untuk penyelesaian Saya melihat hali ini juga di- Kapolres menyatakan, tidak pandang bulu dalam penegakan tukan ketinggian pondasi lantai. Angkola banyak yang mencuri kecil dan bergelombang. Tidak sebagai modal awal. hingga 100 persen tinggal sebulan akibatkan kelalaian Dinas hukum. Walau mereka aparat, tetap ditindak sebab perbuatan itu Sehinggabegituselesaidikerjakan besi. Mulai dari ukuran besi sam- semua tiang memiliki penyangga Sedangkan sekolah lainnya lagi. Jika tidak, sisa dana akan Pendidikan Daerah yang terlalu jelas melawan hukum. Keempatnya kini dikenai status tahanan. masih terlihat rendah dan jika pai jarak cincin besi cor. Di RAB ke dinding, dan pelsteran dinding yang menurut kepala sekolahnya ditarik dan disetor ke pusat. lambat untuk memulai kegiatan Dibenarkan, selain menjalani peradilan umum, oknum anggota banjir pasti air masuk ke ruang harusnya berjarak 15 sampai 20 banyak yang kopong. dikerjakan secara swakelola dan Melihat kondisi kemajuan pembangunan di lapangan. Bila Polri masih mengikuti persidangan kodel etik. kelas, kata Ike Taken yang sebe- cm, namun di lapangan 30 sam- Seluruh SD penerima DAK hanya mengharap pencairan fisik sekarang, saya sangat kha- keraguan kita ini terjadi, berarti Ditambahkan, pengguna mendapatkan barang itu dari Brigadir lumnyamenggelutiperencanaan pai 45 cm. bidang Pendidikan di Batang dana per termen, diragukan akan watir akan banyak sekali sekolah akan banyak sekolah mirip kan- NP yang dibeli seharga Rp 200 ribu. Dalam pemeriksaan, tersangka bangunan. Seperti hakya di SDN101110 Angkola juga rawan tidak selesai selesai paling lambat pada 24 yang terbengkalai karena tidak dang kambing di Tapsel. Karena mengaku tidak biasa mengkonsumsi.(a28) Seperti SDN 101200 Muara Muara Tais III dengan dana Rp tepat waktu, kecuali SDN 101040 Desember nanti. bisa menyelesaikan bangunan pintu dan jendelanya hanya Tais II berjumlah dana Rp 253 253 juta, 10110 Tahalak Rp 345 Pangaribuan dan 100980 Sigala- Pasalnya,kondisidilapangan, secara tepat waktu. Kasihan mu- ditempeltriplekdanpapanbekas, juta. Pondasi lantai teras yang Pemilik Dan Pengedar juta, SDN 101040 Pangaribuan ngan yang diborongkan kepada masih ada sekolah yang baru rid-muridnya nanti, mereka akan kata Suyatmo. (a20) Ganja Ditangkap Pilkada Di Sibolga Habiskan Rp5,4 M P SIANTAR (Waspada): Dua pria warga Kota Pematangsiantar . ditangkap Sat Narkoba Polresta dan Sat Narkoba Polres Simalungun, SIBOLGA (Waspada): Pelak- Kota Sibolga tahun 2009 dan kita masalah anggaran untuk KPU. ngakui KPU sulit menjalankan karena diduga sebagai pemilik dan pengedar narkotika jenis daun sanaan Pilkada di Kota Sibolga berharap Pemko Sibolga bijak Menurut Syamsuarmi, tahapan kalau tidak ada dana. ganja kering. diperkirakan menghabiskan dapat menyelesaikan agar taha- jadwal tahapan ini diprediksi Dijelaskan, ada alternatif lain Kedua pria itu terdiri A, 28, pekerjaan tidak menetap, warga anggaran dari APBD Kota Sibolga pan hingga pelaksanaan Pilkada akan terjadi molor mengingat yakni seperti yang diatur dalam Jalan Singosari, Gang Sumber, Kelurahan Bantan, Kecamatan Siantar sebesar Rp5,4 miliar. di Kota Sibolga tidak terganggu, masalah anggaran, namun Permendagri No. 44 tahun 2007 Barat, Pematangsiantar dan AL, 55, alias Amri, warga Jalan Kenanga, Jadi kita sudah mengajukan, walaupun kekhawatiran apakah kembali dia berharap Pemko dimana dibenarkan Walikota Kelurahan Simarito, Kecamatan Siantar Barat, Pematangsiantar. kalau pilkada diselesaikan dalam dana awal itu bisa timbul di Sibolga bisa lebih bijaksana ber- membuat suatu peraturan untuk A ditangkap di dekat rumahnya di Jalan Singosari, Gang Subur, satu putaran dana yang diha- PAPBD atau tidak terlebih-lebih sama DPRD Sibolga untuk mendahului dana Pilkada yang Kelurahan Bantan pada Selasa (17/11) pukul 20:00 dan AL yang biskan diperkirakan mencapai mengingat sampai dengan saat mendahului dana itu sebab pil- akhirnya menjadi pertimbangan sudah beberapa kali keluar masuk penjara akibat penyalahgunaan Rp3,5 miliar, namun apabila ini kelengkapan dewan di DPRD kada ini sifatnya nasional. pemerintah. Di mana apabila narkotika dan masih bebas bersyarat saat ini, ditangkap di rumahnya pilkada di Sibolga dilaksanakan Sibolga belum juga terbentuk, Kita KPU Sibolga sudah pemerintah daerah menilai akan di Jalan Kenanga pada Selasa (17/11) pukul 14:30. duaputaranmakaanggaranyang kata Ketua KPU Sibolga melalui menetapkan, pilkada di Sibolga terjadi kemungkinan buruk da- Menurut Kapolres Simalungun AKBP Rudi Hartono saat Waspada/Natar Manalu dihabiskan sekira Rp5,4 miliar. Sekretaris KPU Sibolga Syam- akan dilaksanakan tanggal 12 lampenetapananggarandiDPRD dikonfirmasimelaluiPahumasKompolRamliSiraitdanKasat Narkoba DIPEKERJAKAN: Beberapa pria diduga narapidana dieksploitasi Tahapan pilkada dilaksa- suarmi SE kepada Waspada, Se- Mei 2010 dan itu diprediksi tidak molor tentu Pemda mengambil AKP Nelson Situmorang di Mapolres, Rabu (18/11) dan secara mengerjakan proyek air bersih milik Pemkab Dairi di Validen nakan mulai Desember 2009, lasa (17/11) sambil menam- akan molor, sebab yang KPU langkah-langkah dengan payung terpisah Kapolresta Pematangsiantar AKBP Fatori saat dikonfirmasi Kec. Sumbul, Kamis (19/11). maka anggaran untuk pilkada bahkan hal itu bukanlah menjadi Sibolga butuhkan adalah dana Hukum Permendagri No. 44 ta- melaluiPabungpenAKPMuslimdanKasatNarkobaIptuAlturPasaribu kita ajukan bertahap sebesar kewenangan KPU dan pastilah seketika untuk biaya oprasional, hun 2007, kendati tanpa perse- senada menyebutkan A dan AL ditangkap sesudah adanya informasi dari masyarakat. (a14) Puluhan Napi Sidikalang Diduga Rp400 juta yakni melalui PAPBD Pemko Sibolga bijak menyikapi jelas Syamsuarmi sembari me- tujuan DPRD.(a18) Kasat Lantas Dan Kasat Intelpam Dieksploitasi Kerjakan Proyek Delapan Sales Mendadak Kesurupan SIDIKALANG (Waspada): mempertanyakan pengerahan SIBOLGA (Waspada) :Warga matan Pasaribu Tobing, Kabu- dan merinta-ronta, tidak berapa dak kesurupan, namun menu- Polres Tapteng Diserahterimakan Puluhan narapidana penghuni rutan (rumah tahanan negara) itu mengingat kurang wajar kalau narapidana dipekerjakan ke luar Kota Sibolga Kamis (19/11) pagi rut informasi yang dihimpun patenTapanuliTengah menggu- lama yang lainnya juga ikut sekira pukul 09:00 mendadak Waspada dari beberapa Sales nakan minibus Zebra. kesuru-panhinggadelapanorang SIBOLGA (Waspada) : Jabatan Kasat Lantas dari AKP H Indra Rimobunga Sidikalang diduga lokasi. hebohkarenadelapanorangsales Kedelapan sales itu usai menjadi kesurupan. dieksploitasi untuk mengerjakan Kasus itu disebut-sebut telah yang ikut membantu teman- Warman Siagian diserah terimakan kepada AKP .Dchlan Anzib dan yang kantornya di Jalan SM Raja temannya yang kesurupan me- menjalankan tugasnya kembali Teman-teman sesama sales Kasat Intelkam Polres Tapanuli Tengah dari AKP Kusuma diserah .Adi proyek Pemkab Dairi. Kasus itu diadukan masyarakat kepada Sibolga mendadak kesurupan. ngatakan, pada Rabu (18/11) ke Sibolga dan tiba di kantor berupaya menolong teman-te- terimakan kepada AKP Beston Pandiangan Rabu (18/11) di aula terjadi tepatnya di DesaValiden, Kepala Departemen Kehakiman Peristiwa itu sempat mema- pagi perusahaan Metro yang Metro sekira pukul 21:00, na- mannya yang kesurupan namun Mapolres Tapanuli Tengah yang dihadiri para Perwira di jajaran Kec. Sumbul bagi penyelesaian dan HAM. Ditambahkan, tenaga proyek PSAB IKK (air bersih-red) kerja tadi diantar pagi dan pulang cetkan jalan SM Raja Sibolga bergerak pada perkreditan mun Kamis (19/11) sekitar pukul terlihat tidak mampu. Tidak ada Polres Tapanuli Tengah. karena baik warga sekitar lokasi 02:00beberapadiantarasalesyang keterangan dari manajemen Pejabat lama AKP H Indra Warman Siagian mendapat tugas dana stimulus APBN tahun 2009. sore memakai mobil dinas. Ka- barang-barang elektronik dan Dari pantauan lapangan, dangkala, kuantitasnyamencapai kejadian maupun yang melintas rumah tangga itu menugaskan baru pulang tadi ke-surupan Metro, bahkan beberapa warta- baru di Dir Lantas Poldasu dan AKP Dachlan Anzib sebelumnya dari lokasi itu. namun hanya bebe-rapa saat. wan yang ingin mengambil bertugas di Satlantas Polresta Sibolga, AKP Adi Kusuma mendapat Kamis (19/11), mereka bekerja 40 orang. delapan salesnya termasuk sopir tanpa alat pengaman berupa Kepala Rutan Sidikalang, Belum diketahui apa penye- untuk mencari masyarakat yang Tetapi pagi harinya salah satu dari gambarsempatdihalang-halangi. tugas baru sebagai Kasat Intelkam Polres Tobasa dan AKP Beston bab ke delapan sales itu menda- merekasecaratiba-tibakesurupan (a18) Pandiangan sebelumnya bertugas sebagai Kasat Intelkam Polres helm atau sepatu ideal. Hampir Sardin Manullang ketika hendak akan kredit barang- ke Keca- Dairi. tak seorang pun di antaranya me- dikonfirmasi tidak berada di KapolresTapanuli tengah AKBP Dicky Patrianegara dalam arahan- ngenakan sarung tangan. Di sana kantor. Menurut staf, dia sedang nya mengatakan, serah terima jabatan di lingkungan Polri merupakan seorang pegawai rutan diduga keluar dan tidak diketahui ke hal yang biasa dilaksanakan dengan tujuan selain penyegaran juga mengawasi dan beberapa kali mana. Nomor telefon selular untuk peningkatan karir bagi yang bersangkutan dan oleh karena berbincang dengan para pria itu. pimpinan itu juga tidak ada sama itu dipandang perlu dilakukan mutasi jabatan. (a18) Warga Kecamatan Sumbul anggota. (a28) Pasang Iklan Telp. 4528431 HP 081370328259 . Email: iklan_waspada@yahoo.co.id 17. 20 Aceh WASPADA Jumat 20 November 2009 Masyarakat Minta Lanjutkan Pembangunan Jalan KUTACANE (Waspada): lakang. sampai beberapa kali lipat, goreng, minyak tanah dan ke- bangun dan membantu mas- Warga dari puluhan desa di Padahal Kec. Leuser sangat sedangkan harga hasil bumi butuhan lainnya ke tanah yarakat melepaskan diri dari potensial karena telah menjadi seperti jagung, coklat, kemiri, Karo. Jadi kami juga ingin bisa keterisoliran, kemiskinan dan Kec. Leuser Agara tumpuan dan tempat meng- cabe, sawit dan sayur mayur mencapai daerah Agara lain- keterbelakangan. mendesak pemerintah gantungkan hidup warga, ter- kerapkali anjlok sampai titik nya dengan kenderaan roda Sebab itu, Jamidin dan Hu- melanjutkan dan utama dari sektor pertanian terendah, bahkan untuk me- dua dan empat, keluh Amar, saini mengingatkan YLI jangan dan perkebunan, apalagi keca- masarkan hasil bumi petani warga desa Gunung Fak-fak. terlalu gegabah mengusulkan menuntaskan matan yang terletak di bagian tidak semua bisa dipasarkan Komitmen, penghentian jalan tembus pembangunan jalan paling selatan Agara itu berada di Agara, namun harus melalui Bukan Statemen Muasa Situlen-Gelombang tembus Muara Situlan di segi tiga dan berbatasan Kab. Karo, karena tak terbuka Di tempat terpisah, tokoh yang sangat berguna bagi mas- (Agara) Gelombang (Kota langsung dengan Dairi, Karo dan tak adanya akses jalan an- masyarakat Jamidin Hamdani yarakat. Jalan itu sangat ber- dan Subulussalam. tara satu desa dengan desa dan Bagian Humas Format Pe- guna untuk melepaskan Kec. Subulussalam). Saat ini, timpal Jona Marli, lainnya. duli Agara, Husaini Amin me- Leuser dari keterisoliran dan Kec. Leuser merupakan dae- Namun, bila jalan tembus nanggapi pernyataan pihak keterbelakangan, apalagi sela- rah paling terbelakang dan te- Muara Situlen-Gelombang ter- YLI yang menyatakan tidak se- ma ini sebagian warga Leuser Waspada/Muhammad Rapyan Masalahnya, jalan tembus risolir di Agara, baik di bidang buka, kecamatan Leuser, tim- tuju atas program jalan tem- terpaksa berbelanja dan me- Paling kanan Bupati Drs. Darmili dan nyonya, dua dari Kanan Dandim 0115/Simeulue. Muara Situlen- Gelombang pendidikan, kesehatan mau- pal A.Giawa, warga gunung bus Muara Situlen-Gelom- masarkan hasil bumi ke Karo, Letkol Inf. Wirana PB sesaat menjelang keberangkatan Safari Lingkar Simeulue, Sabtu merupakan satu-satunya jalan pun sarana dan prasana lain- Nias Lawe Tawar, dipastikan bang, mengatakan yang dibu- akibat tak adanya sarana ja- (14/11), dimulai dari halaman pendopo bupati. untuk melepaskan enam ri- nya. terlepas dari keterbelakangan, tuhkan masyarakat Leuser lan, kata kedua tokoh pemu- buan jiwa warga Kec. Leuser Kendati sudah lahir 23 de- keterisoliran, kebodohan dan bukan statemen menyakitkan, da dan tokoh masyarakat Safari Lingkar Simeulue dari keterisoliran, keterbela- kangan dan kemiskinan. sa defenitif, namun belum se- mua desa di bisa dilewati ken- kemiskinan, karena semua jalan dari desa bisa langsung tapi komitmen untuk mem- itu.(b27) Diikuti 2.000 Sepeda Motor Tanpa terbukanya akses ja- lan tembus yang menghu- deraan roda dua dan empat, karena masih minim dan sulit- dihubungkan dengan ruas ja- lan Muara Situlen-Gelom- Kompol Boy Heriyanto SIMEULUE (Waspada): Safari lingkar selama kepemimpinannya, khususnya soal bungkan Agara dengan Kota Subulussalam, ujar Kamidin, nya prasarana jalan, jika pun ada jalan penghubung, masih bang. Tak mungkin kami selalu Wakapolres Aceh Singkil Simeulue III dipimpin Muspida Plus Simeu- jalan. dikhawatirkan membuat seki- ada yang harus melalui jalan berjalan kaki sampai tiga jam, SINGKIL ( Waspada): lue, Sabtu (14/11) diikuti sekitar 4.000 peserta Kenyataannya, kata Darmili, masalah tar enam ribuan lebih warga setapak. kalau hanya untuk memundak Kompol Boy Heriyanto, S.Ik, dengan mengendarai 2.000-an sepeda motor. jalan meski sudah jauh perubahaan dari yang mendiami 23 desa itu Akibatnya, harga kebutu- hasil bumi selanjutnya ditu- (foto) Wakapolres Aceh Sing- Pada acara naik sepeda motor mengeli- 7 tahun silam namun masih baru sekitar makin tertinggal dan terbe- han sembako melambung karkan dengan beras, minyak kil yang baru menggantikan lingi jalan lingkar Simeulue sekitar 500 km 20 persen yang berhasil. Kondisi aspalnya Kompol Ali Usman, SH. Se- itu, tampak paling depan Bupati Darmili serta istri, Kapolres Simeulue. AKBP H. Dadik Ju- naedi, SH dan nyonya, Dandim Simeulue. pun telah disaksikan bersama, sebagian jauh dari yang diharapkan. Untuk itu Darmili mengajak semua Masyarakat Minta Pengerasan Jalan rah terima jabatan berlang- sung Senin (16/11) di hala- man Mapolres. Letkol Inf. Wirana PB dan nyonya. Kajari Si- meulue. Toto Sucasto, SH. Sekda Simeulue Drs. Mohd. Riswan R alias Moris dan nyonya pihak senantiasa bergandeng tangan mem- bangun Simeulue ke depan. Meski sudah banyak yang dicapai selama ini, tapi kalau Matang Seupeng Sesuai Bestek Kapolres Aceh Singkil AKBP Helmi Kwarta Kusuma Putra Rauf, S.Ik, MH dalam serta Ketua DPRK Simeulue. H. Aryaudin dan kita bandingkan dengan kabupaten lain be- SIMPANGULIM, Aceh Ti- akhir berupa base B yakni pasir ume proyek jalan itu sepan- sambutannya mengatakan, nyonya. Sementara ketua DPRK dibonceng lum ada apa-apanya, kata Darmili. mur (Waspada): Masyarakat bercampur tanah dan batu ter- jang 1,9 km, lebar empat me- pergantian jabatan di ling- adiknya. Dia berjanji soal cepat rusaknya sejum- Desa Matang Seupeng Kec. masuk campuran batu pecah. ter, ketebalan 25 cm sebelum kungan Polres hal biasa seba- Bupati Darmili menyatakan tujuan kegia- lah badan jalan yang baru di aspal, akan Simpang Ulim, Aceh Timur Jika benar demikian, kenyata- compact dan 15 cm pasca gai penyegaran dalam tugas tan itu bukan untuk ogah-ogahan, melainkan diambil kebijakan dengan meminta du- meminta proyek pengerasan an di lapangan belum sesuai. compact (setelah dipadatkan- pengabdian kepada bangsa, untuk melihat secara bersama tentang kema- kungan dewan seputar penertiban alat-alat jalan Pucok Alue Sa-Matang Bahkan menyangkut penggu- red). Rincian material terdiri negara dan masyarakat. juan pembangunan yang dicapai di lapangan yang melintas di jalan raya.(cmr) Seupeng-Arakundo dibangun naan base-B, baru-baru ini re- dari tanah campur batu dila- Sebelum menjabat Wakapolres Aceh Singkil, Kompol Boy sesuai besaran teknis (Bestek). kanan hanya menabur sedikit pisi base-b berupa campuran Heriyanto bertugas di Reskrim Polda Aceh sedangkan Kompol Pengangguran Tinggi, Jalan ini jalur strategis menghubungkan sedikitnya empat desa dengan pusat ke- tanah pasir kasar di atas per- mukaan jalan, ungkap Saifud- din dibenarkan Sekdes Matang batu pecah dengan tanah pasir dan kerikil setinggi 7 cm sete- lah compact. Ali Usman, SH mendapat tugas baru di Bid. Binkum Polda Aceh. Hadir Ketua Bhayangkari, para pejabat Polres Aceh Singkil dan seluruh Kapolsek di wilayah Aceh Singkil dan Pemko Pelamar CPNS Membludak camatan. Jika dibangun asal- asalan tentu tidak saja merugi- Sepeng Iskandar Basyah. Senada dengan Saifuddin, Anggaran proyek sekitar Rp400 juta dengan pelaksana Subulussalam.(cb02) IDI, Aceh Timur (Waspada): Akibat peng- tidak tertampung lapangan pekerjaan. kan uang negara, tapi juga me- rugikan masyarakat selaku pe- sejumlah warga Pucoek Alue Sa mengeluhkan hal serupa. CV Selat Malaka. Waktu kon- trak 15 September- 11 Desem- Warga Aceh Selatan Diminta angguran yang semakin tinggi di Kab. Aceh Muhammad merinci, dari data terakhir Timur, Provinsi Aceh, menjadi salah satu pe- hingga hari penutupan penerimaan CPNS, nerima manfaat, kata Saifud- din, 32, pemuda Matang Seu- Menurutnya, timbunan yang digunakan rekanan sebagian ber 2009, kata Kamaruzza- man seraya minta masyarakat Siaga Hadapi Banjir Susulan nyebab membludaknya pelamar Calon Pega- Rabu (18/11), di Panitia Penerimaan CPNS wai Negeri Sipil (CPNS) hingga ribuan orang. Tahun 2009 diperoleh bahwa pelamar dari peng kepada Waspada, Rabu besar terkonsentrasi di kedua tidak resah karena jika belum TAPAKTUAN (Waspada): Wakil Bupati Aceh Selatan Daska Rata-rata kab/kota seperti ini. Pelamar- Tenaga Kependidikan 1.206, 717 di antara- (18/11). sisi pinggir jalan. Sedangkan sesuai RAB, pihaknya tetap Aziz mengimbau masyarakat daerahnya tetap siaga, sekaligus nya luar biasa, bahkan di Aceh Timur animo- nya merupakan pelamar dari D-II jurusan Didampingi warga lain- tengah masih jalan dasar. Ka- menolak merekomendasi pro- meningkatkan kewaspadaan menghadapi kemungkinan nya mencapai lima kali lipat dari yang diteri- PGSD. 636 masuk dari pelamar Tenaga nya, Saifuddin menjelaskan, lau pun ada timbunan baru, yek dan akan menginstruksi- terjadinya banjir susulan, mengingat situasi curah hujan yang ma. Ini karena banyaknya pengangguran, Kesehatan, 403 di antaranya pelamar D- proyek pengerasan jalan mulai sangat tipis. Bahkan beberapa kan rekanan menyempurna- melanda kawasan itu diprediksi terus meningkat. kata Bupati Aceh Timur, Muslim Hasballah III Keperawatan. dikerjakan rekanan menjelang titik masih terlihat jalan dasar kan pekerjaaan sesuai kontrak. Kita berharap masyarakat terus meningkatkan kewaspa- melalui Kepala BKPP Aceh Timur, Muham- Pelamar seluruhnya 2.369 orang, dibu- akhir Oktober 2009. Disebut- sebelum ditabur tanah pasir Kamaruzzaman mengin- daan menghadapi kemungkinan terjadinya banjir susulan, mad, SH, MH. tuhkan hanya 154 orang dari seluruh juru- sebut proyek ini di bawah kasar yang disebut-sebut seba- formasikan, sepaket dengan karena kondisi cuaca kian tak menentu, sebut Daska Aziz kepa- Kepada Waspada, Kamis (19/11) di Idi san di Aceh Timur, sebut Muhammad sem- pengawasan Dinas Bina Marga gai base-B. proyek pengerasan jalan juga da wartawan di Tapaktuan, Rabu kemarin. Rayeuk, Muhammad mengatakan, selain fak- bari menandaskan, pihaknya akan melak- dan Cipta Karya provinsi de- Ini terjadi karena saat pe- akan dibangun tiga jembatan Harapan itu dikemukakan Wabup sehubungan awan hitam tor pengangguran, banyaknya pengusaha sanakan ujian 25 November, atau serentak ngan nilai Rp400 juta. Sayang- ngerukan (grader awal), ke dua plat beton, namun sejauh ini terus menyelimuti sebagian wilayah Aceh Selatan, meski sejauh yang belum menerapkan Upah Minimum dengan test yang dilaksanakan Provinsi nya, lanjut Saifuddin, nilai ini sisi pinggir jalan terlalu dalam item dimaksud belum diker- tidak bisa diketahui pasti oleh dikeruk, sampai-sampai ben- jakan rekanan karena penge- ini belum ada laporan terjadinya banjir bandang susulan mau Regional (UMR) sebagaimana ditetapkan Sumatera Utara. pun tanah longsor termasuk di wilayah rawan. bersama pemerintah. Hayatun Nisa, 24, pelamar CPNS me- masyarakat karena proyek ti- tuk jalan menjadi cembung. rasan jalan masih dalam pro- dak dilengkapi plang nama. Kemungkinan siasat ini untuk ses pengerjaan. Menurut dia, meski tak ada korban jiwa, banjir yang melanda Sepanjang UMR atau upah masih ren- ngaku, bersama beberapa temannya di Aceh daerah penghasil pala, Minggu pekan lalu, selain merendam dah, maka orang berbondong-bondong me- Timur melamar CPNS karena ingin menjadi Demikian pula volumenya, mengurangi jumlah pemakaian Kalau soal tidak ada plang belum jelas. material. Parahnya lagi, hampir proyek, setahu saya memang ribuan rumah penduduk di beberapa kecamatan termasuk lamar jadi PNS. Dan itu adalah salah satu PNS yang digaji pemerintah dengan fasilitas umum juga mengisolir ratusan warga desa Panton Luas penyebab membludaknya CPNS di Aceh, mengabdi kepada bangsa dan negara. Kabar yang kami terima, di sepanjang pinggiran jalan kini tidak ada di RAB. Saya rasa de- proyek pengerasan jalan Pu- terbentuk anak saluran bekas mikian. Apalagi ini proyek pro- Kec. Sawang, akibat tanah longsor menutup badan jalan di sebutnya seraya mengatakan, banyaknya Selama ini saya berstatus pegawai swasta, kawasan Gunung Panton. pengangguran disebabkan banyaknya atau menganggur, mudah-mudahan test cok Alue Sa- Matang Seupeng- pengerukan, kata warga. vinsi. Biasanya plang proyek Arakundo memiliki panjang Secara terpisah, Kamaruz- hanya ada pada proyek tingkat Sedangkan banjir terparah adalah Kec. Pasie Raja, Bakongan lulusan Perguruan Tinggi (PT) di daerah yang kali ini lewat, harap Nisa.(cmad) sekitar 1,9 kilometer, lebar em- zaman ST, Konsultan Proyek dua. Meski demikian untuk Timur, Samadua dan Sawang. Sementara sejumlah kecamatan pat meter, ketebalan 25 cm pengerasan Jalan Pucok Alue lebih jelas, silakan konfirmasi lainnya, banjir hanya bertahan dua sampai tiga jam sehingga Ngaku KPA, Caplok Wilayah Bener Meriah atau 15 cm setelah dipadatkan. Materialnya berupa tanah Sa-Matang Seupeng-Arakun- do yang dihubungi via telefon, ke Dinas Bina Marga dan Cipta Karya provinsi, tandas Kam- tidak sempat menggenangi perumahan penduduk. Para korban banjir yang di beberapa desa terparah, telah campur batu dan lapisan ter- kemarin, membenarkan vol- ruzzaman.(b10/cmus) Pantan Lah Masuk Wilayah Bener Meriah kita serahkan bantuan masa panik berupa beras, mi instan dan lauk pauk, sebutnya.(b19) REDELONG, Bener Meriah (Waspada): Bupati Bener Meriah Ir. H. Tagore, AB menye- terkait penggarapan lahan untuk keperluan perkebunan masyarakat di daerah Bener Pemko Subulussalam Produk Kerajinan Lokal Belum butkan Kampung Pantan Lah di Kec. Pintu Rime Gayo masih dalam wilayah Bener Me- riah. Nama kampung tersebut juga dibuat Meriah, hal itu pun tentu ada prosesnya dan harus diketahui pemerintah daerah mau- pun lembaga dewan, paparnya. Dilamar 6.194 CPNS Mampu Bersaing Di Pasaran TAPAKTUAN(Waspada): Bupati Aceh Selatan Husin Yusuf SUBULUSSALAM (Was- berkas calon pelamar berasal mendaftar tujuh orang S.2, mengakui berbagai jenis barang kerajinan produksi lokal di dengan bahasa Gayo. Tagoer menerangkan, kalau ada masya- pada): Hingga berakhir masa dari alumni Universitas Gene- 2.277 S.1, dua pelamar dari Dijelaskan Tagore kepada Waspada, Ka- rakat ingin berkebun di wilayah tersebut daerahnya belum mendapat respon di pasaran bebas baik di pendaftaran Calon Pegawai rasi Muda Medan (UGMM), D.IV dan 588 pelamar dari mis (19/11), wilayah perbatasan tersebut me- tentu yang akan diprioritaskan masyarakat dalam maupun luar negeri. Negeri Sipil Daerah (CPNSD) ditolak. Ada sekira tujuh ber- D.III. rupakan bagian pemukiman penduduk yang Bener Meriah, bukan masyarakat yang tidak Hal ini tejadi karena kualitasnya relatif rendah dibanding Kota Subulussalam tahun ang- kas calon pelamar yang kita to- Terkait pengambilan no- diserahkan Kab. Aceh Tengah ke Pemkab Be- jelas dan ngaku-ngaku dari organisasi ter- hasil produksi kerajinan daerah lain, kata bupati dalam pidato garan 2009, Rabu (18/11), lak setelah mempedomani mor ujian, Mustoliq menye- ner Meriah ketika dimekarkan lima tahun tentu. Masyarakat kita pun masih butuh tertulis dibacakan Sekdakab Drs. H. Harmaini, M.Si, ketika 6.194 pelamar dipastikan ter- buku petunjuk resmi yang kita butkan dilakukan empat hari, lalu. Jadi kalau ada pihak mengklaim wilayah lahan perkebunan, kenapa harus kita beri membuka pelatihan makanan, minuman, anyaman serta sula- daftar menjadi peserta test terima, urai Mustoliq menun- yakni Jumat (21/11) hingga Se- tersebut akan dikuasai pihak-pihak tertentu, kepada warga luar daerah yang tidak jelas, man benang emas, di gedung Rumoh Inong Tapaktuan, Rabu yang digelar, Selasa (25/11). Se- jukkan buku terkait. nin (24/11) di Setdako Subu- ini artinya masyarakat Bener Meriah akan tanyanya. (18/11). mentara formasi yang dibu- Merinci ijazah para pela- lussalam. Kita hanya melaya- terusik dan sangat terganggu dari segi wilayah Di tempat terpisah, tokoh pemuda Be- Sebab itu untuk merebut pasar, kata bupati, tak ada alternatif tuhkan 581 orang, meliputi 250 mar, menurut Mustoliq, untuk ni pelamar dan tidak bisa di- hukum administratifnya, tegas Tagor. ner Meriah, Said menyatakan, pihaknya ber- lain selain berusaha memperbaiki kualitas barang kerajinan, tenaga guru, 45 tenaga keseha- tenaga kependidikan S.1 seba- wakilkan, tegas Mustoliq me- Awalnya, terkait adanya upaya sekelom- sama rekan-rekan dari Ikatan Pemuda Indo- baik bentuk, motif maupun daya tahan agar memenuhi standar tan dan 286 tenaga teknis. nyak 822 pelamar, D.II seba- nambahkan, sistem ini dilaku- pok masyarakat mengatasnamakan dirinya nesia (IPI) telah melakukan survey dan me- mutu pasar sehingga bisa menerobos manca negara. Mustoliq, unsur panitia pe- nyak 2.113 pelamar. Sementa- kan untuk menghindari kesa- dari Komite Peralihan Aceh (KPA) asal Kab. ngukur tanah akan dijadikan perkebunan nerimaan berkas calon peserta ra untuk tenaga kesehatan, lahan seperti pernah dialami Sementara Ketua Dekranas Aceh Selatan, Ny. Rawiyah Husin Bireuen menemui Kepala Kampung Pantan- atau hutan lindung. Menurutnya bukan un- CPNSD Kota Subulussalam di dari 45 yang dibutuhkan ter- pihaknya tahun lalu. Pihaknya Yusuf menyebutkan, pelatihan kerajinan untuk memberdayakan Lah, Kec. Pintu Rime Gayo, minta agar wila- tuk sekelompok masyarakat yang menga- ruang kerjanya, Kamis (19/11) daftar 31 pelamar dari S.1, 310 berharap pelamar benar-be- masyarakat pedesaan dalam bidang industri rumah tangga yah tersebut diserahkan ke Kampung Peudada tasnamakan dirinya KPA wilayah Bireuen. mengatakan, hampir semua orang D.III dan 44 orang dari nar memanfaatkan kesempa- (home industri). Kab. Bireuen pada hari Minggu 15 November. Diungkapkannya, sesuai rencana bersa- formasi diisi pelamar. Kecuali SPK. Lalu untuk tenaga teknis, tan dan mentaati semua atu- Persoalannya semua jenis bahan baku produksi lokal ini Bupati Bener Meriah menambahkan, wi- ma dengan tokoh pemuda lainnya H. Mis- itu, setidaknya tujuh orang dari 286 yang dibutuhkan, ran yang berlaku.(b33) belum kunjung dimanfaatkan secara maksimal karena layah perbatasan tersebut permasalahannya riadi (Adijan), akan menempatkan 2500 ang- telah diserahkan ke tim penentu tapal batas gota IPI ke wilayah tersebut untuk berkebun, terbatasnya sumber daya manusia. Pelatihan menjadi salah provinsi yang dibentuk Gubernur. Kalau ada rencana itu telah disampaikan ke pemerin- satu jawaban memanfaatkan potensi SDM dan SDA yang ada, warga yang memohon kepada Gubernur tah daerah.(cb04) tambahnya.(b19) Gelombang Besar, Angin Kencang Landa Pantai Timur IDI, Aceh Timur (Waspada): Gelombang Desember hingga awal Januari. besar dan angin kencang kembali melanda Meski demikian, nelayan di Kuala Idi, pantai timur Aceh, sepekan terakhir. Banyak khususnya tetap mempersiapkan segala nelayan memilih tidak melaut. Akibatnya bentuk antisipasi mencegah terjadinya ke- stok ikan di beberapa TPI menipis. celakaan di laut, baik itu baju renang mau- Harga ikan mulai naik. Bahkan sejumlah jenis ikan kini mulai langka, seperti gurami. pun alat pelampung lainnya. Kini semua nelayan dibekali baju pelampung, kata Heri PASANG Ini karena nelayan tidak berani melaut, dise- yang juga Sekretaris Aspira Aceh Timur. babkan gelombang tinggi dan angin ken- cang, sebut Heri, tokoh nelayan Kuala Idi Sementara Ketua Pengurus Panglima Laot Lhok Kuala Idi, Tgk. Muslem H. Musa, IKLAN Rayeuk, Kamis (19/11) di Idi. Menurutnya, tingginya gelombang berda- kepada Waspada membenarkan gelombang dan angin kencang mulai melanda pantai MINI sarkan pengakuan beberapa tekong kapal timur Aceh. (boatred) mencapai 4 hingga 5 meter. Per- putaran arah angin terkadang juga tidak me- Meski demikian, untuk mencu-kupi stok ikan di Kuala Idi atau di beberapa TPI masih ACEH nentu di parairan Aceh, mulai dari perbatasan banyak nelayan melaut. Aceh Tamiang dengan Sumatera Utara hingga Gelombang ada, tapi belum mencapai Hub: ke perairan Kota Sabang. puncak. Biasanya puncak angin kencang Heri menambahkan, tinggi gelombang dan kencangnya angin belum mencapai dan gelombang besar itu bulan Desember, tandas Muslim H. Musa yang akrab disapa 0651-22385 puncak. Dikarenakan, berdasarkan pengala- man nelayan, puncak tingginya gelombang Abu Laot seraya mengharapkan, mendekati masa hujan nelayan yang melaut berhati- Waspada/Muhammad Rapyan Ketua DPRK Simeulue. H. Aryaudin menunjuk salah satu dari sekian jalan yang berlubang 0645-42109 sebagaiman tiap tahun terjadi mulai awal hati.(cmad) di lintasan dari dan ke Sinabang. Sekian lama tak diperbaiki banyak jalan berlubang-lubang yang kini jadi kubangan. Foto direkam Rabu (18/11). 18. WASPADA Jumat 20 November 2009 Aceh 21 Kepala Desa Pertanyakan Jalan Kabupaten Rusak, MaTA Dana BKPG Kritik Proses Tender Proyek LHOKSEUMAWE (Waspada): Sejumlah kepala desa di Wilayah Pemko Lhokseumawe mempertanyakan ACEH UTARA (Waspada): Keru- kan BPK-RI bersama PPTK, diketa- dana Bantuan Keuangan Peumakmu Gampong (BKPG) sakan sejumlah ruas jalan di Kab. hui penghamparan material agre- yang belum disalurkan. Sementara bantuan Pemerintah Aceh Utara disinyalir akibat kesala- gat dengan volume 655,20 meter Aceh senilai Rp100 juta per desa untuk daerah lain sudah han dalam proses tender. Di antara- kubik tidak sesuai kontrak. Dalam disalurkan. nya pada pekerjaan lanjutan peng- kontrak dinyatakan menggunakan Keluhan kepala desa disampaikan kepada Komite aspalan jalan Panton Labu Lang- landasan pondasi atas (LPA) kelas- Pengawasan Anggaran dan Kebijakan Publik (Kompak) kahan yang dikerjakan tidak sesuai B dengan harga satuan per meter di Lhokseumawe. Menurut Koordintor Kompak Ikhsan, spesifikasi teknis. Rp322.717,00 atau total Rp211. di kabupaten lain bantuan sama sudah disalurkan. Untuk Pantauan Waspada, Rabu (13/ 444.178,40. tahap pertama Rp50 juta, jelasnnya kepada Waspada, 11), jalan Panton Labu di Kec. Tanah Namun kenyataannya meng- Rabu (18/11). Sisanya dilanjutkan tahap berikutnya. Jembo Aye rusak. Meski menurut gunakan LPA kelas-C dengan harga Penyaluran dana bantuan dari provinsi dilakukan warga jalur transportasi ini belum satuan per meter hanya Rp167. melalui Dinas Pemberdayaan Masyarakat. Dari hasil lama dibangun, namun di beberapa 339,00 atau total Rp109.640.512,80. penelusuran pihak Kompak, disinyalir terlambatnya titik telah hancur. Padahal belum Dengan demikian terjadi selisih pengucuran bantuan akibat kesalahan dinas. lama dibangun, tapi aspalnya sudah harga Rp101,803.665,60, tambah Sementara Kepala Dinas Pemberdayaan Masyarakat rusak, kata Muhammad Hasan, 25, Alfian seraya menjelaskan, kondisi yang dihubungi Waspada sedang tidak berada di tempat, warga Tanah Jambo Aye. Kondisi itu ini berpotensi merugikan keuang- sehingga belum diketahui alasan belum disalurkannya mengakibatkan warga sulit melin- an negara. bantuan kepada masyarakat 68 desa itu.(b17) tasi jalan yang dibangun dari dana Menurutnya, dari hasil lokakar- Anggaran Pendapatan dan Belanja ya yang diikuti sejumlah satuan Gedung SD Dibobol Maling Kabupaten (APBK) Aceh Utara. Sementara itu, hasil penelu- kerja perangkat daerah (SKPD) di jajaran Pemkab Aceh Utara bebe- JULOK, Aceh Timur (Waspada): Kawanan maling suran LSM anti korupsi Masyarakat rapa waktu lalu, terungkap sistem membobol Gedung SD Negeri Ulee Tanoh, Kec. Julok, Transparansi Aceh (MaTA), Badan tender masih perlu pembenahan. Aceh Timur, Minggu (15/11) sekira pukul 09:15. Akibat- Pemeriksa Keuangan (BPK-RI) Di antaranya proses tender masih nya perangkat elektronik terdiri dari CPU, monitor, menemukan pengaspalan hot-mix tertutup. printer, DVD, Wiyer Les, serta sound sistem raib. Jalan Panton Labu Langkahan Sementara Kepala Dinas Bina Kerugian ditaksir sekitar Rp13 juta. Tapi berkat tidak sesuai spesifikasi. Pekerjaan Marga Pemkab Aceh Utara, Tan- kerjasama polisi masyarakat, akhirnya alat elektronik lanjutan pengaspalan hot-mix ber- wier menjelaskan kerusakan di itu berhasil ditemukan sekitar 300 meter dari lokasi Waspada/Zainal Abidin biaya Rp1.701.408.000 itu tak sesuai beberapa proyek pembangunan pada salah satu rumah kosong tak berpenghuni. KEMBALI RUSAK: Seorang warga melintasi jalan lintas Panton Labu Langkahan yang baru selesai dibangun spek, jelas Koordinator MaTA, Al- jalan kabupaten akibat faktor lain. Putri Wahyuni, salah seorang guru mengatakan, namun rusak lagi, Kamis (13/11). fian. Jangka waktu pelaksanaan Seperti kerusakan jalan Panton pagi itu dia melihat pintu kantor sekolah terbuka. Sementara barang-barang berupa komputer telah tidak pembangunan selama 58 hari ka- Labu Langkahan karena sering lender, mulai 4 November 2008 dilintasi truk bermuatan berat. Hal Gangguan Gajah ada lagi. Melihat kondisi itu, Putri yang tinggal di komplek sekolah mengabarkan kepada wakil kepala sampai 31 Desember 2008 dan ma- sama terjadi di jalan Buket Hagu, sekolah yang tinggal tidak jauh dari lokasi. sa pemeliharaan 90 hari kalender. Kec. Lhoksukon, jelas Tanwier, Mengingat aset negara hilang, selanjutnya masalah Hasil pemeriksaan fisik di la- yang sering dilintasi kendaraan itu dilaporkan kepada Kepala SD Negeri Ulee Tanoh, pangan, 18 Desember 2008 dilaku- bermuatan galian-C.(b17/cmus) Bahronsyah, S.Pd, diteruskan ke Mapolsek Mapolsek Julok.(cmad) Penghuni Rutan Bireuen Butuh Pelayanan Kesehatan Makin Parah Kemacetan Dominasi Masalah Transportasi Di Aceh GEUMPANG, PIDIE (Waspada): gunungan), sering dilewati gajah Lutueng, Mane, menyebutkan pi- BANDA ACEH (Waspada): Kon- kaan di jalan raya adalah faktor BIREUEN (Waspada): Napi dan tahanan Rutan meski sebelumnya hanya sekedar haknya sudah berupaya semampu disi transportasi di Aceh sangat kelalaian manusia. Bireuen butuh pelayanan kesehatan dari pemerintah. Keberingasan kawanan binatang memprihatinkan, terutama karena Menanggapi ini, Kepala Dinas melintas dan tidak melakukan peng- dan sebisanya untuk menghalau ka- Beberapa napi dan tahanan, Rabu (18/11) mengata- berbelalai (gajah) di kawasan rusakan. wanan gajah yang selalu meresah- pengaruh masalah kemacetan dan Perhubungan, Komunikasi, Infor- kan, meski mereka penghuni rumah tahanan namun pemukiman penduduk dengan Ibnu, seorang warga dan tokoh kan, tapi satwa itu masih saja nong- tingkat kecelakaan yang cukup ting- masi dan Telematika (Dishubko- mereka juga masyarakat yang butuh pelayanan keseha- masyarakat Geumpang menyata- krong dan unjuk kekuatan di pemu- gi. Namun tidak serta merta kesa- mintel) Aceh, Prof. Dr. Yuwaldi mengobrak-abrik berbagai tan. Selama ini mereka belum mendapat pelayanan kan, kondisinya semakin parah sejak kiman penduduk. lahan ditimpakan pada masyarakat, Away menyebutkan, masalah ke- kesehatan dari pemerintah. tanaman bahkan mendekati tiga pekan terakhir, aksi kawanan Kami senantiasa merespon tapi lebih kepada faktor kelalaian macetan di Aceh justru disebabkan Kepala Cabang Rutan Bireuen Suseno, SH yang kawasan perumahan warga Kec. gajah menjadi-jadi. Kami tidak tahu setiap terjadinya gangguan gajah ter- hingga menyebabkan terjadinya hal oleh pengguna jalan dan kondisi dikonfirmasi di kantornya, Rabu (18/11) mengatakan, Geumpang, Kab. Pidie semakin lagi harus berbuat apa, sebab ham- hadap penduduk dan harta mereka, tersebut. jalan itu sendiri. jumlah penghuni Rumah Tahanan Bireuen melebihi pir tiap malam gajah-gajah liar itu sehingga kita pernah menurunkan meresahkan. Hal itu dikatakan pengamat Begitu pun, menurut Yuwaldi, kapasitas mencapai 196 orang, 14 di antaranya napi/ gentayangan di pemukiman pen- tim bersama para Mahot (pawang tahanan wanita. Kapasitas tampung Rutan Bireuen transportasi dan Kebijakan Publik pihaknya melibatkan semua ele- duduk, ujarnya. gajah) dari BKSDA Aceh, untuk me- Universitas Syiah Kuala (Unsyiah), men stakeholder lainnya akan status kelas II B hanya 65 orang napi/tahanan, dan tiga Rumah yang dirusak adalah nghalau kawanan gajah liar tersebut. kali lipat melebihi kapasitas. Dr. Muhammad Isa dalam diskusi membentuk Forum Angkutan Puluhan hektar lahan persawahan milik Apa Sewuri, 42, warga Desa Bahkan tim dari BKSDA berhari-hari digelar PT. Asuransi Jasa Raharja Darat. Dalam memberi pelayanan Kendala yang masih dihadapi, dana yang tersedia dan kebun diamuk kawanan gajah liar Bangkeh. Selain itu, rumah Abdullah di lokasi lintasan hewan berbelalai hanya Rp2,5 juta per tahun sangat tidak memadai. (Persero) bekerjasama dengan Un- kepada masyarakat terutama me- yang jumlahnya diperkirakan sekira Saman, 55, di Desa Pulo Lhok, mem- itu, tapi setelah kembalinya tim dari Untuk membawa para napi/tahanan yang sakit ke syiah di Gedung AAC Dayan Da- ngatasi kecelakaan dan kemace- 12 ekor, sehingga kerugian warga ber- buat seisi rumah mengungsi hingga lokasi, kawanan gajah beraksi lagi. rumah sakit sangat beresiko tinggi bagi petugas karena tambah besar, ungkap warga kepada wood, Darussalam, Banda Aceh, Se- tan, forum perlu mendapat duku- sekarang. Masyarakat minta peme- Itulah kondisi yang terjadi, katanya. dikhawatirkan melarikan diri. Waspada, Rabu (18/11). rintah serius melakukan penang- Disebutkan, kemungkinan ada lasa (17/11). ngan masyarakat, paparnya. Untuk mengatasi resiko tinggi bagi petugas, pihak- Kebrutalan satwa liar yang dilin- gulangan, kalau tidak warga akan yang tidak beres dari ekologi gajah, Menurut dia, kemacetan dan Sementara Wadirlantas Polda nya sudah mempersiapkan ruang pelayanan kesehatan dungi itu semakin menjadi-jadi, jum- menempuh cara mereka sendiri untuk seperti ada kemungkinan kawasan kecelakaan adalah dua hal pokok, Aceh, AKBP Drs. Ermayudi Sumar- bagi para napi dan tahanan yang sakit. lahnya pun semakin banyak, jika sebe- mengusir kawanan gajah tersebut. lintasan satwa dilindungi itu ter- dan ini bukan salah siapa-siapa. Se- sono menyatakan sangat sepakat Dikatakan, beberapa waktu lalu Bupati Bireuen lumnya hanya 7 ekor kini dilaporkan Kami juga heran, kenapa ka- ganggu atau terusik akibat peneba- mua warga punya tanggung jawab bila di Aceh dibentuk forum untuk Nurdin Abdul Rahman pernah datang ke Rutan, dan menjadi 12 ekor. Bahkan kawanan ga- wanan gajah liar itu selalu muncul ngan hutan (kayu) secara liar. masing-masing untuk melakukan angkutan darat dan transportasi, mengatakan akan membantu soal pelayanan kesehatan jah merusak rumah warga di Gampong di pemukiman penduduk dengan Karena sebagaimana diketahui, perbaikan. Apalagi kita tahu, 80 agar keselamatan dalam berlalu- tersebut.(b16) (Desa-red) Bangkeh dan Pulo Lhok, merusak lahan, tanaman dan ru- apabila habitatnya terganggu biasa- hingga 90 persen penyebab kecela- lintas tetap terjamin. (b07) membuat korban ketakutan dan ter- mah. Padahal di Kec. Mane (keca- nya gajah mengamuk dan turun Pemkab Bireuen Tes Urine paksa mengungsi. Informasi yang diperoleh, sejak em- matan tetangga Geumpang) terdapat CRU (Conservation Response Unit) hingga pemukiman penduduk dan merusak apa saja yang dijumpai. Sayuran Punya Siswa Di Sekolah pat bulan terakhir kawasan pemuki- man penduduk yang masih banyak yang berada di Lutueng, anehnya gangguan hewan berbadan besar itu Kami selalu memantau perkem- bangan terakhir dari aksi binatang Prospek Luas Di Aceh BIREUEN (Waspada): Untuk memberantas pengguna- ditumbuhi hutan-hutan kecil dan besar makin meresahkan, imbuhnya. berbelalai itu, sebut Hasballah, an narkoba oleh pelajar, Pemkab Bireuen melalui Badan karena berada di dataran tinggi (pe- Salah seorang petugas di CRU petugas di CRU Lutueng, Mane.(b21) BANDA ACEH (Waspada): Pros- paikan hasil-hasil kegiatan yang Kesatuan Bangsa, Politik dan Perlindungan Masyarakat pek pengembangan komoditi sayu- telah dilaksanakan selama dua bekerjasama dengan Polres turun ke sekolah melakukan ran di sejumlah kawasan di Provinsi tahun, serta menghimpun masu- tes urine. Kepala Badan Kesatuan Bangsa, Politik dan Perlin- dungan Masyarakat, Drh. Bani Amin, Rabu (18/11) Warga Minta Kontraktor Aceh masih terbuka lebar dan pu- nya prospek masa depan yang cu- kan dari para pengambil kebijakan dan penerima manfaat untuk kup bagus. Hal itu seiring luas lahan perbaikan di masa mendatang. mengatakan prihatin dengan banyaknya pemuda usia produktif terjerumus dalam penggunaan narkoba. Kita sengaja turun ke sekolah untuk menyelamatkan genera- Hentikan Pembangunan Irigasi yang tersedia dengan kondisi wila- yah beragam. BPTP Provinsi Aceh bekerja- sama dengan Badan Riset Perta- si muda, apabila penggunanya pelajar, dengan cepat Karena kondisi wilayah beragam, nian Australia dan lembaga pene- BUKET HAGU, Aceh Utara (Waspa- pernah bertatap muka dengan war- Hagu saat dikonfirmasi, Selasa (17/ pemetaan wilayah tanaman sayuran litian Sayur Taiwan, telah membina mempengaruhi kepada kawan-kawanyanya, ujarnya da): Sedikitnya 2000 warga petani sa- ga petani bahkan plang nama peru- 11) mengatakan, pembangunan Selasa (17/11), pihaknya melakukan tes urine siswa menjadi sangat penting dalam me- 1.608 petani sayuran yang meman- wah dari Buket Hagu, Kec. Lhoksukon, sahaan tidak dipasang di lokasi. saluran irigasi itu telah sesuai spesi- nentukan komoditas unggulan suatu faatkan lahan kosong terutama di SMKN 1 Jeunieb, selanjutnya ke SMA Negeri Samalanga. Aceh Utara, Selasa (17/11), minta kon- Akibatnya, masyarakat tidak tahu fikasi. Jika kedapatan hal-hal yang Tes urine bagi pelajar akan dilakukan berkelanjutan kawasan, baik untuk tujuan pasar lahan bekas tsunami. traktor menghentikan pembangunan harus komplain kepada siapa. Ini janggal di lapangan, maka pihaknya lokal maupun luar daerah. Peserta workshop 91 orang, ter- ke seluruh sekolah. Namun jadwalnya dadakan, saluran irigasi BLS-I hingga BBS-IB, ka- proyek siluman. Mohon Dinas PU akan memintai keterangan kontrak- sehingga siswa yang mengkonsumi narkoba tidak bisa Sebab itu, Pemerintah Australia diri dari unsur dinas lingkup perta- rena sebagian bangunan yang diker- Provinsi Aceh menyeleksi kontraktor. tor. Dananya belum kita cair sepe- mengontrak beberapa tenaga ahli nian provinsi dan kabupaten, mengelak, terangnya.(b03) jakan dinilai tidak sesuai spesifikasi. Kalau seperti ini kerjanya, yang diru- nuhnya. Kontraktor akan kita mintai sayuran dari Taiwan bekerjasama pengurus kelompok tani, LSM, Un- HT. Syahril Basyah, tokoh masyara- gikan masyarakat. Apalagi proyek pertanggungjawaban sebelum pro- dengan Balai Pengkajian Teknologi syiah, Balitsa Lembang dan dona- 1.608 Siswa Yatim kat Buket Hagu, Lhoksukon, Aceh Uta- ra, Selasa (17/11) kepada Waspada me- seperti ini tidak turun setahun sekali. Ini penting, katanya diamini Nur- yek kita terima 100 persen. Bila perlu, kalau memang tidak layak kita akan Pertanian (BPTP) Aceh untuk me- tur. Hadir Dr. Gamini Keerthi- Bireuen Dapat Beasiswa ngatakan, pembangunan saluran iriga- din, warga lainnya. mengintruksikan untuk membong- ngajari petani di Aceh Semua tenaga ahlinya dikon- singhe, Manager Program Peneli- tian ACIAR berkedudukan di Cam- si itu dikerjakan kontraktor sejak 40 hari Jika instruksi penghentian pe- kar seluruh bangunan, kilahnya. BIREUEN (Waspada): Sedikitnya 1.608 siswa yatim lalu. Hasilnya, dibangun asal jadi. Ba- ngerjaan proyek lewat media massa Menjawab Waspada, Agus tidak trak dari Taiwan, sedangkan Peme- berra Australia. dari berbagai sekolah SD-SMA di wilayah Kab. Bireuen han baku yang diaduk tidak sesuai spe- ini tidak diindahkan, warga akan mampu menjelaskan, berapa vol- rintah Australia hanya memberi Pimpinan Proyek, Dr. Gregory mendapat biasiswa dari Pemerintah Aceh yang disalurkan sifikasi dan dinding bangunan tidak bertindak sendiri untuk meng- ume panjang saluran itu, karena me- uang (bantuan-red), ungkap Kepa- C Luther menyebutkan, kegiatan melalui Bank BPD sejak beberapa waktu lalu hingga menggunakan batu bersih, dengan hentikannya. Ini dilakukan demi nurut dia masih dalam perencanaan. la BPTP Aceh, Ir. T. Iskandar, M.Si yang didanai lembaga penelitian sekarang. Tahap I Rp600 ribu, tahap II Rp1,2 juta per orang. adukan semen 50:50. Selain itu penge- kemaslahatan hidup orang banyak. Apalagi itu merupakan proyek pin- menjawab Waspada di sela-sela pertanian Australia tersebut terdiri Kepala BPD Cabang Bireuen, Anshari menjelaskan, coran dilakukan di air. Kita khawatir, Dan sebelum kontraktor itu rugi dahan dari BLS 11 ke BLS 12. Saya se- kesibukannya pada final workshop dari pelatihan SDM petugas dan pihaknya sedang menyalurkan beasiswa yatim, mulai saat pelepasan air ke sawah bangunan banyak, sebaiknya pembanguanan tuju dengan masyarakat. Kita akan be- (lokakarya akhir-red) di aula BPTP petani, pengkajian bekerjasama dari sekolah tingkat Pendidikan Anak Usia Dini (PAUD), ini ambruk, sebut Syahril Basyah me- saluran irigasi itu dihentikan. rembuk dengan atasan, apakah proyek di Banda Aceh, Rabu (18/11). dengan petani dan mengetahui Sekolah Dasar (SD/MIN), SMP/MTsN dan SMA/MA, wakili warga. Agus Suryadi, Pengawas Proyek ini akan kita hentikan sementara atau Lokakarya dua hari, Selasa dan kendala pada proses produksi sa- di 17 kecamatan. Selain itu, pihak kontraktor belum Saluran Irigasi BLS-I-BSS-IB di Buket bagaimana, sebut Agus.(cmun) Rabu (17-18/11), untuk menyam- yuran pada lahan tsunami.(b21) Anshari menyebutkan, jumlah dana tahap pertama dari jumlah penerima 1.608 siswa, dananya mencapai Rp6.368.800.000. Sedangkan tahap II jumlah Rp12 miliar. Bantuan Rumah Sementara BPD Bireuen juga sedang menunggu Pelajar Jadi Motivator Kebersihan Kota Lhokseumawe nomor rekening sekitar 570 warga yang rumahnya terbakar dari BRA, karena uangnya telah berada di bank. KEPALA Dinas Pendidikan (Kadisdik) Ujong Pacu, Kec Muara satu, Pemko terurai), katanya. Kita menunggu nomor rekening warga korban Pemuda dan Olah Raga, Pemerintahan Lhokseumawe. Juara III lomba me- Menggarap dan memobilisasi rumah terbakar hasil pendataan yang dilakukan BRA. kota (Pemko) Lhokseumawe, Ramli milah sampah yang diselenggarakan sampah ke tempat pembuangan se- Masing-masing korban Rp40 juta, jumlah dana Ismail, S Pd minta pelajar jadi motivator Badan Lingkungan Hidup dan mentara (TPS) dan tempat pem- keseluruhan Rp22,8 miliar. sebutnya.(b03) kebersihan kota Lhokseumawe. Kebersihan (LH dan K) Pemko Lhok- buangan akhir (TPA) itu hal yang Karena itu sosialisasi kebersihan seumawe, Minggu (15/11). gampang, cukup hanya dengan me- Lagi, Puluhan Siswi SMAN 1 di kalangan pelajar, tidak hanya di saat penilaian tim Adipura. Tapi, kita ha- Perlombaan mengolah sampah pada hari yang sama, kelompok Seko- ngerahkan armada dan petugas ke- bersihan kota. Namun, membentuk Langkahan Kesurupan rapkan aktivitas itu berlaku secara ruti- nitas. Sebab, tingkat kota kecil Lhokseu- lah Menengah Pertama Negeri (SMPN) 7 Cunda Lhokseumawe, ke-luar seba- karakter sadar kebersihan dan sadar lingkungan bersih, ini yang sulit dan LANGKAHAN, Aceh Utara (Waspada): Hanya berse- mawe, tuntutan akan sadar kebersihan gai juara I. SMAN 6 kota Lhokseuma- merupakan pekerjaan berkesinam- lang satu hari, puluhan siswi SMAN 1 Langkahan, Aceh dan sadar lingkungan bersih sudah ha- we, juara II dan SMPN 10 Kec Blang bungan, serta tanggungjawab utama Utara kembali kerasukan roh halus. Kejadian berbau rus merakyat, kata Ramli Ismail kepa- Mangat, Pemko Lhokseumawe, juara Badan LH dan K Pemko Lhokseuma- mistik ini terjadi ketika dewan guru beserta siswa dan da Waspada, Selasa (17/11) menanggapi III pada perlombaan tersebut, jelas we, selaku dekation maker leading tokoh masyarakat menggelar ritual baca surah Yasin beberapa sekolah yang menjadi juara Ramli Ismail, Selasa kemarin. sektor di bidang lingkungan dan ke- bersama di halaman sekolah, Rabu (18/11) pagi. lomba mengolah sampah di kota Kadisdik Pemuda dan Olah Raga bersihan, tandas Ramli Ismail. Ritual baca yasin kami gelar untuk mengusir roh Lhokseumawe, baru-baru ini. Pemko Lhokseumawe, mengakui Ia mengamati gagalnya perole- halus yang sehari sebelumnya mengganggu puluhan Ramli Ismail menyambut gembira para juara tingkat SD, SLP dan SLA han piala Adipura kota Lhokseuma- siswi terutama siswi kelas dua IPA. Tiba-tiba kejadian terhadap para pelajar di beberapa seko- ini sudah benar-benar trampil da- we, tahun 2008/2009 lalu dengan seli- serupa kembali terulang. Bahkan jumlah siswi yang lah yang sudah menguasai mekanisme lam memilah, mengolah dan mem- sih nilai angka yang tipis dengan ko- kesurupan lebih banyak lagi, yakni sekitar 20 siswi. Se- memilah, mengolah dan memamfaat- produksi pupuk kompos. ta Banda Aceh, tidak hanya dari pa- orang tenaga tata usaha juga ikut dirasuki makhluk kan sampah organik jadi pupuk kom- Harapan sekarang, ketrampilan rameter sekolah. Tapi, juga lingku- halus, kata Kepala SMAN 1 Langkahan, A Jalil AR yang dihubungi via telefon kemarin petang. pos. Namun, di lain pihak dia mengha- itu supaya menjadi karakter dan ngan. Seperti, sampah di gampong Menurut A. Jalil, sesuai petunjuk Tgk. Razali yang rapkan agar mekanisme itu dapat mengkarakter dalam masyarakat (Desa) Pusong, di kawasan inti kota memimpin ritual baca Yasin, kesurupan yang kerap diajarkan secara merata. kota Lhokseumawe, yaitu mem- terkadang sempat berhari-hari tidak Waspada/M. Jakfar Achmad terjadi di SMAN 1 belakangan dipicu karena ada pihak Kelompok Sekolah Dasar Negeri buang sampah di tempat yang benar. terangkut ke TPA. Nah, kalau ini kita SERAH PIALA: Kadis Perhubungan kota Lhokseumawe, Zulkifli sedang menuntut ilmu hitam dan menguji kemampuan (SDN) 13 Hagu Selatan, Kec Banda Sebelumnya memilah-milah antara mau jujur dan ingin mencari kam- menyerahkan piala lomba pengelolaan sampah kepada juara I antar sekolah kepada para siswiterutama mereka yang mentalnya Sakti, Pemko Lhokseumawe, keluar sampah organik (mudah membusuk bing hitam, siapa kambing hitam- SLP dan SLA yang diraih oleh SMPN 7 Pemko Lhokseumawe, diterima salah agak labil dan mudah dipengaruhi roh jahat.(cmus) sebagai juara I. SDN 4 Kec Banda Sakti dan terurai) dan sampah nonor- nya, lanjut Ramli Ismail. seorang siswi sekolah itu, Ira Marisna di Stadion Tunas Bangsa kota , juara II dan SDN Gampong (Desa) ganik (tidak mudah membusuk dan M. Jakfar Achmad Lhokseumawe, Minggu (15/11). 19. 22 WASPADA Jumat, 20 November 2009 FAX.4561347 1 CM Rp. 12.000 3 CM Rp. 36.000 5 CM Rp. 65.000 7 CM Rp. 91.000 9 CM Rp. 126.000 11 CM Rp. 165.000 IKLAN KHUSUS HARGA BELUM TERMASUK Khusus Medan Deli, Marelan, Labuhan, Belawan 2 CM Rp. 24.000 4 CM Rp. 48.000 6 CM Rp. 78.000 8 CM Rp. 104.000 10 CM Rp. 140.000 12 CM Rp. 180.000 6x1,5 kolom Rp. 120.000 PPN 10% Hub. 0812 6390 660 Iklan Anda Dijemput Bursa PROMO DAIHATSU NATAL MERIAH ISUZU Panther Th. 91-92. BK SUZUKI Escudo Thn. 2000 Dijual. Rp. TOYOTA Corona 1997 Type DIJUAL MOBIL KIOS JUALAN HILANG AUTOMOTIVE Xenia DP 10Jt-an/angs. 2 Jt-an Terios DP 20Jt-an/angs. 3 Jt-an Luxio 4 Gran Max MB DP 9Jt-an Medan asli. W. Abu2 cantik skl. PS, AC, Tape, VR, BR, H. 39,5Jt. 96Jt TV/Power, Subwofer / CD / Ban Besar. G. 1,5cc. Gold Metalic. Velg 17. Sama Isi Lengkap. Cantik. BK Speksi Hidup. Ingin H. 10 Jt. Nego. Hub. 0812 6477 946 Promosikan Bunga 2,5 %, Diskon + Hadiah. Informasi Pembaca Bursa Automotive Hub. Gery 0813 7694 1988 / 77722561 Hub. 0813 7060 1839 - 763 81000 Hub. 061-77983400 / 0852 7000 3775 Mulus. Hrg. Rp. 65Jt. Hub. 0813 1 B K Ta s y a n g b e r i s i ISUZU Panther New Hi Grade thn 97/98 SUZUKI Carry PU HT 2006, Rp. 57Jt Produk DAIHATSU Taft Rocky Independent 98. AC BR : Air Condition : Ban Radial PS PW : Power Stearing : Power Window Fullsound, TV, Velg, Cobra Baru. Kaleng. Warna Hijau. Hub. Jl. G. Krakatau Gg. Suzuki Carry PU HT 2005, Rp. 55Jt 2589 1460 Psr. I Setia Budi Mdn. Bursa Dokumen2 penting: SEPEDA MOTOR Anda BK Mdn =95Jt. Taft GT 86=39Jt. Katana CL ND DB : Central Lock : Nippon Denso : Double Blower RT VR EW : Radio Tape : Velg Racing : Electric Window GX 2000=49,5Jt. Hub. 0812 6000 6686 Berkat 1 No. 6 HP. 0813 6104 7788 Hub. 7880294 - 7867522 TOYOTA Kijang Krista Diesel Thn. 99. Hijau met. BK Asli Medan. Mobil cantik. Berisikan Bon Penagihan DIJUAL/OVER KREDIT DAIHATSU Feroza 96. Mulus orisinil NEW Xenia VVTi......DP 11 Jt-an New Terios VVTi.......DP 20 Jt-an ISUZU Panther Pick Up Thn. 93 Dijual. W. Hitam, Kijang Pick Up Thn. 96 SUZUKI Esteem 94. 1.3cc. Mulus, Original. BU. Hub. 061-77797306 Sepeda Motor HONDA CS.1. Thn. 2008. Warna merah. Cicilan/Bln 500rb. Toko2 Dan Surat Penting Harian W. Hitam, BK Medan, aC, Tape, BR. Mesin Hijau met. Mulus, original. AC, bagus. H. 18Jt Net. Sisa 1.600.000x 30 New MB BRAM MAX...DP 14Jt-an W. Merah. Keduanya sangat mulus. PS, VR, CD, DVD, Medan asli, TOYOTA Kijang Kapsul 2003 LX Sisa 1/Bulan. Hub. 0813 6167 3580 Lain-lainnya. Hilang disekitar Bulan. Hub. 0812 6477 946 DAIHATSU Xenia Xi (1300cc) thn. 2004 Hub. Tian 0813 6121 3567 / 77399677 DAIHATSU PAKET MURAH Hub. Jl. SM. Raja Dpn. Kapolda Mdn. ISUZU Panther Miyabi (Grand Bravo) 1994. 37 Nego. Hub. 77689316 W. Merah AC, PS, CL, Tape, Jok kulit. BK Mdn. Mulus. Langsung Pemakai. Bursa jalan Halal. Bagi yang WASPADA - 0813 75299 445 TP. H. 110 Nego. Hub. 087868283222 menemukan hubungi. Media (akhir) W. Biru Met. BK Asli Mdn (br. Gran Max Pick Up DP 7 Jtan Angs. 2 Jt-an W. Merah/Silver BK Baru Pilihan. AC, Tape. Kondisi perpanjang), lkp, AC, Tape, PS, PW, CL, Gran Max Minibus DP 16 Jt-an Angs 3 Jt-an mobil, sangat terawat dan orisinil Cat. ALAT KANTOR Remote, BR, VR, sgt mulus skl (95% Origi- Luxio D M/T DP 7 Jtan Angs. 4 Jt-an NB: Lihat mobil tdk kecewa. Hub. 061 77581391/ SUZUKI APV Arena GX Thn. TOYOTA Corona Ex Salon ;87 PS, AC, nal), mesin sehat terawat, jarang pakai (1 tgn dr baru) (KM rendah 50.XXX). Hrg. Xenia 1.0 DLX DP 10Jt An. Angs. 3 Jt-an Terios TX TS XTra M/T DP 23 JtAn Angs 4 Jtan 0812 60258 795 (Daerah S. Budi Tj. Rejo) 2008. Accesories Lengkap/ CL, Tape, BK Mdn, Hrg. Nego. Peminat DIJUAL SECOND Brankas, Filing Cabinet, lemari Plat, Fax, HP. 0812 6005 375 - (061) yang Tepat ISUZU Panther LDX Thn. 93. Biru Mls. AC Mulus Km. 18000. Warna Lsg. Hub. 0852 6120 1056 (TP). Msn Tik. Cash Register. Printer Epson 2180/ 77864916. Tidak dituntut untuk Rp. 102 Jt/Nego. Hub. 0812 650 6623 Sirion D M/T DP 20 Jan Angs. 4 Jtan Hub. WINDI HP. 0812 6078 052 DB, VR, BR, RT, PS, PW. Nama Langsung. 1170/800. Hub. 0813 9785 9320 Bergundi / Merah Maroon. DAIHATSU BARU PAKET AKHIR TAHUN Xenia.........................DP Mulai 16 Jt-an Flexi 061 (77402067) H. 41Jt. Nego. Hub. 0858 3015 2886 Harga Rp. 126 Jt damai. Hub: TOYOTA Starlet 85 dijual. Kondisi mesin prima, AC, VR, RT. Body/Cat Bursa dan dibelikan imbalan yang Iklan Anda # DAIHATSU PAKET IDUL ADHA # Terios........................DP Mulai 19 Jt-an Gran Max Minibus...DP Mulai 12 Jt-an Luxio..........................DP Mulai 6 Jt-an LUXIO DP Hanya 5 Jt, Angs 4 Jt-an OPEL Blazer Montera 2000. Mulus. W. Hitam, BK Medan, AC, Tape, BR, Besar, 061-7784 1643 Bp. Ngudi dengan mulus. Jual Cepat Rp. 21Jt. HP. 061-77515253 BUTUH UANG sepantasnya. Hub. PT. Capella Medan, Josua XENIA Li DP 11 Jt, Angs. 3 Jt-an Pwd. CL, PS. Cantik. Harga 62jt. Nego. TOYOTA 100% BARU TOYOTA Kijang SSX Commando ANDA BUTUH DANA TUNAI? (061) 77004944 / 0812 6311 0820 TERIOS TS - Extra DP 20 Jt-an Angs. 4 Jt-an Bisa TT. Mobil. Hub. 061-7692 8865 AVANZA, RUSH, INNOVA, FORTUNER, YARIS, VIOS, ALTIS, CAMRY, HILUX DP + Bunga Ringan. 1993, abu2 tua Rp. 55Jt. Asli Medan. Jaminan BPKB Spd. Motor, mobil Bunga ringan, data dijmpt. BPKB Aman. Hub. Bursa TERCECER Proses Cpt & Mudah, Hub. Taufik OPEL BLAZER LT. DOHC 2002. Mulus. Hub. 0813 7512 7297 - (061) 7795 1428 Mulus Hub. 061-6843 6748 061-6647 7734 / 0813 9779 1077 (TP) RENTAL MOBIL W. Biru mica. BK Medan. Tangan TERCECER 0811 651 993 - 061 77491993 Pertama 1 nama. Siap pakai. H. 68Jt # TOYOTA 100% BARU # BAR ARU APV 06 RENTAL BPKB BK 1195HV. A/n. Noviyani Nego. Hub. 0812 6477 946 Ready: Innova, Fortuner, Rush, Yaris, BURUAN STOCK TERBATAS THN DP ANGS - Kijang LGX Htm, Diesel, BK Mut, Ban Maxxis 01 35 Jt 3,6 Jt ANDA BUTUH DANA Sagita, SAG. Alamat: Jl. Kiwi 17 No. DIJUAL/BU Vios, Altis, Hilux, D. Cabin (Pick Up - Kijang LSX EFI, Biru 01 25 Jt 3,2 Jt Jaminan Apa Saja, Sertifikat Tanah. Harian/Bulan, Terima Antar 367. Kel. Kenangan PS. Tuan. Bunga 0%) Tukar Tambah...Oke !!! Jemput Anak Sekolah, DAIHATSU YRV Thn. 2006/2007. Warna silver, Hub. 0812 655 6962 / 061 77958206 - Cherokee 4x4 M/T Biru, BR 31, Velg asli 95 20 Jt 2,2 Jt Proses Cepat, Syarat Mudah. Hub. OPEL BLAZER DOHC 97 - Zebra Espas 1.6 Maroon Met, VS, BR 96 14 Jt 1 Jt 061-8222774, HP 0816 314 1807 . Harapan I, SMU I dan sekitarnya. metalic, Bill Up Rp. 120Jt/Nego. Hub. 0811 645 684 Ridwan Jl. Bayangkara 449 Mdn. Mulus, Silver, BK Medan, AC, Tape, VR, TOYOTA Innova Tipe V Manual, Th. 2004, - Zebra Master Pick Up, Bak 3 Way Hitam 04 55 Jt Nego - Isuzu Panther Touring, Hitam, Mulus 01 125 Jt Nego Karyawati, supir Ibu2. HILANG DAIHATSU SPECIAL PROMO BR, PS, Pwd, SL, Mesin, body sehat. Siap pakai. H.49Jt. Nego. Hub. 061-7692 8865 Tangan I warna light green. Mulus. Km. rendah. Pajak baru diperpanjang. - Isuzu Panther Pick Up 2.4 04 75 Jt Nego - Land Cruiser VX Turbo Diesel, 4x4, Mulus 96 60 Jt 8 Jt DANA CEPAT Hub. 0813 70430 346 Sertifikat Hak Milik No. 318. An. Jaminan BPKB Semua Tahun. Syamsuddin Sutan Makmur NIB: - Xenia VVTI Li & Xi - Pick Up Granmax - Terios VVTI MITSUBISHI BARU Hub. 762 34312 / Jam Kerja. TP. - Mercy E230, New eyes, Hitam 96 47 Jt 3,4 Hub. SM. Raja 368 Simp. Limun 0812.6336.6155 / 0813.7588.7306 ALAT PELACAK KENDARAAN 00317 Letak Tanah Gg. Seto. Desa/ Proses Cepat, Syarat Ringan. WASPADA DPbs 10%, Proses Cepat & Data Dijemput Bawa Pulang L300 Angs. 3Jt-an. T 120 ss, With GPS Tracking System Hub. TEDDY 77884663 / 0812 6325 656 New Terios VVTI DP 18 Jt-an Colt 110, 125 PS, Pajero Sport, L200,... Serius Hub. (061) 76728071 / 0812 653 3319 xpress Hub. (061) 77052032 - Dengan iTrack anda setiap saat dapat mengetahui Kel: Tegal Sari II. kecamatan: Medan Area. Luas: 85m2. New Xenia VVTi DP 14 Jt-an 0815 3476 7327 * Keberadaan Mobil anda * Laju Kecepatan Mobil MITSUBISHI EVO IV 97 Hijau Met, BK Tersedia Grand Max, Sirion, Luxio. Medan asli, pajak panjang, jok kilit, BPKB * Rute Perjalanan * Berbagai Aktifitas Lainnya TERCECER Terima Tukar Tambah 1 nama, Velg 17. Mesin sehat, cantik, siap BUTUH DANA TUNAI BUNGA RENDAH Hub. Kami: ITrack Medan BPKB Suzuki Carry ST 100 Serius !! Hub. Budi D. 0819 6088 998 / 7756 4010 pakai, mulus. Hub. 7796 3088 (Nego) 1 - 2 %, 1 Jam Cair. Jaminan, SHM, SK Komp. Asia Mega Mas Blok LL No. 32 Thn. 1986. BK 1629 FE. A/n. MITSUBISHI BARU. DP Murah, L300 Camat, BPKB Mobil, Truk, Kreta dan Juga Telp. 0813 6075 0388 - 7321 726 - 77872232 Khairul Amri Nasution. Jl. HONDA Grand Civic Thn. 90. BK Medan, mobil yang masih kredit. Over Leasing Kunjungi Situs kami: iTrack.iqios.com Rawa No. 275 Lk. 13 Medan 10 Jt-an* W. Coklat met. AC, CD MP3 + Power/Sub PU, Colt Diesel. Fuso, T120 SS, Hub. DP lai Woofer, PS, PW, CL, EM, BR, VR. BPKB 2 nama (nama sendiri). Hub. 0857 6070 7345 (061) 763 65344 / 0813 6170 3628 dan Bantu Pelunasan BPKB. Hub. (061) 8445716, 0813 7044 6633 (Heny) Bursa Denai. No. BPKB 6695293-B mu MITSUBISHI T120 SS Thn. 2004. ELEKTRONIK HONDA Nova Sport 88. Dua Pintu Sangat mulus, memuaskan AC, ANDA BUTUH DANA CEPAT !!! TERCECER BK 2 Angka. Warna merah, AC, Tape, Merah, original. Hub. 0812 602 2348 JUAL-BELI PS 1, 2, 3 TV, Keyboard, Mixer, Power, VR, BR, H. 25Jt. HP. 0812 6472 6918 Rp. 49Jt (Nego). Bisa Bantu Kredit. Spesialis Surat Tanah Laptop, LCD Projector, Handycam, Camera, Kulkas, M. Cuci, Tape compo, LCD, dll Hub. MARKET Satu (1) Buah BPKB Proses Cepat & Gampang ELECTRONIC Telp. 821.0097 - 6690.0693 Sp. Motor BK 4925 DP KHUSUS BULAN INI SAJA HONDA Civic Wonder Thn. 1986 HONDA Dijual. Rp. 24Jt. Velg Racing/AC Dingin/Tape Power Sub Wover. Hub. MITSUBISHI L300 BOX TINGGI Thn. 99. Mobil Original. Mesin 1 Hari Clear Pinjaman Max 1/2 Miliar Jl. Setia Budi No. 424 B dekat Simp. Ring Road ZIDAN GAME TEL. 77418902 a/n Kiatno Saputra. 061-7798 3400 / 0852 7000 3775 mulus, siap pakai. 0819 886560 Hub. 0852 7038 9990 * Playstation & Bergaransi Rp. 1 Jt * PS HDD 80 & 160 GB Garansi Rp. 1,65 Alamat Lk. 31 s/d 1,950rb. HONDA Civic Genio BK Mdn asli. NISSAN PROMO AKHIR TAHUN Cash Back Habis + Hadiah menarik BUTUH DANA CEPAT * Install HDD, Service PS1, 2 & 3, TV 29 & 21 Rp. Murah. Rengas Pulau Mdn. Warna hitam. Original tinggal pakai. lainnya + bunga rendah. Info selanjutnya Jaminan BPKB Mobil, SPM, Jl. AR. Hakim 104/Bt. Hari No. 2 NB: Jual/Beli Labuhan Medan. Harga 58Jt Hub. 061-77731399 Hub. 7702 6289 / 0819 7308 2002 Betor, Angkot, Taxi, semua tahun. Hub. Telp. 7781 - 7498 KIA Picanto Sporty thn. 2005. Biru met. BK Mdn Asli Rp. 91Jt. SUZUKI Carry Futura (1.3) Alexander Thn. 91. Warna abu-abu met. AC, Tape, Jl. Gatot Subroto Km. 4,5 No. 43. Sei Sekambing Simp. MINI & EFEKTIF Bursa KOMPUTER Hub. 0812 6594 2789 VR, BR, Jok kulit, BK Medan, Siap pakai. Hrg. 35Jt/Nego. Hub. 061-68440368 Lampu Merah Medan. IKLANKAN PRODUK ANDA RYAN TONER DIBELI CATRIDGE : CANON, HP CANON 40, 41, 830, 831. HP 21, 22, 60B, 60C, 27, 28, 56, 57 Laserjet. HP 12A, HP 36A, HP 35A, dll. Baru / Bekas Dengan Harga Tinggi Hub. 061-76699002 / 0878 682 44474 Mau Menjual Rumah, Tanah, Kendaraan, Barang Kerajinan Tangan atau Barang Dagangan Lain? Ya Tentu...Pasang Iklan di... Surat Kabar Tercinta: Harian WASPADA Untuk informasi lebih lengkap hub TEL. (061) 4576602 FAX. (061) 4561347 20. Ekonomi & Bisnis 23 WASPADA Jumat 20 November 2009 Bursa Bursa Bursa PENDIDIKAN PRIVATE AL-QURAN Jl. Psr. XII - Bdr. Setia (terusan dari Jl. Bilal / Jl. Metrologi) UMROH MULTAZAM PERABOT TEMPAHAN MURAH KOMUNIKASI TERIMA HP TINGGI Nelayan Aceh Butuh 1. UMROH REGULER (MEKKAH - MADINAH) Pedoman tata cara membaca Al-Quran, dengan baik dan benar untuk anak-anak dan dewasa Rencana Jalan Inti Menuju Bandara Kuala Namu &T-62/105 2. UMROH PLUS CAIRO -Lemari pakaian 3 pintu Sungkai asli Rp. 1.500.000 tempahan -Kursi Sofa Kulit 3 ,2 1 pakai Spring Rp. 1.300.000 Hub Telp. (061) 6618116 - 6616802 Garansi, Mulus Hub. 0812 6055 8833 E90 = 5.500 9500=1200 E63 = tinggi 9300 =950 Pi I =1.400 G900 =tinggi 5310 = tinggi 7610 =tinggi W9601 =1950 Bank Perikanan Bersedia mengajar ke rumah SPRING BED DIJUAL MURAH 3210 = tinggi 6680=tinggi KT 610 =tinggi BANDA ACEH (Antara): Nelayan di Provinsi Aceh membu- Call: H. Jalaluddin HP. 0812.657.6065 3. UMROH PLUS TURKI Spring Bed 6 kaki 2 lapis Rp. 1.100.000 1661 = tinggi 6681=tinggi KP500 =tinggi tuhkan Bank Perikanan untuk membantu modal usaha dalam 2630 = tinggi 3110 =700 Samsung=tinggi KURSUS LILIN HIAS MEMBUAT LILIN GULUNG, LILIN LIPAT, LILIN T-45 : Rp. 175 Jt 4. UMROH PLUS AQSHO Spring Bed 5 kaki 2 lapis Spring Bed 4 kaki 2 lapis Rp. 1.075.000 Rp. 1.000.000 2505= tinggi 5800=tinggi Nexian=tinggi Langsung bawa lengkap ke upaya meningkatkan hasil tangkapan dan pendapatan mereka. BUNGA, LILIN ICE CREAM, BIAYA RP. 200.000/ T-62 : Rp. 195 Jt Spring Bed 3 kaki 2 lapis Rp. 900.000 AVISTEL (d/h AVIATEL) Sekretaris Jenderal Asosiasi Saudagar Ikan Aceh (ASIA) ORANG TERMASUK BAHAN PELAJARAN, HASIL BAWA PULANG, BISA MENGAJAR KE LUAR HUB. JL. TITIPAPAN/ PERTAHANAN NO. 8/ 10 Spring Bed 3 kaki Dorong Rp. 1.000.000 Carrefour, Plaza Medan Fair Lt. 4 Zulkifli di Banda Aceh, Kamis (19/11), mengatakan Pemerintah MEDAN SISTEM PAKET DP 10% SEI SIKAMBING D MEDAN Garansi Per 10 tahun Hub. 061-661.8116 - 661.6802 (samping Kalasan masuk, sebelah blooming) Aceh harus memikirkan adanya Bank Perikanan karena bank HUB: ROYAL TELP. (061) 844.2134 (061) 9134.4789 - 0816.346.823 http://indonetwork.co.id/royalmultichemical Bonus : - Bebas Biaya Adm KPR TELP. (061) 457.6116 HP. 0813.6137.2321 - 0812.6566.807 TEMPAHAN EKSLUSIF Bursa konvensional yang ada sekarang tidak bisa diandalkan. Lemari pakaian minimalis, Bed Bank konvensional dan bank syariat di Aceh tidak mau KURSUS KOMPUTER CEPAT - Hadiah (TV, Kulkas, Sofa, Genset, dll) Genset) Mesin Cuci, Kulkas, Sofa, - Discount Harga MELAYANI TIKET DOMESTIK & INTERNASIONAL set, Kitchen set, Sekat ruang, dll Hub. (061) 661.5879 ALAT MUSIK membantu kredit sektor perikanan karena berbagai alasan LPK PAULINE TELP. (061) 456.7532 HP. 0812.6302.6293 - Aplikasi Window XP/ Internet................ 200 Rb (2 minggu) SHM & IMB I Listrik I Air Bersih (PDAM) I Tembok Keliling I Pos Keamanan I Lampu Penerangan KEYBOARD KN-7000 seperti tidak ada jaminan, katanya. Kondisi 90% sangat asli, mewah, barang rumahan. - - Komputer Aplikasi Perkantoran Lengkap350 Rb (1 bulan) Autocad 2D/ 3D/ 3D Max......................... 300 Rb (10 hari) 0813-7580-8383 * 0812-6383-8820 TIKET DAPAT DIANTAR KE TEMPAT Harga Rp. 29.800Jt. Hub. 8210097 - 66900693 Data Bank Indonesia Banda Aceh menyebutkan realisasi - SAP/ EBTAB (Tehnik Sipil)....................... 400 Rb (10 hari) Jl. Setia Budi No. 424 B-Dkt. Simp Pasar III kredit di sektor perikanan di Aceh hanya tiga persen. Ini menun- - Merakit Komputer/ Lengkap................... 400 Rb (6 hari) - Autocad 2D + 3D + 3D Max/ SAP............. 1,2 Jt (4 bulan) jukkan bahwa pihak perbankan di Aceh tidak tertarik membantu - - Desain Grafis Komplit............................. 500 Rb (1 bulan) Bhs. Inggris............................................ 400 Rb (Paket) Harga Model nelayan di Aceh, ujarnya. Daftar langsung belajar, Waktu Bebas, Tanpa batas usia Jl. Sei Batang Hari Ujung 170 Medan Ter Murah Terbaru Dia berharap agar Pemerintah Aceh memikirkan adanya Telp. 844.2158 - 844.2159 Website: www.lkp-pauline.com Bank Perikanan dengan bunga yang rendah, sehingga para 4525462 nelayan di daerah ini bisa mengembangkan usahanya. Bursa KRISNA WATER Zulkifli menyatakan Pemerintah Aceh tidak peru ragu untuk LOWONGAN KERJA PELUANG BISNIS membantu sektor perikanan di Aceh karena potensinya cukup 1. Pemasangan Depot Air Minum besar dan peluang pasarnya juga tidak diragukan lagi. DIBUTUHKAN WANITA (GADIS/ JANDA) Dengan Sistem Filtrasi & Ro Jaga anak, Perawat Gaji Rp. 500 - 1 Jt/ Rp. 22 Jt s/d 38Jt Komoditas perikanan merupakan peluang bisnis yang bln (bersih) Hub. CAHAYA (061) 2. Air Pegunungan 6700 s/d 7000 Liter menggiurkan, karena hampir setiap orang mengonsumsi ikan 7670.0079 HP. 0812.6514.3676 Rp. 230.000 / Tangki sehingga tidak ada alasan bagi perbankan untuk tidak mau KERJASAMA Menyediakan Mesin RO dan Yamaha membantu nelayan. Lembaga Terapi Autisme mencari terapis sebagai mitra sistem gaji + bagi hasil Hubungi: Pemerintah Aceh seharusnya meniru Malaysia yang begitu usaha. T: 0812.2168.5268 CV. HYDRO UTAMA konsen membantu nelayan untuk meningkatkan hasil Jl. Kapt. Muslim No. 53-D Medan tangkapan dan kesejahteraan mereka, katanya. RANTAU PRAPAT Telp. (061) 8457879 / (061) 77839790 Dibutuhkan !!! beberapa orang asisten Dia mengatakan untuk meningkatkan produksi dan Koki dan karyawan/ti restoran, Max. HP. 0812 600 5410 Bursa kesejahteraan nelayan, Pemerintah Malaysia tidak ragu mem- 25 thn, Penampilan menarik, Belum HEWAN PELIHARAAN bantu nelayan dengan memberi pinjaman sampai ratusan juta menikah, Muslim, Jujur & Bertanggung jawab Hub. 0813.6145.0089 Bursa LEMBU QURBAN rupiah. (Tdk melayani MC & SMS) JASA Anda membutuhkannya !!! Bursa Tidak cukup di situ, kata dia, Pemerintah Malaysia juga Hub. 0852.7642.3133 (Jamal) 821.4513 Jl. Setia Budi No. 240 PERCETAKAN memberikan subsidi bahan bakar minyak mencapai 50 persen LOWONGAN KERJA CV. AMDAL ABADI dari harga pasar. - KOKY/ TUKANG MASAK Berpengalaman, menger- - WAITRESS/ PELAYANG USIA: 17 - 30 TAHUN jakan AMDAL, UKL-UPL, DPPL, TERSEDIA SAPI UNTUK DITEMPATKAN SECEPATNYA DI RESTORANT/ CAFE DI BANDARA RUMAH DIJUAL DI JL. M. BASIR 4 Kamar Tidur, 1 Gudang, 3 Kamar RUMAH DIJUAL CEPAT LT. 11x20, LB. 100, KT 3 Keramik, Carport, IZIN LA, IPAL, DLL Telp. (061) 844.8182 UNTUK KURBAN Resesi Singapura Berakhir Mandi, Pagar keliling dan ada kolam Medan Johor, Harga murah Cepat/ POLONIA DAN JL. SM. RAJA MEDAN di belakang 0812.6039.8903 (Joni) damai Hub. 0812.6542.2876 HP. 0812.657.5588 SINGAPURA (Antara): Singapura pada Kamis menyatakan SYARAT: resesi parah berakhir ketika data menunjukkan perekono- RUMAH Dijual di Jl. Pala Dsn. III Desa Sei RUMAH DIJUAL CEPAT RUMAH - PAS PHOTO 3X4: 2 LEMBAR - COPY KTP Mencirim, Sunggal Ds. Serdang Samping Villa Mutiara Johor II Blok G No. 3, Jl. Eka Bursa miannya tumbuh untuk kuartal berturut-turut kedua dalam Masjid Baitussalam, LB: 60m, LT: 500m RAGAM - COPY IJAZAH TERAKHIR Hub. 0812.6440.5211, Hrg nego Surya/ Sidodadi, Full keramik, AC, Ruang tiga bulan hingga September. Sholat, Tipe 110 depan Taman dan - DAFTAR RIWAYAT HIDUP Sarana olah raga, 320 Jt/nego DIJUAL CEPAT Data resmi yang dirilis Kamis menunjukkan produk RUMAH Dijual, LT. 8X18m, LB. 5x18m, 0813.7076.0333 - (061) 6876.6333 LAMARAN DITUJUKAN KE: Jl. Balai Desa Gg. Nusa Indah/ Bunga Eks Tenda Pesta, Lengkap besi, Uk. 5x6m, domestik bruto (PDB) tumbuh 14,2 persen pada periode Juli- PO. BOX 563 KANTOR POS MEDAN Tanjung Marendal II Hub . RUMAH DIJUAL 3 Unit diameter besi 3/4 tebal 1,8mm GUNDALING FARM September berdasarkan basis tahunan kuartal ke kuartal 0856.622.5522, 60 Jt/nego, SK Camat Hub. (061) 735.3664 HP. 0813.6226.4452 Jl. Pancing Komp. IAIN No. 12 Medan, JARANGUDA menyusul kenaikan 21,7 persen di kuartal sebelumnya. DIBUTUHKAN SEGERA RUMAH DIJUAL Jl. B. Katamso Gg. Kenanga No. 1, LT. 15,15x29,1 (441m), LB. 171 (m), 1 Tkt, SHM, 4 KT, 2 KM, Garasi, PLN, PDAM, Telp, Bebas banjir, Maaf khusus Muslim Bursa BERASTAGI Service Secara efektif, resesi di Singapura berakhir, kata Ravi Me- Dua tingkat Hub. 0812.6594.470 MATERI BANGUNAN non, sekretaris tetap pada Kementerian Perdagangan dan Indus- - 1 Orang Tenaga Las & Ketok Body Mobil - (061) 3038.1231 Hub. 0812.601.7682/ (061) 662.0390 KONSTRUKSI tri (MTI), dalam taklimat media. Perekonomian di seluruh - 1 Orang Tenaga Pengecatan RUMAH DIJUAL CEPAT MOBIL SEDOT : 77737996 SEDOT dunia kini sedang beranjak membaik... Singapura mendapat RUMAH Dijual Siap huni, LT. 15x17m, LB. - 1 Org Montir Mobil 14x9m, SHM, 250 Jt Jl. Amal/ Sehat II No. 1 Ukuran Tanah 19x24m WC MAJU JAYA : 0852 7093 3649 JA keuntungan dari tren global dan kawasan ini. - 1 Org Pembantu Montir HP. (061) 7680.4669/ 0819.829.190 Ukuran Rumah 18x12,5m 0819 33 408099: MURAH : GRS. 1 THN. Secara tahunan, PDB Singapura tumbuh 0,6 persen pada Sertifikat Hak Milik Anda punya keahlian ! WC TUMPAT, Sal. AIR, K. Mandi TUMPA kuartal III dibandingkan dengan kontraksi 3,3 persen pada DIJUAL CEPAT Jl. Rawa Cangkuk I No. 8 Medan Denai 1 Unit Rumah Kondisi 90% Selesai. Hub. (061) 7666.8646 Tel. 081361718158, 77008458 periode April-Juni, kata MTI dalam survei ekonomi kuartal Pendapatan boleh di negosiasi Jl. Eka Suka Depan Gang Eka Suka TELP: 0628 91800/ 7003058 NARO SERVICE Jl. Sisingamangaraja III-nya. Pertumbuhan tahunan 0,6 persen pada periode Juli- Hubungi segera: 0852.6058.8558 9 Gedung Johor. Ukuran tanah 15 RUMAH BUTUH UANG DIJUAL FAX. 0628 92780 September merupakan data positif pertama ekonomi itu sejak WAHYU SERVICE x 24 M2. Ukuran rumah 12 x 16 M2. Jl. Setia Luhur Gg. Langsat 187C (100m Email: gundaling2005@yahoo.com WC TUMPAT SEDOT TUMPA SEDOT kuartal III 2008, ketika negara kota itu meluncur kedalam resesi. Kamar 4 buah, Garasi 1 buah, SHM, dr outer ringroad), LT/ LB. 198/135m, Telp. 76352865 Jl. Sukarno Hatta Banda Aceh IMB. Hub.0878.6829.4842 1 Lt, 5 KT, 3 KM, Gudang, Dapur, Garasi, 735.9504 ADA GARANSI Pertumbuhan di kuartal III didorong oleh sektor manufaktur 2 AC, Kitchen set, Full keramik, PAM, PLN penting, yang mencatatkan pertumbuhan 26,6 persen ber- Supardi/ Pimpinan RUMAH BARU DIJUAL 3500 Watt, SHM, Khusus Muslim Bursa WC ANDA TUMPAT - SEDOT Hub. 0812.6041.357 - 0812.6044.551 TRAVEL / WISATA dasarkan basis kuartalan mengikuti pertumbuhan 58,5 persen SHM, Full keramik, Model terbaru, pada kuartal sebelumnya, kata kementerian itu. LOWONGAN KERJA Uk. 7,5x22,5mtr, Jl. Karya Darma Hub. 8219951 RESMI KE MALAYSIA Gg. Famili Medan Johor, Medan DIJUAL SALAH SATU Jl. Setia Budi No. 2 Sektor lain juga beralih menjadi positif seperti industri Dibutuhkan Tenaga Kerja Wanita untuk Hub. 0813.9607.8185 1. Rumah di Gaperta Ujung wholesale dan ritel, yang tumbuh 10,8 persen setelah pening- dipekerjakan pada perusahaan Elec- didalam Komplek, Uk. Tanah katan 7,9 persen pada kuartal II, katanya. WC tronic terkemuka di Malaysia, Kilang 0812.6079.1334 TUMPAT SEDOT SL AIR SANYO COMPANY, bukan KONTREK (OUT 8x15m, Tipe 90, SHM, Telp, SOURCING), sebagai berikut: DIJUAL Kolam Ikan Hias, Harga 265 Jt REHAP RUMAH KM BOCOR. BALAI PENGOBATAN TRADISIONAL CARSEM M SDN. BHD DI IPOH PERAK SHM No. 66 A/n. Sarno Lokasi 2. Rumah di Palm Mas P. Baris Uk. ASIA JAYA DLL. ALAT VITAL Ingin Syarat-syarat pendaftaran dan seleksi: Komplek Perumahan Karang Tanah 8x18, Tipe 70, SHM, Telp, Jl. G. Subroto 9F 76938959 DITANGANI OLEH AHLINYA: M. SUHERDI 1. Wanita umur 18 s/d 30 tahun 2. Pendidikan minimal SMP sederajat Bangun Permai Kel. Tembung Merah Kab. Simalungun Harga 260 Jt Hub. 0812.655.4477 - 0811.6046.774 Jl. Krakatau 88 69467958 DARI PELABUHAN RATU SUKABUMI JABAR Promosikan 3. Membawa Foto copy Ijazah, KTP, Kartu Hub. Sarno 081.39632.3636 Terapi keperkasaan seksualitas Pria hasil permanen tanpa Produk WC Keluarga (Asli dibawa sewaktu interview) 4. Membawa phasphoto warna 3x4: 3 lbr TANAH 8442271 efek samping, alami, bebas pantangan, untuk semua usia Hasil langsung reaksi ditempat, cukup satu kali berobat Anda A. RINCIAN GAJI RUMAH DIJUAL CEPAT/ B.U TANAH Dijual 10x165m, Tepi jln besar Medan 0813 7035 7291 MENANGANI KELUHAN: MENAMBAH UKURAN - Gaji Pokok : RM 415/ bln - Tunjangan Kehadiran : RM 50/ bln LT. 198m (9mx22m) Jl. STM Gg. - Sembahe Km. 21d ari P. Batu 2 Km, 300 Jt, bisa Jl. Setia Budi - Panjang: 13, 14, 15, 16, 17, 18, 19, 20 cm Harian - Tunjangan Shift 12 jam : RM 65/bln 2 kali bayar, Lintasan hidup 24 jam, Cocok utk TUMPAT - Besar: 3,5. 4,5. 5. 5,5. 6 diameter Arifin No. 33, 3 KT, 3 KM, Garasi, - Memperkeras, Tahan lama - Tunjangan Shift : RM 60/bln bisnis Hub. 0812.6487.1965 WASPADA WC TUMPAT/ SEDOT - Ejakulasi dini, Mani encer - Tunjangan Makan : RM 34/bln PAM, PLN, Telp, Muslim, Damai (TP) - Impotensi, Lemah syahwat - Tunjangan Transport : RM 15/bln TANAH EX KAPLINGAN B. FASILITAS: Hub. 061 - 6964.3495 SHM, 11x26,5m, Jl. Bajak II H 77442112 - Diabetes, kencing manis/ batu Juga melayani problem asmara, mempercepat jodoh, Media - Levy subsidy 100% Gg. Villa (Lbr 7 M) Jl. Gatot Subroto Medan pengasihan, penglaris, buka aura, pasang susuk, dll - Asrama tiket pulang, kemudahan DIJUAL Ada Garansi ALAMAT KELINIK TETAP: yang Tepat kesehatan, Asuransi, berangkat naik Serius Hub. (061) 7750.7040 1 unit Ruko I Tk. SHM, Jl. Rakyat Jl. SM. Raja Masuk ke Jl. Utama No. 18 Medan untuk pesawat terbang Tumpat Sedot Jl. Brayan Medan Dari Toko Roti Majestik 100meter No. 175C, Psr. III Medan WC 0812 642 71725 - Bagi yang tidak mampu tidak dipungut biaya proses pemberangkatan. Biaya TANAH KAPLING RP. 60 JT 8442246 Izin Kejaksaan: B/DSP.5/12/2008 Iklan Anda Telp.: dipotong di Malaysia setelah TKI bekerja Harga Rp. 375 Jt/nego SHM, JL. EKA BARU, Izin Dinkes: No. 448/0649/I/2008 HP 0812.6388.7999 . C. JAD WAL SELEKSI: SENIN/ 23 HP. 0812.645.0006 - 0857.6079.8888 MEDAN JOHOR Buka setiap hari NOPEMBER 2009 HUB. 0813.9639.9991. TP ADI Ada Garansi Segera daftarkan diri anda sekarang juga ke: DIJUAL CEPAT (B.U) PT. MUTIARA KARYA MITRA JL. KAPTEN MUSLIM NO. 89C MEDAN TELP. (061) 845.2956 (DEKAT RSU SARI MUTIARA) Contact Person: Mega 0813.6220.2213, Ecy: 0813.7515.5055, 0812.6408.0074 Rumah di Jl. STM Ujung/ Suka Senang No. 7 Medan, SHM, LT. 600m, LB. 300m, Layak Huni HONDA Sonic/ FS 125 Biru TANAH KAVLING RIZKY Hadiah Langsung TV Flat 21 + DVD Player, Berlaku s/d 28 Nov 09 !!! Yang cepat dia dapat Uk: 6,5x15m 6x20m : 12,5 Jt : 14,5 Jt 7,5x19,5m : 17,5 Jt WC TUMPAT Hub. 08887966667 (INDRA) Bursa 11,5/6x20m : 16 Jt Bunglon Rp. 10 Jt Thn 2001 LOWONGAN KERJA KE MALAYSIA Tinggal 5 Kavling dari 10 Kavling selama 3 minggu !!! Lokasi Jl. Karya Pembangunan PENGOBATAN Hub. 0813.6164.7950/ 786.6404 (COMPANY LANGSUNG) Psr. V Sei Mencirim Sunggal Service BUTUH ALAT BANTU DENGAR? ALAT BANTU Hub. 7707.2611 - 7626.5139 Perusahaan Amerika di Malaysia: JUAL CEPAT (B.U) ELEKTRONIK Hub. MELTRA HEARING AID MELTRA Satu unit Rumah, Type 70 REPARASI AC, KULKAS, MESIN CUCI Jl. Kediri No. 36 Medan Tel. 4516161 Memerlukan segera 50 orang TKI Ukuran, Tanah 9x19m, 3 KT, 2 KM Fasilitas, PAM, Listrik, Telepon, SHM Jl. Karya Kasih Complek Perumahan Villa permata Blok C TANAH DIJUAL 1. Jl. Eka Surya/ Jl. Karya Sidodadi Uk. 100x30m: 3000m (depan AC Kompor Gas, Dispenser H & C TV, M. Pompa Air Sanyo Hub. SURYA TEKNIK SERVICE Telp. 66482216 - 0813 7589 8757 SERVICE / BERGARANSI Siap Ketempat PIJAT LULUR DAN REFLEKSI JL. KLAMBIR V NO. 152 Jangan Lewatkan Interaktif langsung dengan PASAK BUMI di DELI TV Setiap dengan persyaratan sbb: No. 9 Medan Johor 100m), beserta isinya, Kiri/ CUCI - T. OBAT - BONGKAR PASANG AC Sabtu Malam Pkl. 22.30 Wib (Live) 1. Wanita, usia 18 - 30 tahun 2. Pendidikan min. SLTP Hubungi langsung Phone 785.0169 kanan/ belakang sudah ditembok setinggi 2 meter Telp. 77677220 HP. 0813 7536 4412 SAVIRA KP. LALANG MEDAN Call Center: 0818 090 73481 Gaji & Fasilitas: HP. 0812.646.7140 AC HARGA HARGA MURAH 1. Gaji pokok : RM 450/ bln 2. Jl. Eka Warni Gg. Nusa Indah Service AC Rp. 20.000,- PENGOBATAN ALAT VITAL Menjual AC 1pk Rp. 2.090.000 JL. MANDALA BY PASS SAMPING BRI Pengobatan Alat Vital H. Suhendar 2. Total Tnj : RM 157 - 265/ bln Uk. 30x20: 600m Baru 100% (Garansi) 3. Total OT Wajib : RM 241 - 287/ bln Menerima Bongkar Pasang AC HUB. 0812.6047.6830 4. Levi subsidi 10% Hub. 0813.6139.7838 dan Tukar Tambah. 0813.7561.8178 Hub. Sumatera Jaya Jl. Gatot Subroto 401 5. Asrama & bus antar jemput Tel. 77555550 - 4143670 disediakan HP. 088261698639 6. Asuransi Indonesia dan Malaysia 7. Klinik dan kantin di pabrik Besar dan panjang di tempat Klinik H. Suhendar di bawah Tidak ada hasil, Mahar kembali kontrol dan pengawasan langsung 8. Berangkat naik pesawat Biaya pemberangkatan 100% dari Ingin Promosikan Ditangani secara profesional H. SUHENDAR potongan gaji RM 75 x 24bln, disini Produk Anda Alami bukan suntik, menggunakan metode terapi dan ramuan tradisional, Diberitahukan kepada masyarakat hanya bayar jaminan Rp. 1 Jt dan untuk berhati-hati terhadap pengobatan dikembalikan sebelum berangkat Pendaftaran setiap hari kerja, Harian Paling aman tidak ada efek samping sejenis yang mengaku-ngaku kerabat H. Suhendar sudah di kenal sebagai pakar membawa copy KTP, Ijazah, KK dan pasfoto 2 lbr langsung ke: PT. TIMURAYA JAYA LESTARI WASPADA kejantanan yang sudah berpengalaman, sanggup mengatasi keluhan alat vital khusus pria, memperbesar, memperpanjang atau saudara, soal cara boleh sama tapi keahlian yang membedakan JL. AH. NASUTION, RUKO TENAGA ASRI NO. 1, SP. POS, PD. BULAN - MEDAN Media yang Tepat (garansi), meningkatkan kekerasan, tambah Mahar Untuk keluhan dan pengaduan silahkan hubungi langsung: (BELAKANG BANK MANDIRI) untuk Iklan Anda kuat dan tahan lama Rp. 500 ribu TELP. (061) 822.7419 H. SUHENDAR HP. 0812.131.6364 dalam berhubungan Jl. Tempuling No. 43 B - Serdang (masuk Gg. Sado) Medan Bursa Mau Menjual Telp. (061) 663.4220 Saksikan !!! PROPERTY 061-6846 2888 061- 6846 3888 Rumah, Tanah, Interaktif bersama Bpk. H. SUHENDAR Informasi Pembaca Kendaraan, Barang di TVRI Nasional Medan. Setiap Sabtu Malam Minggu Pukul 20.00 WIB Bursa Property Bursa GR : Garasi KM : Kamar Mandi LB LT : Luas Bangunan : Luas Tanah BUSANA / AKSESORIS Kerajinan Tangan atau Barang PENGOBATAN ALAT VITAL KP : Kamar Pembantu KT : Kamar Tidur SHM: Sertifikat Hak Milik RM RT : Ruang Makan : Ruang Tamu PECI MAHKOTA Dagangan Lain? MAK EROT MENJUAL PECI TEMPAHAN DITANGANI Berbagai Model Dan Warna RUMAH DIJUAL Jl. Prof. H.M. Yamin SH. No. 340 / Jl. Serdang Ya Tentu...Pasang Iklan di... HAJI TEJA SYAIFUL Alamat Jl. Kapt. Muslim Komp. Tata Bestari No. Depan Gg. Sadu Medan Bila Anda ingin periksa jangan salah masuk. Disini tempatnya, Carilah yang benar-benar asli. Perwira 21 dekat Millenium Plaza, 2 Tingkat, LT. 6x13,5m, yang sempurnya ya disini tempatnya yang lebih joss. Bergaransi seumur hidup tanpa efek samping. Bursa Surat Kabar Tercinta: Pastikan anda menjadi laki-laki yang luar biasa. Fasilitas PAM, PLN, SHGB, Harga 350 Jt Kalau anda penasaran, ikuti terapi ini berlaku untuk semua Agama, ras, dll, Legenda pengobatan Mak Hub. 732.4572/ 0813.6213.4522 PELUANG BISNIS Erot sudah tidak diragukan lagi, ribuan pasien sudah tertolong dan sudah disembuhkan di sluruh kota- Harian kota di Indonesia, bahkan sampai kemancanagara dari keluhan laki-0laki seperti: Ganguan ereksi, penyakit kelamin secara medis sudah disembuhkan. RUMAH 2 LANTAI DIJUAL DEPOT AIR MINUM WASPADA Terapi Mak Erot ini mengutamakan ramuan. Doa-doa, pemijatan dan minyak poles. Tanpa bahan kimia dan tanpa perbedaan, tanpa efek samping. Jangan biarkan masalah anda berlarut-larut. Bagi wanita yang ingin punya keturunan, mau memperkencang dan memperbesar payudara disinilah tempatnya Ikut dengan perabotan, 3 Kmr Kalau mau pasang Menangani Keluhan Pria & Wanita murah dan bagus Tidur dan 3 Kmr Mandi, SHM, Belanja Barangnya Aja Untuk informasi KHUSUS PRIA - Ejakulasi dini KHUSUS WANITA - Ingin punya keturunan PLN, Jl. Eka Rasmi (Komp. Segala perlengkapan - Impotensi - Memperkencang dan memperbesar payudara Depot isi ulang R.O dan lebih lengkap hub - Memperbesar, panjang - Mengembalikan keperawanan Johor Town House), Blok C 12 Hexagonal - Keras, Tahan lama - Mengobati keputihan Hubungi : Ibu Catharine Siregar PANDAN PUTIH PAND ANDAN TEL. (061) 4576602 Dpt Diperoleh di Sumatera - Aceh HP 0812.403.8333 . Terdaftar Dinkes No. 448 Hak Paten No. 00.2004.09965.10041 Jl. Laksana No. 55J masuk dari Jl. Amaliun YUKI 0813.7524.8000 - 0812.6064.5000 Hub. 081361 309280/ 77642 832 FAX. (061) 4561347 Hub: (061) 7365429 - 7362887 Simpang Raya Medan (Praktek Tetap) 21. 24 Ekonomi & Bisnis WASPADA Jumat 20 November 2009 BUMN Watch Desak Direksi PLN Diganti J A K A R TA ( A n t a r a ) : ganggu, ujarnya. kapan dibangun pembangkit Keenam unit tersebut ada- BUMN Watch, lembaga swa- Dalam penanganan ma- baru dan transmisi listrik yang lah PLTU Labuan, Banten unit daya masyarakat yang me- salah pembangkit, Naldy juga baru. pertama 300 MW sesuai kon- nyoroti kinerja BUMN, men- tak melihat kemampuan ma- Saat ini PLN mengalami trak selesai 11 September 2009 dorong adanya pergantian najerial direksi PLN saat ini. defisit tak kurang dari 460 dan unit kedua 300 MW pada di jajaran direksi PT. PLN, se- Akibatnya saat terjadi ke- Mega Watt (MW). Berdasarkan 11 Desember 2009. bagai bentuk pertanggungja- rusakan sedikit saja, permasa- data BUMN Watch, dari 24 sis- Selanjutnya, PLTU Rem- waban atas ketidakmam- lahan tak bisa segera diatasi tem kelistrikan, terdapat 11 sis- bang, Jateng unit pertama 315 puan manajemen PLN mem- karena harus membeli suku tem di antaranya mengalami MW ditargetkan selesai pada berikan pelayanan yang baik cadang terlebih dulu, itu pun defisit. Selebihnya, hanya dua 21 September 2009 dan unit kepada konsumennya. sebagian harus diimpor. Se- sistem dalam kondisi normal kedua 315 MW pada 21 De- Hanya saja direksi baru dang birokrasi penganggaran dan 11 lainnya mengalami sember 2009, dan PLTU Indra- di PT PLN (Persero) itu se- tak mendukung dilakukannya status siaga. mayu, Jabar unit pertama 330 baiknya berasal dari kala- pembelian secara cepat, ucap 48 Persen MW pada September 2009 dan ngan internal perusahaan Naldy. Sementara PT PLN (Perse- unit kedua 330 MW pada De- agar bisa segera menangani Karena itu, menurut Naldy, ro) sampai akhir 2009 hanya sember 2009. berbagai permasalahan ter- saatnya Presiden SBY merom- mampu menyelesaikan pro- PLN menargetkan PLTU kait kelistrikan, kata Ketua bak total direksi PLN. yek pembangkit yang masuk Rembang unit kedua baru ber- Umum BUMN Watch Naldy Untuk ini, dia mengusul- program percepatan 10.000 operasi pada Maret 2010 dan Nazar Haroen di Jakarta, kan kepada Presiden SBY me- Mega Watt (MW) sebesar 915 PLTU Indramayu unit pertama Waspada/Armin Nasution Kamis. milih warga terbaik dari dalam MW atau 48 persen dari tar- Juni 2010 dan unit kedua pada IPO: BTN segera melakukan IPO (initial public offering) atau penawaran saham perdana ke publik. Di Medan Managing Naldy mengatakan, ke- PLN sendiri (pejabat karir) get sesuai kontrak sebanyak November 2010. Director BTN Saut Pardede didampingi Asosiation Director PT Mandiri Sekuritas Doni Arsal mengungkapkan rencana IPO bijakan pemadaman listrik yang rekam jejaknya baik dan 1.890 MW. Kontrak PLTU Labuan di- tersebut. yang dilakukan PLN dalam mengerti permasalah kelis- Data PLN yang diperoleh tandatangani pada 12 Maret beberapa bulan terakhir me- trikan saat ini dan ke depan. di Jakarta, Kamis menyebut- 2007 dengan kontraktor asal nimbulkan masalah di ma- BUMN Watch berharap kan, proyek yang selesai tahun China yakni Chengda Engi- Saham BTN Ditawarkan na-mana. Presiden SBY tak menunjuk di- ini adalah dua unit PLTU La- neering Corporation of China Kegiatan investasi ter- reksi PLN dari disiplin ilmu buan, Banten dengan total da- dan PT Truba Jurong Engineer- hambat, pendistribusian air lain. Bisa saja dia sukses me- ya 600 MW dan satu unit PLTU ing. minum terganggu, dan juta- ngelola BUMN lain, tapi tak Rembang, Jateng berdaya 315 Nilai kontraknya adalah Rp750-Rp1.100 an pengusaha menengah dan kecil terancam gulung tikar akibat pemadaman lis- trik secara bergilir yang akan mampu mengelola PLN dengan segudang masalah yang harus ditangani dalam waktu sesingkat mungkin, MW. Proyek PLTU Labuan unit pertama dengan daya 300 MW sudah beroperasi pada Okto- 373,428 juta dolar AS dan Rp1,395 triliun. PLTU Rembang yang me- miliki kontrak senilai 338,8 juta MEDAN ( Waspada): PT (BEI) pada 17 Desember 2009, dari menurunnya tingkat suku Untuk Sumatera, kami umumnya tanpa pemberita- kata Naldy. ber 2009 dan unit kedua juga dolar AS dan Rp2,474 triliun, Bank Tabungan Negara (BTN) sekaligus menjadi emiten ter- bunga dan cost of fund. sangat mengharapkan peran huan, katanya. Hal itu, lanjut Naldy, sangat sebesar 300 MW ditargetkan ditandatangani pada 21 Maret akan menawarkan 27,1 persen akhir yang melantai di bursa BTN pada tahun ini sudah investor Sumut, termasuk Pelayanan publik am- penting karena salah satu fo- rampung pada Desember 2007 dengan kontraktor asal atau sebanyak 2.360.057.000 pada tahun ini. menurunkan bunga kredit Sumsel di samping investor buradul, kenyamanan dan kus Kabinet Indonesia Bersatu 2009. Sedang, proyek PLTU Malaysia, Zelan-Priamanaya- saham ke publik dengan harga Bertindak sebagai penja- sebanyak 5 kali dari 15 persen dari Jawa dan daerah lain- keamanan rakyat banyak ter- II adalah penyediaan listrik Rembang unit pertama dengan Tronoh. kisaran Rp750-Rp1.100 per min pelaksana emisi IPO BTN dan saat ini sebesar 11,9 per- nya, katanya. ganggu. Padahal gaji mereka dan infrastruktur jalan. daya 315 MW akan selesai De- Sedang, kontrak PLTU In- lembar. ini adalah Mandiri Sekuritas sen, ungkapnya. Managing Director BTN (karyawan PLN) sudah naik Listrik, katanya, adalah sember 2009. dramayu senilai 696,734 juta Harga itu sama dengan dan CIMB Securities Indone- Semua persiapan untuk Saut Pardede mengatakan, sampai 300 persen. Jika ini faktor kunci, sehingga harus Padahal, sesuai kontrak, dolar AS dan Rp1,498 triliun PBV (price book value) 1,5 sia. melakukan IPO sudah dilaku- rencana ini ditujukan guna tak segera dibenahi, maka segera ditempatkan orang- terdapat sebanyak enam unit diteken 12 Maret 2007 dengan hingga 2,2 kali, kata Head of Dalam kesempatan yang kan. Dan besok (hari ini-red) memperkuat permodalan target pertumbuhan ekono- orang yang profesional di bi- dari tiga lokasi di Jawa yang di- kontraktor asal China, Sino- Invesment Banking Mandiri sama Direktur Utama BTN Iq- rencana ini resmi diumumkan agar ekspansi kredit terus di- mi Kabinet Indonesia Ber- dang kelistrikan. Harus ada targetkan selesai tahun ini de- mach-CNEEC-PT Penta Adi Sekuritas Irman Rahman, da- bal Latanro mengatakan dana ke publik, ujar Managing Di- laksanakan. IPO akan lebih satu Jilid II akan sangat ter- inventarisasi yang lebih jelas ngan total daya 1.890 MW. Samudera. lam acara ekspose publik pe- hasil IPO tersebut akan digu- rector BTN Saut Pardede di- menjamin pemenuhan fasi- nawaran umum perdana (IPO) nakan untuk ekspansi kredit dampingi Asosiation Director litas pembiayaan peruma- saham BTN di Jakarta, Kamis (19/11). Menurut Irman, dalam guna mengejar target pertum- buhan 20 persen pada 2010. Dana hasil IPO PT Mandiri Sekuritas Doni Ar- sal kepada wartawan di Me- dan, Rabu (18/11) malam. han bagi masyarakat, ka- tanya. Dengan IPO, BTN ingin Emas Capai Rekor Baru, Euro Menguat menawarkan saham BTN ini Jika dana hasil IPO ini tidak PT Mandiri Sekuritas dan tumbuh menjadi perusaha- nya emas dan ngisyaratkan bahwa hal itu dah untuk berinvestasi di aset pihaknya akan melakukan mencukupi untuk mendorong PT CIMB Sekuritas dipercaya an publik yang lebih baik dan minyak, kata akan menjaga tingkat suku yang lebih tinggi-menghasil- road show ke kota-kota di In- pertumbuhan kredit, lanjut menjadi penjamin emisi. Aso- diharapkan proses ini mem- para analis. bunga rendah untuk semen- kan luar negeri, meningkatkan donesia dan luar negeri. Iqbal, pihaknya juga telah ciation Director Mandiri Seku- beri peningkatan keuntu- E m a s tara waktu. tekanan pada dolar. Untuk ke luar negeri sa- mempersiapkan beberapa pe- ritas Doni mengatakan, de- ngan baik bagi pemegang sa- mencapai re- Greenback telah melemah Di tempat lain pada Rabu, ham BTN akan ditawarkan ke nambahan modal yang akan ngan kekuatan BTN saat ini, ham maupun pemangku ke- kor puncak terus terhadap euro dalam be- poundsterling Inggris maju investor Asia, Eropa, kecuali dilakukan tahun depan. pihaknya yakin saham yang pentingan. 1.152,85 dolar berapa bulan terakhir karena terhadap dolar karena men- AS, jelas Irman. Dia juga me- Kami sudah memasuk- dilepas diminati investor. Selain itu, dengan IPO LONDON (Antara): Euro per ons dalam perdagangan Federal Reserve, bank sentral cerna berita bahwa Bank of negaskan bahwa sebagian be- kan rencana penerbitan obli- Baik Saut maupun Doni, diharapkan BTN mampu naik terhadap dolar pada Ra- di London Bullion Market sete- AS, telah mempertahankan England pembuat kebijakan sar sahamnya akan ditawar- gasi keempatbelas, KIK EBA, belum bersedia menerangkan merealisasikan target per- bu (18/11) waktu setempat, lah mencapai serangkaian suku bunga mendekati nol. tersebut dibagi tiga cara ke- kan investor institusi. kata Iqbal. Obligasi yang diter- lebih jauh tentang saham yang tumbuhan pembiayaan dengan selera investor untuk puncak baru dalam beberapa Kepala Bank Sentral Eropa putusan baru-baru ini mereka Bank yang fokus dalam bitkan itu sekitar Rp1 hingga akan diperdagangkan. Dise- perumahan subsidi 100.000 unit Eropa berisiko mening- minggu. Jean-Claude Trichet pada Sela- untuk memompa lebih ba- pemberian kredit perumahan Rp1,4 triliun. butkannya, sekitar 60 persen unit tahun 2010. Sementara katnya di tengah tanda-tan- Pelemahan greenback sa bergabung dengan mitra- nyak uang baru ke dalam eko- (KPR) ini diperkirakan akan Iqbal juga menegaskan dari saham yang dijajakan di untuk pembiayaan peru- da bahwa pemerintah akan membuat harga aset berdeno- nya AS dalam menyuarakan nomi yang terpukul resesi. mencatatkan saham hasil IPO bahwa target pertumbuhan 20 pasar lokal dan sisanya untuk mahan nonsubsidi sekitar terus mempertahankan ren- minasi dolar seperti emas le- dukungan untuk dolar yang BoE setuju awal bulan ini ini di Bursa Efek Indonesia persen tersebut tidak terlepas asing. 50.000 unit.(m13) cana stimulus ekonomi skala bih murah bagi pembeli yang lebih kuat. untuk memompa keluar seba- besar di tempatnya untuk menggunakan mata uang Kekuatan dolar ... bukan nyak 25 miliar pound (28 mi- saat ini. kuat, cenderung untuk me- hanya dalam kepentingan liar euro, 42 miliar dolar AS) Negara Maju Dinilai Tak Peduli Krisis Pangan Dalam perdagangan sore di London, euro telah berja- rangsang permintaan terha- dap mereka. Amerika Serikat tetapi seluruh masyarakat internasional ju- tunai segar langkah yang di- dukung oleh tujuh dari sem- lan pada 1,4989 dolar, diban- Pedagang mengatakan ga, Trichet mengatakan kepa- bilan pembuat kebijakan ROMA (Waspada): Anca- Ban Ki Mon, Presiden Mesir (FAO) Jacques Diouf. Menurut- krisis global telah mengan- dingkan dengan 1,4873 akhir dolar secara keseluruhan ber- da koran Prancis. Keterangan- termasuk gubernur bank Mer- man krisis pangan menjadi Husni Mubarak, Presiden Zim- nya, tanpa kehadiran para pe- cam masalah pangan di du- Selasa di New York. nada lemah tetapi utuh berkat nya menyusul komentar kepa- vyn King. persoalan global. Hampir 1 mi- babwe Robert Mugabe, serta mimpin dunia, maka perte- nia. Dunia membutuhkan Euro naik terhadap unit prospek suku bunga US yang la Fed Ben Bernanke pada Se- Di London pada Rabu liar penduduk dunia terancam PM Bangladesh. Dan Indone- muan di RIma ini hanya akan banyak dana untuk menga- Jepang, naik ke 133,97 yen rendah yang tersisa untuk be- nin, ketika ia menekankan 1,4873 dolar akhir Selasa, pada kelaparan. Tapi sayangnya, ti- sia mengirimkan Wapres Boe- menjadi forum teknis. mankan pasokan pangan. dari 132,76 yen pada akhir berapa waktu. pentingnya penguatan dolar. 133,97 yen (132,76), 0,8947 dak ada satupun negara maju diono. Jika tidak pemimpin de- Faktanya adalah kita Selasa, sementara dolar naik Tren dasar pasar untuk Mata uang AS sedang digu- pound (0,8848) dan 1,5111 yang mengirimkan perwakilan Ada kesepakatan antara ngan otoritas luas, yang dapat butuh 44 miliar dolar AS se- ke 89,37 yen dari 89,25 yen. dolar yang lemah tidak beru- nakan oleh investor untuk apa franc Swiss (1,5112). Dolar dalam World Summit on negara berkembang untuk sa- mengkoordinir langkah, maka tiap tahun dan kita telah me- Euro juga didorong oleh bah, kata Hideaki Inoue, ke- yang disebut carry trade berdiri di 89,37 yen (89,25) dan Food Security. ling membantu dan memberi- kita menghadapi masalah. Ki- lihat bahwa 1,34 triliun dolar kenaikan baru-baru ini pasar pala manajer valuta asing di membawa perdagangan di- 1,0081 franc Swiss (1,0157). Negara-negara maju ku- kan dukungan, terangnya. ta mengurangi isunya menjadi AS per tahun dihabiskan un- saham dan peningkatan Mitsubishi UFJ Trust dan Ban- mana mereka meminjam Pound berada pada 1,6752 rang memberikan perhatian. Ada 5 poin disepakati yakni murni dimensi teknis, ujar tuk belanja senjata. Kita telah harga bahan baku, khusus- king Corp The Fed telah me- uang dolar pada tingkat ren- dolar (1,6808). Tidak mengirimkan perwaki- saling memberikan bantuan Diouf dalam konferensi penu- melihat kabar tentang ke- lan sama sekali, kata Mentan di bidang ketahanan pangan, tup seperti dikutip dari AFP. mungkinan menggerakkan Suswono di Roma, Italia, Rabu (18/11) malam. Konferensi digelar di mar- kerjasama regional. menerap- kan strategi ketahanan pa- ngan, efektivitas negara pada Sekitar pimpinan 60 nega- ra hadir dalam pertemuan 3 World Summit on Food Secu- triliunan dolar dana untuk mengatasi krisis finansial, RI Targetkan Ekspor CPO Tumbuh 10 Persen kritik Diouf. JAKARTA (Antara): Indo- taan CPO masih lebih tinggi 19,2 juta ton dan pada tahun sional, GAPKI menjadikan kas FAO di Roma sejak 16-18 ketahanan pangan termasuk rity. PM Italia, Silvio Berlusconi Saya hanya berfikir kika November ini pun hanya dida- pada prioritas pertanian pada menjadi satu-satunya pemim- nesia menargetkan ekspor dari pasokan, ujar Sekjen Ga- ini diperkirakan produksi bisa pembangunan industri sawit memungkinkan untuk me- minyak sawit mentah (CPO) bungan Pengusaha Kelapa Sa- menembus angka 21 juta ton. secara berkelanjutan dan les- tangi sejumlah pemimpin ne- anggaran belanja. pin negara maju yang hadir. mobilisasi (dana-dana itu), tumbuh sebesar 10 persen wit Indonesia, Joko Supriyono, Tahun depan produksi tari sebagai tema utama pada gara berkembang saja, seperti Ketidakhadiran para pe- Sisanya hanya mengirim per- Presiden Brazil Lula mimpin dunia juga disoroti wakilannya. maka ada kemungkinan juga atau sekitar 17,6 juta ton di- di Jakarta, Kamis (19/11), di se- CPO nasional pasti di atas 20 Indonesia Palm Oil Confer- Da Silva, Presiden Libya oleh Direktur Jenderal Organi- Padahal forum ini dinilai untuk memberikan fokus bandingkan tahun ini yang la pemaparan rencana Indo- juta ton, karena tahun ini saya ence (IPOC) & Outlook 2010 Muamar Khadafi, Sekjen PBB sasi Pertanian dan Pangan PBB sangat penting mengingat lebih kepada 1 miliar pen- diproyeksikan akan menca- nesia Palm Oil Conference & diproyeksikan produksi akan yang akan diselenggarakan di duduk yang kelaparan di du- pai sekitar 16 juta ton. Outlook 2010 di Bali, pada 2- menembus angka 21 juta ton, Nusa Dua, Bali, pada 2-4 De- nia, ujarnya.(dtc) Pertumbuhan permin- 4 Desember 2009, kata Joko. sember 2009. XL Dapatkan Persetujuan Lakukan PUT I Kondisi itu, lanjut dia, me- nyebabkan potensi pasar CPO Dia mengakui bisnis CPO mengalami tantangan yang Ketua penyelenggara Mo- na Surya mengatakan pada MEDAN (Waspada): Rapat Umum Pemegang Saham Luar mercial Bank, pinjaman dari PT Bank Mandiri Tbk, pinja- program layanan pengiriman atau pembayaran uang ini Penjualan Mobil Tahun Ini masih sangat tinggi dan indus- tri CPO memiliki prospek yang sangat berat, terkait industri tersebut masih mengandalkan konferensi internasional ke- 5 yang diselenggarakan GAPKI Biasa PT Excelcomindo Prata- ma Tbk (XL) berlangsung di man dari PT Bank Mizuho In- donesia, pinjaman dari DBS akan semakin memperkaya manfaat layanan XL sekaligus Lebih Rendah baik. Sampai September 2009, ekspor CPO nasional telah pasar ekspor yang banyak hambatannya, terutama di itu, pihaknya mengangkat te- ma Sustainable Palm Oil De- grhaXL, Jakarta, Senin (16/11), Bank Ltd, dan pinjaman dari juga untuk memenuhi besar- JAKARTA (Antara): Penjualan mobil nasional sepanjang mencapai 11,47 juta ton. Uni Eropa yang menerapkan velopmen:Challange and Op- telah terlaksana dan memu- Export Kreditnamnden (EKN) nya kebutuhan pelanggan. tahun 2009 diperkirakan akan lebih rendah daripada pen- Dia mengatakan dengan berbagai standar lingkungan. portunities. tuskan sejumlah keputusan Buyer Credit Facility didanai Kami akan segera menyiap- jualan selama tahun 2008. asumsi, ekspor CPO nasional Padahal Indonesia telah Menurut dia, kampanye penting. Swedish Export Credit Corpo- kan program ini sehingga akan Hal itu dikarenakan selama 10 bulan 2009 penjualan sebesar 1,2 juta sampai 1,3 juta memiliki peraturan yang men- pembangunan industri sawit Keputusan penting terca- ration). dapat diluncurkan dalam wak- mobil nasional baru mencapai 389.711 unit atau hanya 64,1 ton per bulan, maka sampai jamin pengembangan perke- lestari itu sangat penting di te- pai antara lain persetujuan un- Saham Baru hasil pelak- tu tidak lama lagi, tuturnya. persen dari penjualan 2008, ungkap data penjualan mobil akhir tahun ekspor CPO akan bunan CPO secara lestari (sus- ngah semakin gencarnya isu tuk melakukan Penawaran sanaan HMETD ini akan dica- Selain itu, RUPS LB juga nasional dirilis Gabungan Industri Kendaraan Bermotor mendekati angka 16 juta ton. tainable). Pengusaha dan pe- lingkungan terhadap industri Umum Terbatas I (PUT) dalam tatkan di BEI bersama-sama menyetujui perubahan nama Indonesia (Gaikindo), Kamis (19/11). Pada tahun lalu ekspor merintah harus lebih berani CPO nasional. rangka Penerbitan Hak Meme- dengan saham-saham telah persero. Nama baru perseroan Disebutkan, penjualan mobil per bulannya selama 2009 CPO Indonesia mencapai 14,7 dan percaya diri bahwa kebija- Konferensi tersebut akan san Efek Terlebih Dahulu (HM- dicatatkan sebelumnya oleh adalah PT XL Axiata Tbk, dima- lebih rendah ketimbang penjualan mobil per bulannya sela- juta ton. Sampai September kan dan sistem yang diterap- dibuka oleh Menko Perekono- ETD) serta persetujuan untuk Perseroan. Dengan asumsi, se- na nama tersebut dimaksud- ma 2008. Dalam sisa waktu dua bulan lagi untuk tahun ini, 2009 ekspor CPO telah tumbuh kan di Indonesia sudah mene- mian Hatta Rajasa dan sejum- menggelar layanan Pembaya- luruh HMETD dilaksanakan kan agar Perseroan melalui diprediksi penjualan mobil 2009 tidak akan melampaui sekitar 16 persen, ujarnya. rapkan konsep pengemba- lah menteri yaitu Menteri Per- ran Pengiriman Uang melalui maka jumlah saham Persero- Axiata Group Berhad dapat penjualan 2008. Dia memperkirakan dalam ngan perkebunan CPO secara tanian Suswono dan Menteri jaringan telekomunikasi. an akan dikeluarkan dalam menembus pasar regional dan Sementara itu selama 10 bulan 2009 penjualan mobil hitungan konvensional ekspor lestari, sehingga kita tidak di- Perdagangan Mari E Pangestu XL berencana melakukan rangka PUT I menjadi seba- memberikan pelayanan lebih produk Astra Internasional masih mendominasi dengan CPO masih tumbuh sekitar 10 kendalikan standar asing, ujar juga akan hadir sebagai pem- Penawaran Umum Terbatas nyak 1.418.000.000 saham de- luas dan lebih terjangkau ke- pangsa pasar sekitar 58 persen. persen tahun 2010. Joko. bicara yang memaparkan ke- (PUT) I dalam rangka pener- ngan demikian jumlah seluruh pelanggannya didukung sem- Mobil Toyota dan Daihatsu masih merajai penjualan Sedangkan produksi, lan- Dikatakannya, sampai saat bijakan Indonesia dalam pe- bitan Hak Memesan Efek Ter- akan dicatatkan menjadi se- bilan operator lainnya di Asia mobil produk Astra. Kemudian disusul produk mobil non jut Joko, juga mengalami per- ini masih banyak kampanye ngembangan industri CPO. lebih Dahulu (HMETD) de- jumlah 8.508.000.000 saham. seperti layanan Roaming Black Astra yakni Mitsubishi, Suzuki dan Honda.(dtc) tumbuhan. Tahun 2008 pro- negatif terhadap CPO yang di- Selain itu juga akan hadir ngan harga pemesanan sebe- Rapat Umum Pemegang Berry/GPRS murah. (m09) duksi CPO nasional mencapai lakukan secara berkesinambu- berbagai pembicara dari pela- sar Rp2.000 perlembar saham. Saham Luar Biasa juga menye- ngan dan sistematis. ku dan pengamat CPO inter- Dana diperoleh dari PUT tujui penambahan kegiatan Harga Emas Di Medan Valuta Asing Di Medan Oleh karena itu, ia berha- nasional, seperti Sime Darby I senilain total Rp2.836.000. usaha perseroan berupa Laya- Mata Uang Jual Beli rap pemerintah menegakkan (perusahaan CPO asal Malay- 000.000 setelah dikurangi de- nan Pembayaran Pengiriman Jenis Kadar Harga aturan terkait pembangunan sia) serta pengamat seperti Ja- ngan biaya-biaya Emisi, selu- Uang Melalui Jaringan Teleko- Dolar AS 9.470 9.300 London Murni 99% Rp335.000 Dolar Australia 8.924 8.651 perkebunan CPO secara lestari mes Fry (LMC Internasional) ruhnya akan digunakan untuk munikasi Perseroan. Dengan Franc Swiss 9.492 9.138 dan pengusaha di dalam nege- dan Dorab E Mistry (Godrej In- London 97% Rp290.000 membayar hutang Perseroan, demikian XL akan segera meng- Poundsterling Inggris 15.971 15.605 ri juga memiliki komitmen ternational Ltd). yaitu pembayaran pinjaman gelar program pembayaran atau 24 Karat 90 s/d 93% Rp260.000 Dolar Hongkong 1.258 1.164 menjalankannya. Kami memperkirakan sindikasi dari DBS Bank Ltd, pengiriman uang melalui Emas Putih 75 % Rp230.000 Yen Jepang 107,43 103,18 IPOC sekitar 800 peserta akan hadir Export Development Canada, jaringan telekomuni-kasi. 22 Karat 70% Rp165.000 Dolar Singapura 6.882 6.680 Terkait dengan upaya pada konferensi tersebut baik The Bank of Tokyo-Mitsubishi Euro 14.225 13.887 Presiden Direktur XL, Has- Suasa 20 s/d 35% Rp100.500 memberi pengertian pada du- dari dalam maupun luar ne- Ringgit Malaysia 2.805 2.780 UFJ Ltd, dan Chinatrust Com- nul Suhaimi, mengatakan, nia mengenai industri CPO na- geri, ujar Mona.